--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Nov 18 01:49:29 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/105/CG30273-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1036.00 -1048.42
2 -1036.01 -1047.81
--------------------------------------
TOTAL -1036.00 -1048.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.624995 0.012503 0.438680 0.863462 0.611797 1249.03 1375.01 1.000
r(A<->C){all} 0.105391 0.001385 0.038143 0.181528 0.101938 837.82 881.02 1.000
r(A<->G){all} 0.311309 0.004988 0.174282 0.444794 0.307842 666.23 713.82 1.000
r(A<->T){all} 0.050957 0.001008 0.001344 0.109184 0.046350 651.22 711.42 1.000
r(C<->G){all} 0.087632 0.000906 0.030816 0.145342 0.085079 833.08 989.05 1.000
r(C<->T){all} 0.369866 0.004975 0.243559 0.516242 0.365753 672.25 740.70 1.001
r(G<->T){all} 0.074845 0.001259 0.014436 0.144237 0.070880 703.06 865.65 1.000
pi(A){all} 0.205809 0.000370 0.170731 0.245775 0.205589 1153.10 1255.89 1.000
pi(C){all} 0.340978 0.000497 0.295693 0.383798 0.340912 1030.76 1160.42 1.001
pi(G){all} 0.257333 0.000418 0.217707 0.297151 0.257194 1236.59 1283.30 1.000
pi(T){all} 0.195880 0.000352 0.160405 0.233346 0.195810 1131.40 1153.42 1.000
alpha{1,2} 0.092558 0.002990 0.000206 0.181726 0.093588 979.09 1144.70 1.000
alpha{3} 1.917777 0.615414 0.653820 3.433554 1.782068 1320.72 1360.63 1.000
pinvar{all} 0.284450 0.012594 0.069792 0.495317 0.288632 922.30 1132.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -912.43635
Model 2: PositiveSelection -912.436351
Model 0: one-ratio -920.045838
Model 3: discrete -912.175986
Model 7: beta -912.256202
Model 8: beta&w>1 -912.187714
Model 0 vs 1 15.218976000000112
Model 2 vs 1 1.9999999949504854E-6
Model 8 vs 7 0.1369760000000042
>C1
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQHQ
AVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C2
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQHQ
TVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C3
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQHQ
TVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHSTAPPPVVIIQHQ
TVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSPAPPPVVIIQHQ
TVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C6
MQYNQQQPGYPHQTPPPSYEQVVHVQAPVRVVHTTAPPPVVIIQHQAVLP
VGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCACLPYC
ATSCMNANHFCGNCNKFVGVYNGDoooo
>C7
MQYNQQPGYPHQMPPPSYEQVVHVQAPVRVVHTTAPPPVVIIQHQAALPV
GPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCACLPYCA
TSCMNANHFCGNCNKFVGVYNSDooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=134
C1 MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
C2 MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
C3 MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
C4 MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
C5 MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
C6 MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
C7 MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
****** .*** ** ************** **** . ****:*****
C1 QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C2 QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C3 QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C4 QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C5 QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
C6 QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
C7 QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
*:.*******:********:******:******** :*************
C1 CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C2 CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C3 CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C4 CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C5 CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C6 CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
C7 CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo
***************************.*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 128 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 128 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5800]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [5800]--->[5726]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.358 Mb, Max= 30.588 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C2
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C3
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C6
MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
>C7
MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo
FORMAT of file /tmp/tmp2594903912118287865aln Not Supported[FATAL:T-COFFEE]
>C1
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C2
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C3
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C6
MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
>C7
MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:134 S:97 BS:134
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 96.88 C1 C2 96.88
TOP 1 0 96.88 C2 C1 96.88
BOT 0 2 98.44 C1 C3 98.44
TOP 2 0 98.44 C3 C1 98.44
BOT 0 3 96.85 C1 C4 96.85
TOP 3 0 96.85 C4 C1 96.85
BOT 0 4 93.70 C1 C5 93.70
TOP 4 0 93.70 C5 C1 93.70
BOT 0 5 95.16 C1 C6 95.16
TOP 5 0 95.16 C6 C1 95.16
BOT 0 6 95.93 C1 C7 95.93
TOP 6 0 95.93 C7 C1 95.93
BOT 1 2 98.44 C2 C3 98.44
TOP 2 1 98.44 C3 C2 98.44
BOT 1 3 96.85 C2 C4 96.85
TOP 3 1 96.85 C4 C2 96.85
BOT 1 4 93.70 C2 C5 93.70
TOP 4 1 93.70 C5 C2 93.70
BOT 1 5 92.74 C2 C6 92.74
TOP 5 1 92.74 C6 C2 92.74
BOT 1 6 93.50 C2 C7 93.50
TOP 6 1 93.50 C7 C2 93.50
BOT 2 3 97.64 C3 C4 97.64
TOP 3 2 97.64 C4 C3 97.64
BOT 2 4 94.49 C3 C5 94.49
TOP 4 2 94.49 C5 C3 94.49
BOT 2 5 94.35 C3 C6 94.35
TOP 5 2 94.35 C6 C3 94.35
BOT 2 6 95.12 C3 C7 95.12
TOP 6 2 95.12 C7 C3 95.12
BOT 3 4 94.53 C4 C5 94.53
TOP 4 3 94.53 C5 C4 94.53
BOT 3 5 92.74 C4 C6 92.74
TOP 5 3 92.74 C6 C4 92.74
BOT 3 6 93.50 C4 C7 93.50
TOP 6 3 93.50 C7 C4 93.50
BOT 4 5 91.13 C5 C6 91.13
TOP 5 4 91.13 C6 C5 91.13
BOT 4 6 91.06 C5 C7 91.06
TOP 6 4 91.06 C7 C5 91.06
BOT 5 6 96.85 C6 C7 96.85
TOP 6 5 96.85 C7 C6 96.85
AVG 0 C1 * 96.16
AVG 1 C2 * 95.35
AVG 2 C3 * 96.41
AVG 3 C4 * 95.35
AVG 4 C5 * 93.10
AVG 5 C6 * 93.83
AVG 6 C7 * 94.33
TOT TOT * 94.93
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
C2 ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
C3 ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
C4 ATGCAGTACAATCAGCAGCCGGCGGGAGCCCCGGGCTATCCCACCCACCA
C5 ATGCAGTACAATCAGCAACCACCGGGAGCCACGGGCTATCCCCCCCACCA
C6 ATGCAGTACAACCAACAGCAG---------CCGGGGTATCCG---CACCA
C7 ATGCAGTACAATCAACAA------------CCGGGGTATCCA---CATCA
*********** **.**. .**** ***** ** **
C1 GATGCCCCCACCGAGCTATGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
C2 GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGATC
C3 GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
C4 GATGCCACCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCCATTC
C5 GGTGCCACCACCCAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAATTC
C6 GACGCCTCCTCCGAGCTACGAGCAAGTGGTCCATGTGCAGGCGCCAGTTC
C7 GATGCCGCCACCGAGCTACGAGCAAGTGGTCCATGTTCAGGCGCCAGTTC
*. *** **:** ***** *****.***** ** ** ********..:**
C1 GGGTGGTTCACCACACGACAGCACCTCCGCCCGTGGTGATCATACAACAT
C2 GGGTGGTTCACCACACGGCAGCACCTCCGCCCATGGTGATCATACAACAT
C3 GGGTGGTTCACCACACGGCAGCACCTCCGCCCGTGGTGATCATACAACAT
C4 GGGTGGTTCACTCGACC---GCACCACCGCCCGTGGTGATCATACAACAT
C5 GGGTGGTTCACTCGCCA---GCCCCGCCGCCCGTGGTGATCATACAACAT
C6 GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
C7 GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
*********** . .* **.** ******.*****************
C1 CAAGCTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C2 CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C3 CAAACTGTATTACCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C4 CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C5 CAGACCGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C6 CAAGCCGTGCTACCCGTGGGTCCCGACCCCAGTTTCATCACCTGCCCGCA
C7 CAAGCTGCATTGCCCGTGGGTCCCGATCCCAGCTTCATCACGTGCCCACA
**..* * . *.** ******** ** **** ******** *****.**
C1 TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGTGTGAAAA
C2 TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
C3 TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
C4 CTGCCACATCCAGAAGCTGACTCGCGTGGAGTACTCGCCCAGTGTGAAGA
C5 CTGCCATGTCCAGAAGCTGACCCGCGTGCAGTACTCGCCCAGTGTGAAAA
C6 CTGTCACGTCCAGAAACTGACCCGCGTCGAGTACTCGCCCAGTGTGAAAA
C7 TTGTCATGTCCAGAAACTGACCCGCGTTGAGTATTCGCCGAGTGTTAAAA
** ** .*******.***** ***** **** ***** ** ** **.*
C1 CTCACTGCATGGCCGCCATTCTATGCATCGTTGGCCTCTGGTGTTGTGCC
C2 CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
C3 CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
C4 CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
C5 CGCACTGCATGGCCGCCATTCTGTGCATCGTTGGCCTCTGGTGCTGTGCC
C6 CGCACGTCATGGCCGCCATTCTCTGCATAGTTGGCCTCTGGTGCTGCGCC
C7 CACACGTTATAGCCGCCATTCTCTGCATAGTCGGCCTCTGGTGTTGCGCC
* *** **.*********** *****.** *********** ** ***
C1 TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
C2 TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
C3 TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
C4 TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
C5 TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
C6 TGTCTTCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
C7 TGCCTGCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
** ** ** *********************** **.******** *****
C1 CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C2 CAATTGCAATAAGTTCGTCGGCGTCTACAACAGTGAT-------------
C3 CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C4 CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C5 CAATTGCAACAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C6 CAATTGCAACAAGTTCGTCGGCGTCTACAACGGCGAT-------------
C7 CAATTGCAACAAGTTCGTCGGCGTGTACAACAGCGAT-------------
********* ************** ******.* ***
C1 --
C2 --
C3 --
C4 --
C5 --
C6 --
C7 --
>C1
ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
GATGCCCCCACCGAGCTATGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
GGGTGGTTCACCACACGACAGCACCTCCGCCCGTGGTGATCATACAACAT
CAAGCTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGTGTGAAAA
CTCACTGCATGGCCGCCATTCTATGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C2
ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGATC
GGGTGGTTCACCACACGGCAGCACCTCCGCCCATGGTGATCATACAACAT
CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGTGAT-------------
--
>C3
ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
GGGTGGTTCACCACACGGCAGCACCTCCGCCCGTGGTGATCATACAACAT
CAAACTGTATTACCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C4
ATGCAGTACAATCAGCAGCCGGCGGGAGCCCCGGGCTATCCCACCCACCA
GATGCCACCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCCATTC
GGGTGGTTCACTCGACC---GCACCACCGCCCGTGGTGATCATACAACAT
CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
CTGCCACATCCAGAAGCTGACTCGCGTGGAGTACTCGCCCAGTGTGAAGA
CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C5
ATGCAGTACAATCAGCAACCACCGGGAGCCACGGGCTATCCCCCCCACCA
GGTGCCACCACCCAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAATTC
GGGTGGTTCACTCGCCA---GCCCCGCCGCCCGTGGTGATCATACAACAT
CAGACCGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
CTGCCATGTCCAGAAGCTGACCCGCGTGCAGTACTCGCCCAGTGTGAAAA
CGCACTGCATGGCCGCCATTCTGTGCATCGTTGGCCTCTGGTGCTGTGCC
TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
CAATTGCAACAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C6
ATGCAGTACAACCAACAGCAG---------CCGGGGTATCCG---CACCA
GACGCCTCCTCCGAGCTACGAGCAAGTGGTCCATGTGCAGGCGCCAGTTC
GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
CAAGCCGTGCTACCCGTGGGTCCCGACCCCAGTTTCATCACCTGCCCGCA
CTGTCACGTCCAGAAACTGACCCGCGTCGAGTACTCGCCCAGTGTGAAAA
CGCACGTCATGGCCGCCATTCTCTGCATAGTTGGCCTCTGGTGCTGCGCC
TGTCTTCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
CAATTGCAACAAGTTCGTCGGCGTCTACAACGGCGAT-------------
--
>C7
ATGCAGTACAATCAACAA------------CCGGGGTATCCA---CATCA
GATGCCGCCACCGAGCTACGAGCAAGTGGTCCATGTTCAGGCGCCAGTTC
GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
CAAGCTGCATTGCCCGTGGGTCCCGATCCCAGCTTCATCACGTGCCCACA
TTGTCATGTCCAGAAACTGACCCGCGTTGAGTATTCGCCGAGTGTTAAAA
CACACGTTATAGCCGCCATTCTCTGCATAGTCGGCCTCTGGTGTTGCGCC
TGCCTGCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
CAATTGCAACAAGTTCGTCGGCGTGTACAACAGCGAT-------------
--
>C1
MQYNQQPAGAPGYPoHQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C2
MQYNQQPAGAPGYPoHQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C3
MQYNQQPAGAPGYPoHQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHSToAPPPVVIIQH
QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSPoAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C6
MQYNQQQoooPGYPoHQTPPPSYEQVVHVQAPVRVVHTToAPPPVVIIQH
QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNGD
>C7
MQYNQQooooPGYPoHQMPPPSYEQVVHVQAPVRVVHTToAPPPVVIIQH
QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 7 taxa and 402 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479433385
Setting output file names to "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1916063435
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5152428019
Seed = 24113112
Swapseed = 1479433385
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 22 unique site patterns
Division 2 has 16 unique site patterns
Division 3 has 53 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1357.374785 -- -24.557203
Chain 2 -- -1356.395700 -- -24.557203
Chain 3 -- -1342.859931 -- -24.557203
Chain 4 -- -1298.223851 -- -24.557203
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1366.486141 -- -24.557203
Chain 2 -- -1286.949097 -- -24.557203
Chain 3 -- -1338.063912 -- -24.557203
Chain 4 -- -1362.306675 -- -24.557203
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1357.375] (-1356.396) (-1342.860) (-1298.224) * [-1366.486] (-1286.949) (-1338.064) (-1362.307)
500 -- (-1082.767) (-1074.406) [-1073.494] (-1076.975) * (-1069.161) (-1073.526) [-1072.496] (-1073.898) -- 0:33:19
1000 -- (-1065.671) (-1064.366) [-1056.792] (-1071.114) * (-1063.113) (-1076.171) [-1062.534] (-1062.071) -- 0:16:39
1500 -- (-1053.633) (-1069.484) (-1052.735) [-1055.924] * (-1058.232) (-1060.855) [-1054.230] (-1064.158) -- 0:11:05
2000 -- (-1065.618) [-1047.229] (-1046.981) (-1043.240) * [-1059.367] (-1059.586) (-1044.217) (-1056.749) -- 0:08:19
2500 -- (-1050.827) [-1043.390] (-1046.613) (-1044.741) * (-1050.325) (-1051.940) [-1043.916] (-1043.442) -- 0:06:39
3000 -- (-1050.894) (-1038.255) (-1044.144) [-1037.594] * (-1042.108) (-1049.942) [-1046.494] (-1047.200) -- 0:05:32
3500 -- [-1048.903] (-1041.878) (-1047.309) (-1039.090) * (-1039.347) (-1050.231) (-1052.712) [-1039.711] -- 0:04:44
4000 -- [-1042.391] (-1042.230) (-1045.570) (-1038.397) * (-1040.286) (-1041.821) [-1039.825] (-1046.606) -- 0:04:09
4500 -- (-1045.806) (-1044.937) (-1042.927) [-1044.055] * (-1040.946) [-1041.197] (-1040.306) (-1039.858) -- 0:03:41
5000 -- (-1045.793) (-1035.381) (-1044.427) [-1042.316] * (-1043.759) [-1038.301] (-1049.432) (-1041.241) -- 0:06:38
Average standard deviation of split frequencies: 0.047140
5500 -- (-1042.654) [-1036.027] (-1044.777) (-1047.722) * [-1044.409] (-1042.376) (-1045.918) (-1042.183) -- 0:06:01
6000 -- (-1041.339) (-1035.582) (-1047.030) [-1034.581] * (-1039.461) (-1038.540) (-1037.434) [-1045.730] -- 0:05:31
6500 -- (-1043.246) (-1040.731) (-1051.004) [-1036.660] * (-1039.836) [-1040.555] (-1037.700) (-1042.126) -- 0:05:05
7000 -- (-1044.875) [-1034.066] (-1041.492) (-1042.808) * (-1043.696) (-1047.755) (-1036.852) [-1034.437] -- 0:04:43
7500 -- (-1043.670) (-1043.177) [-1047.366] (-1040.167) * [-1041.066] (-1047.877) (-1035.996) (-1044.710) -- 0:04:24
8000 -- [-1042.279] (-1049.455) (-1038.253) (-1037.845) * (-1039.752) [-1039.225] (-1038.395) (-1043.289) -- 0:04:08
8500 -- (-1047.542) (-1049.700) [-1042.134] (-1039.255) * (-1038.058) [-1038.642] (-1044.546) (-1044.511) -- 0:03:53
9000 -- (-1042.882) (-1051.692) [-1037.498] (-1031.904) * [-1042.202] (-1041.054) (-1042.320) (-1037.292) -- 0:05:30
9500 -- (-1040.829) [-1038.722] (-1040.915) (-1041.605) * (-1036.771) (-1038.808) (-1048.517) [-1040.915] -- 0:05:12
10000 -- (-1054.252) (-1037.042) [-1039.798] (-1042.439) * (-1046.410) (-1036.337) [-1036.592] (-1051.126) -- 0:04:57
Average standard deviation of split frequencies: 0.044194
10500 -- [-1039.868] (-1042.005) (-1040.534) (-1040.915) * (-1037.726) [-1036.099] (-1041.996) (-1035.693) -- 0:04:42
11000 -- (-1038.106) (-1039.677) (-1055.406) [-1038.951] * (-1038.195) (-1041.194) [-1039.134] (-1041.154) -- 0:04:29
11500 -- (-1042.170) [-1044.928] (-1046.604) (-1035.518) * (-1042.028) [-1038.041] (-1036.122) (-1044.203) -- 0:04:17
12000 -- [-1042.543] (-1043.642) (-1046.291) (-1035.098) * (-1035.779) (-1040.951) [-1041.332] (-1045.219) -- 0:04:07
12500 -- [-1041.861] (-1040.029) (-1040.373) (-1041.398) * [-1037.912] (-1040.330) (-1046.852) (-1037.322) -- 0:03:57
13000 -- (-1042.653) [-1039.805] (-1042.691) (-1042.507) * [-1036.282] (-1044.743) (-1042.186) (-1041.885) -- 0:03:47
13500 -- (-1039.028) (-1042.274) (-1039.687) [-1038.621] * [-1040.475] (-1039.219) (-1042.312) (-1047.946) -- 0:04:52
14000 -- (-1041.543) (-1039.557) (-1041.654) [-1037.079] * (-1040.747) (-1038.176) (-1050.525) [-1044.660] -- 0:04:41
14500 -- [-1039.921] (-1042.685) (-1041.255) (-1040.147) * [-1041.126] (-1040.760) (-1042.472) (-1050.179) -- 0:04:31
15000 -- [-1042.638] (-1042.524) (-1038.901) (-1041.489) * (-1042.683) [-1041.429] (-1044.938) (-1051.984) -- 0:04:22
Average standard deviation of split frequencies: 0.036828
15500 -- [-1041.889] (-1038.005) (-1034.231) (-1039.366) * (-1040.827) [-1039.690] (-1044.851) (-1043.502) -- 0:04:14
16000 -- (-1042.797) (-1044.459) [-1049.284] (-1038.808) * (-1042.352) (-1040.822) (-1040.743) [-1041.565] -- 0:04:06
16500 -- (-1043.701) (-1045.707) (-1045.296) [-1038.945] * (-1042.283) (-1038.861) (-1038.587) [-1037.442] -- 0:03:58
17000 -- (-1047.256) (-1039.376) (-1043.700) [-1039.501] * [-1040.521] (-1041.342) (-1040.652) (-1037.004) -- 0:03:51
17500 -- (-1041.869) [-1040.640] (-1038.384) (-1035.304) * (-1040.945) (-1043.824) [-1042.656] (-1039.771) -- 0:03:44
18000 -- (-1038.710) [-1045.254] (-1034.863) (-1040.315) * [-1040.158] (-1040.393) (-1039.646) (-1044.197) -- 0:04:32
18500 -- (-1043.127) (-1038.169) [-1036.909] (-1039.066) * (-1042.299) (-1050.637) (-1041.630) [-1036.192] -- 0:04:25
19000 -- (-1036.604) (-1047.461) (-1034.233) [-1034.239] * (-1042.354) (-1044.855) [-1040.483] (-1043.095) -- 0:04:18
19500 -- (-1045.318) (-1047.994) (-1045.608) [-1038.852] * (-1044.180) [-1036.992] (-1044.959) (-1038.678) -- 0:04:11
20000 -- (-1039.572) (-1042.193) (-1036.787) [-1043.711] * (-1050.816) (-1035.255) (-1043.351) [-1045.686] -- 0:04:05
Average standard deviation of split frequencies: 0.029327
20500 -- [-1042.293] (-1050.792) (-1048.842) (-1039.949) * [-1043.878] (-1041.361) (-1041.644) (-1046.756) -- 0:03:58
21000 -- (-1040.722) (-1046.556) [-1042.786] (-1040.921) * (-1048.266) (-1038.397) [-1037.877] (-1049.809) -- 0:03:53
21500 -- (-1036.098) (-1049.905) [-1040.556] (-1043.196) * [-1051.171] (-1043.337) (-1039.523) (-1036.975) -- 0:03:47
22000 -- (-1041.784) (-1043.245) (-1040.160) [-1044.767] * [-1046.888] (-1033.634) (-1043.512) (-1041.030) -- 0:03:42
22500 -- (-1048.929) [-1042.800] (-1039.851) (-1043.593) * (-1042.611) (-1037.373) [-1038.009] (-1043.213) -- 0:04:20
23000 -- [-1037.074] (-1048.420) (-1046.457) (-1040.800) * (-1044.478) [-1043.395] (-1045.124) (-1042.767) -- 0:04:14
23500 -- (-1046.832) (-1033.409) (-1035.988) [-1040.219] * (-1034.953) (-1045.442) [-1035.390] (-1038.449) -- 0:04:09
24000 -- [-1048.070] (-1042.208) (-1032.174) (-1039.896) * (-1041.911) (-1040.277) [-1040.277] (-1046.311) -- 0:04:04
24500 -- (-1037.758) (-1037.539) [-1038.384] (-1043.100) * (-1045.192) (-1039.666) (-1044.046) [-1048.714] -- 0:03:58
25000 -- (-1038.000) [-1040.204] (-1035.947) (-1043.196) * (-1045.112) (-1038.902) (-1040.323) [-1037.844] -- 0:03:54
Average standard deviation of split frequencies: 0.052378
25500 -- (-1045.051) (-1041.922) [-1038.506] (-1037.477) * (-1034.734) (-1043.755) (-1047.308) [-1037.867] -- 0:03:49
26000 -- [-1049.655] (-1040.347) (-1040.295) (-1039.197) * (-1044.516) [-1048.809] (-1042.558) (-1036.572) -- 0:03:44
26500 -- (-1037.991) (-1044.590) (-1037.880) [-1043.956] * (-1038.247) (-1040.074) (-1040.420) [-1038.798] -- 0:04:17
27000 -- [-1040.862] (-1036.978) (-1049.593) (-1042.142) * (-1038.435) [-1042.374] (-1040.970) (-1037.927) -- 0:04:12
27500 -- (-1041.025) [-1038.235] (-1040.133) (-1043.309) * (-1040.574) [-1040.351] (-1039.826) (-1039.676) -- 0:04:07
28000 -- (-1041.982) (-1041.326) (-1046.728) [-1037.850] * (-1042.352) (-1047.195) [-1032.363] (-1039.507) -- 0:04:03
28500 -- [-1041.771] (-1037.943) (-1047.376) (-1043.943) * [-1040.838] (-1042.699) (-1038.676) (-1039.852) -- 0:03:58
29000 -- [-1037.994] (-1041.254) (-1042.684) (-1050.724) * [-1035.825] (-1047.756) (-1044.079) (-1042.794) -- 0:03:54
29500 -- [-1044.522] (-1037.950) (-1039.324) (-1045.612) * (-1047.533) (-1041.489) (-1039.786) [-1043.371] -- 0:03:50
30000 -- (-1037.457) (-1042.908) (-1043.471) [-1046.732] * (-1040.374) (-1036.917) [-1038.126] (-1050.622) -- 0:03:46
Average standard deviation of split frequencies: 0.051240
30500 -- [-1038.077] (-1042.434) (-1054.667) (-1041.593) * [-1047.003] (-1040.613) (-1039.949) (-1042.114) -- 0:03:42
31000 -- [-1035.992] (-1044.734) (-1040.890) (-1043.789) * [-1045.255] (-1049.928) (-1039.640) (-1045.397) -- 0:04:10
31500 -- (-1045.854) (-1046.359) [-1038.549] (-1039.679) * (-1046.616) (-1042.301) [-1042.028] (-1038.563) -- 0:04:05
32000 -- [-1044.984] (-1042.518) (-1041.347) (-1045.310) * (-1045.686) (-1045.643) (-1049.429) [-1042.681] -- 0:04:02
32500 -- (-1041.894) (-1041.331) (-1040.617) [-1040.303] * (-1042.498) (-1041.290) [-1038.757] (-1042.812) -- 0:03:58
33000 -- (-1045.111) (-1040.137) (-1039.375) [-1045.034] * (-1045.209) (-1042.286) (-1041.818) [-1039.267] -- 0:03:54
33500 -- (-1044.853) [-1037.533] (-1045.599) (-1040.592) * (-1046.956) (-1043.775) (-1041.235) [-1036.378] -- 0:03:50
34000 -- (-1041.628) [-1037.678] (-1044.067) (-1043.869) * (-1044.214) [-1038.820] (-1046.130) (-1034.210) -- 0:03:47
34500 -- (-1044.138) (-1040.364) (-1042.263) [-1045.253] * [-1047.063] (-1038.090) (-1042.413) (-1037.403) -- 0:03:43
35000 -- (-1039.160) [-1043.217] (-1042.429) (-1052.184) * (-1039.887) [-1036.821] (-1038.934) (-1040.138) -- 0:03:40
Average standard deviation of split frequencies: 0.040739
35500 -- (-1040.274) (-1039.627) [-1039.219] (-1053.046) * (-1040.431) [-1037.165] (-1038.083) (-1043.777) -- 0:04:04
36000 -- (-1039.633) [-1037.094] (-1037.481) (-1039.267) * (-1044.879) (-1040.157) [-1036.948] (-1044.961) -- 0:04:01
36500 -- (-1046.841) [-1035.825] (-1041.722) (-1037.409) * (-1046.224) (-1043.262) [-1036.588] (-1041.869) -- 0:03:57
37000 -- (-1040.847) [-1041.377] (-1037.604) (-1044.845) * [-1034.622] (-1039.483) (-1036.470) (-1047.080) -- 0:03:54
37500 -- (-1044.065) (-1036.326) [-1035.887] (-1044.432) * (-1045.050) [-1036.262] (-1041.605) (-1041.856) -- 0:03:51
38000 -- (-1041.032) [-1042.445] (-1038.969) (-1042.224) * (-1042.907) (-1047.269) (-1042.251) [-1036.019] -- 0:03:47
38500 -- (-1045.277) (-1040.404) (-1042.508) [-1035.517] * (-1041.111) (-1050.411) [-1042.909] (-1043.841) -- 0:03:44
39000 -- (-1037.473) (-1047.003) (-1040.123) [-1041.542] * [-1036.345] (-1037.449) (-1046.879) (-1043.169) -- 0:03:41
39500 -- [-1043.098] (-1052.924) (-1039.997) (-1043.838) * (-1038.226) [-1036.856] (-1044.884) (-1045.251) -- 0:04:03
40000 -- (-1039.458) (-1040.032) (-1038.164) [-1043.070] * (-1037.642) (-1048.303) (-1040.600) [-1046.392] -- 0:04:00
Average standard deviation of split frequencies: 0.034776
40500 -- [-1038.862] (-1040.136) (-1039.780) (-1035.727) * (-1041.141) (-1052.705) [-1040.436] (-1049.567) -- 0:03:56
41000 -- [-1041.417] (-1044.713) (-1049.944) (-1042.520) * [-1034.292] (-1045.929) (-1047.137) (-1041.459) -- 0:03:53
41500 -- (-1039.351) [-1036.793] (-1046.391) (-1035.656) * [-1036.403] (-1036.012) (-1037.993) (-1039.083) -- 0:03:50
42000 -- (-1041.172) [-1037.544] (-1046.665) (-1035.586) * [-1035.402] (-1041.297) (-1039.214) (-1034.913) -- 0:03:48
42500 -- (-1039.609) (-1035.906) (-1041.755) [-1038.740] * (-1044.048) [-1045.302] (-1042.425) (-1042.165) -- 0:03:45
43000 -- (-1041.580) (-1045.219) (-1042.555) [-1042.746] * [-1038.748] (-1045.509) (-1050.227) (-1041.693) -- 0:03:42
43500 -- [-1039.256] (-1039.300) (-1044.390) (-1046.418) * (-1037.621) (-1047.390) (-1039.989) [-1043.994] -- 0:03:39
44000 -- (-1043.178) (-1047.496) (-1039.982) [-1046.217] * [-1036.655] (-1046.529) (-1038.198) (-1042.479) -- 0:03:59
44500 -- [-1040.583] (-1038.746) (-1038.778) (-1043.826) * [-1038.390] (-1039.034) (-1041.021) (-1047.051) -- 0:03:56
45000 -- (-1042.562) (-1038.840) (-1032.860) [-1044.571] * (-1036.736) (-1041.706) [-1041.169] (-1048.889) -- 0:03:53
Average standard deviation of split frequencies: 0.031882
45500 -- (-1041.969) [-1040.260] (-1043.584) (-1052.894) * (-1043.932) (-1045.502) (-1045.359) [-1041.303] -- 0:03:50
46000 -- (-1038.637) (-1035.960) [-1041.912] (-1042.061) * [-1039.064] (-1035.981) (-1044.949) (-1037.074) -- 0:03:48
46500 -- (-1036.570) [-1034.562] (-1044.949) (-1041.993) * [-1034.917] (-1038.352) (-1043.981) (-1046.391) -- 0:03:45
47000 -- (-1044.616) [-1040.459] (-1036.532) (-1041.033) * (-1046.352) (-1047.893) [-1040.302] (-1039.348) -- 0:03:43
47500 -- (-1042.905) [-1038.443] (-1041.111) (-1040.642) * [-1037.621] (-1045.235) (-1042.486) (-1042.336) -- 0:03:40
48000 -- (-1044.465) (-1040.898) [-1042.961] (-1049.612) * (-1040.049) (-1049.910) [-1041.855] (-1047.448) -- 0:03:38
48500 -- (-1047.799) [-1039.885] (-1037.098) (-1044.458) * [-1040.934] (-1038.106) (-1043.232) (-1048.172) -- 0:03:55
49000 -- (-1041.543) (-1035.230) [-1041.027] (-1039.531) * (-1042.836) (-1038.032) [-1042.007] (-1039.701) -- 0:03:52
49500 -- (-1044.364) [-1034.125] (-1041.000) (-1041.290) * (-1043.518) [-1038.602] (-1034.983) (-1037.524) -- 0:03:50
50000 -- [-1040.949] (-1040.853) (-1045.071) (-1038.132) * (-1040.408) [-1040.924] (-1042.178) (-1036.986) -- 0:03:48
Average standard deviation of split frequencies: 0.027912
50500 -- (-1045.166) (-1041.495) [-1043.299] (-1048.393) * (-1038.452) (-1039.016) [-1044.101] (-1041.323) -- 0:03:45
51000 -- (-1055.646) (-1045.601) (-1048.980) [-1037.853] * [-1040.179] (-1041.923) (-1041.916) (-1043.004) -- 0:03:43
51500 -- (-1050.620) (-1045.900) [-1037.537] (-1042.495) * (-1040.342) [-1037.425] (-1042.916) (-1039.606) -- 0:03:41
52000 -- (-1041.222) (-1041.454) (-1041.197) [-1034.169] * (-1048.768) (-1042.423) [-1037.462] (-1043.372) -- 0:03:38
52500 -- [-1043.122] (-1045.306) (-1036.967) (-1040.419) * (-1039.390) (-1045.029) (-1040.521) [-1037.926] -- 0:03:54
53000 -- (-1042.005) (-1046.338) [-1044.201] (-1036.263) * (-1041.593) (-1048.493) [-1041.649] (-1034.164) -- 0:03:52
53500 -- [-1039.716] (-1044.837) (-1044.650) (-1042.337) * (-1037.095) (-1046.501) (-1043.451) [-1039.329] -- 0:03:49
54000 -- (-1044.825) [-1039.386] (-1038.982) (-1042.483) * (-1040.179) (-1037.143) [-1035.725] (-1040.306) -- 0:03:47
54500 -- (-1035.312) (-1052.215) [-1038.270] (-1039.807) * [-1033.662] (-1036.433) (-1035.917) (-1035.311) -- 0:03:45
55000 -- [-1043.959] (-1038.203) (-1046.755) (-1039.361) * (-1035.137) (-1042.457) (-1039.473) [-1038.713] -- 0:03:43
Average standard deviation of split frequencies: 0.030064
55500 -- [-1037.183] (-1041.868) (-1038.279) (-1039.237) * (-1036.455) (-1050.137) (-1038.879) [-1034.921] -- 0:03:41
56000 -- [-1043.931] (-1041.460) (-1039.304) (-1041.542) * (-1039.916) (-1046.539) (-1037.708) [-1039.760] -- 0:03:39
56500 -- (-1037.252) (-1042.363) [-1033.211] (-1040.961) * (-1045.244) (-1046.347) (-1045.049) [-1049.743] -- 0:03:37
57000 -- (-1037.197) (-1041.547) [-1034.470] (-1040.322) * (-1037.038) (-1044.407) [-1038.947] (-1048.305) -- 0:03:51
57500 -- (-1044.736) (-1043.637) [-1036.961] (-1046.997) * (-1043.459) (-1055.228) [-1043.549] (-1043.946) -- 0:03:49
58000 -- (-1041.977) (-1041.558) (-1037.359) [-1042.059] * (-1043.524) (-1044.724) (-1039.025) [-1043.557] -- 0:03:47
58500 -- (-1036.265) (-1042.940) [-1042.631] (-1050.579) * (-1040.068) (-1047.048) (-1045.891) [-1045.875] -- 0:03:45
59000 -- (-1044.667) (-1045.243) [-1045.045] (-1047.992) * (-1041.241) [-1036.173] (-1043.140) (-1048.468) -- 0:03:43
59500 -- [-1039.248] (-1042.925) (-1042.546) (-1041.284) * (-1039.822) (-1043.639) (-1039.090) [-1036.718] -- 0:03:41
60000 -- [-1039.103] (-1052.279) (-1051.151) (-1039.275) * (-1032.922) [-1044.811] (-1047.737) (-1041.631) -- 0:03:39
Average standard deviation of split frequencies: 0.027751
60500 -- (-1037.784) (-1045.026) (-1044.473) [-1037.884] * (-1037.410) (-1039.445) [-1039.366] (-1050.758) -- 0:03:37
61000 -- [-1037.860] (-1043.728) (-1047.163) (-1038.770) * [-1034.665] (-1041.918) (-1033.222) (-1046.652) -- 0:03:35
61500 -- [-1043.126] (-1050.275) (-1039.533) (-1047.653) * (-1041.001) (-1039.249) (-1037.355) [-1041.514] -- 0:03:48
62000 -- (-1037.757) [-1044.366] (-1038.909) (-1040.725) * (-1041.887) (-1049.257) (-1039.590) [-1037.334] -- 0:03:46
62500 -- (-1037.857) [-1037.684] (-1039.611) (-1046.750) * [-1040.488] (-1042.781) (-1038.246) (-1037.321) -- 0:03:45
63000 -- (-1042.189) (-1039.601) (-1039.148) [-1038.379] * (-1033.611) (-1049.234) [-1040.588] (-1039.700) -- 0:03:43
63500 -- (-1045.254) (-1043.244) (-1036.815) [-1034.518] * (-1041.866) (-1046.094) [-1036.957] (-1039.996) -- 0:03:41
64000 -- [-1043.068] (-1044.484) (-1044.292) (-1039.793) * (-1038.395) [-1043.571] (-1043.198) (-1042.445) -- 0:03:39
64500 -- (-1042.905) (-1044.440) [-1038.481] (-1046.076) * (-1042.356) [-1050.338] (-1039.800) (-1040.845) -- 0:03:37
65000 -- [-1041.736] (-1038.210) (-1039.159) (-1034.784) * (-1044.928) (-1050.379) [-1044.466] (-1047.462) -- 0:03:35
Average standard deviation of split frequencies: 0.024489
65500 -- (-1041.427) [-1041.973] (-1050.913) (-1039.561) * (-1037.915) [-1038.946] (-1038.618) (-1043.127) -- 0:03:34
66000 -- [-1036.038] (-1050.275) (-1041.647) (-1043.386) * (-1039.506) (-1042.469) (-1047.629) [-1042.066] -- 0:03:46
66500 -- (-1038.511) (-1041.860) [-1041.607] (-1041.277) * (-1040.340) [-1038.836] (-1042.874) (-1041.374) -- 0:03:44
67000 -- (-1042.742) (-1038.776) (-1045.656) [-1038.107] * (-1041.337) [-1035.641] (-1040.630) (-1044.412) -- 0:03:42
67500 -- (-1048.519) (-1038.567) [-1040.063] (-1044.076) * (-1047.257) (-1048.191) [-1040.441] (-1044.412) -- 0:03:41
68000 -- (-1047.864) [-1039.761] (-1036.253) (-1040.505) * (-1042.197) (-1041.940) [-1039.779] (-1040.486) -- 0:03:39
68500 -- (-1042.946) [-1035.753] (-1038.813) (-1043.821) * (-1035.042) (-1045.512) (-1046.229) [-1035.696] -- 0:03:37
69000 -- [-1049.376] (-1042.044) (-1049.281) (-1042.669) * (-1041.409) (-1046.353) (-1042.207) [-1046.647] -- 0:03:35
69500 -- (-1048.378) (-1039.928) (-1043.664) [-1044.342] * [-1038.557] (-1043.436) (-1040.452) (-1038.530) -- 0:03:34
70000 -- [-1035.104] (-1043.191) (-1042.508) (-1041.750) * [-1038.449] (-1041.046) (-1043.968) (-1042.210) -- 0:03:32
Average standard deviation of split frequencies: 0.026683
70500 -- [-1033.707] (-1040.027) (-1045.508) (-1040.686) * [-1038.358] (-1039.897) (-1041.049) (-1034.393) -- 0:03:44
71000 -- (-1038.035) (-1043.600) (-1047.552) [-1035.063] * [-1040.180] (-1040.869) (-1035.888) (-1045.271) -- 0:03:42
71500 -- (-1045.665) (-1033.881) (-1038.234) [-1040.441] * (-1040.086) (-1042.447) (-1038.376) [-1047.895] -- 0:03:40
72000 -- (-1043.075) (-1043.339) (-1057.310) [-1047.039] * (-1041.150) (-1050.420) [-1038.223] (-1047.988) -- 0:03:39
72500 -- (-1043.097) [-1035.508] (-1041.183) (-1033.121) * (-1038.584) [-1049.523] (-1046.769) (-1038.936) -- 0:03:37
73000 -- (-1048.458) (-1037.688) [-1038.526] (-1038.084) * (-1036.331) (-1044.933) (-1041.355) [-1038.360] -- 0:03:35
73500 -- (-1041.551) (-1039.501) (-1041.485) [-1036.677] * [-1037.684] (-1043.308) (-1044.250) (-1036.894) -- 0:03:34
74000 -- [-1045.052] (-1042.739) (-1041.846) (-1038.888) * [-1034.151] (-1042.842) (-1037.592) (-1034.759) -- 0:03:32
74500 -- (-1042.418) [-1039.469] (-1047.319) (-1042.480) * [-1035.777] (-1047.666) (-1034.123) (-1040.115) -- 0:03:31
75000 -- (-1047.688) [-1041.959] (-1040.049) (-1041.668) * (-1034.833) [-1037.809] (-1043.699) (-1037.998) -- 0:03:42
Average standard deviation of split frequencies: 0.025697
75500 -- (-1045.426) (-1037.594) [-1037.423] (-1038.515) * (-1037.126) [-1041.280] (-1040.136) (-1038.863) -- 0:03:40
76000 -- (-1043.531) (-1040.673) (-1038.046) [-1037.943] * [-1042.659] (-1040.736) (-1048.657) (-1037.454) -- 0:03:38
76500 -- (-1040.759) [-1042.279] (-1039.502) (-1045.335) * [-1041.750] (-1036.948) (-1039.656) (-1042.562) -- 0:03:37
77000 -- (-1039.397) [-1034.680] (-1035.020) (-1040.599) * (-1046.372) (-1042.415) (-1035.401) [-1038.080] -- 0:03:35
77500 -- (-1039.399) (-1041.421) (-1043.375) [-1041.565] * (-1039.747) (-1043.019) [-1039.986] (-1037.496) -- 0:03:34
78000 -- (-1038.347) (-1041.087) (-1043.687) [-1041.479] * (-1050.663) (-1044.072) (-1043.238) [-1043.704] -- 0:03:32
78500 -- (-1042.993) [-1036.453] (-1048.407) (-1038.969) * (-1037.684) (-1043.041) [-1040.252] (-1037.854) -- 0:03:31
79000 -- (-1038.031) (-1037.860) (-1042.533) [-1042.721] * (-1038.191) [-1040.418] (-1039.300) (-1038.123) -- 0:03:29
79500 -- [-1038.299] (-1035.710) (-1050.277) (-1040.440) * [-1038.964] (-1044.884) (-1039.477) (-1039.145) -- 0:03:39
80000 -- (-1041.502) (-1036.479) (-1035.741) [-1042.623] * (-1040.606) (-1046.813) [-1039.349] (-1039.760) -- 0:03:38
Average standard deviation of split frequencies: 0.022541
80500 -- (-1040.149) (-1041.251) [-1042.100] (-1038.975) * (-1039.987) (-1043.256) [-1040.362] (-1046.306) -- 0:03:37
81000 -- [-1039.383] (-1037.447) (-1044.686) (-1039.626) * [-1038.140] (-1045.522) (-1035.855) (-1041.662) -- 0:03:35
81500 -- [-1048.922] (-1049.765) (-1046.586) (-1043.206) * (-1043.864) (-1038.865) [-1036.930] (-1043.654) -- 0:03:34
82000 -- (-1036.828) (-1037.949) [-1040.075] (-1037.979) * (-1041.510) (-1039.272) (-1036.858) [-1047.773] -- 0:03:32
82500 -- (-1048.319) [-1042.522] (-1042.879) (-1040.357) * [-1041.661] (-1042.490) (-1043.196) (-1043.833) -- 0:03:31
83000 -- (-1041.578) [-1033.215] (-1040.219) (-1034.939) * [-1040.782] (-1048.968) (-1043.167) (-1040.065) -- 0:03:29
83500 -- [-1039.174] (-1039.383) (-1037.745) (-1036.550) * [-1035.178] (-1039.801) (-1040.175) (-1039.200) -- 0:03:28
84000 -- (-1043.036) [-1042.475] (-1040.256) (-1041.278) * (-1036.044) (-1042.982) (-1040.394) [-1042.197] -- 0:03:38
84500 -- (-1038.853) [-1042.584] (-1039.762) (-1043.658) * (-1044.271) [-1044.389] (-1040.998) (-1040.034) -- 0:03:36
85000 -- (-1041.802) [-1039.001] (-1045.232) (-1038.393) * (-1039.295) (-1039.978) (-1038.216) [-1039.173] -- 0:03:35
Average standard deviation of split frequencies: 0.023492
85500 -- (-1039.664) (-1043.336) [-1042.258] (-1044.619) * [-1045.618] (-1035.795) (-1038.885) (-1040.350) -- 0:03:33
86000 -- (-1045.692) (-1046.667) (-1046.720) [-1036.534] * (-1046.197) [-1038.790] (-1042.713) (-1041.182) -- 0:03:32
86500 -- (-1038.638) [-1044.758] (-1041.313) (-1052.226) * [-1041.235] (-1036.390) (-1046.617) (-1045.365) -- 0:03:31
87000 -- [-1043.640] (-1046.436) (-1043.681) (-1047.157) * (-1036.536) (-1044.724) (-1040.079) [-1036.541] -- 0:03:29
87500 -- (-1041.778) (-1043.598) [-1039.594] (-1036.070) * (-1040.774) (-1044.411) (-1039.281) [-1034.560] -- 0:03:28
88000 -- [-1041.593] (-1037.645) (-1044.427) (-1041.728) * (-1042.619) (-1044.059) [-1037.907] (-1043.009) -- 0:03:27
88500 -- (-1041.779) [-1038.540] (-1038.226) (-1039.626) * [-1043.084] (-1040.843) (-1036.911) (-1046.975) -- 0:03:36
89000 -- [-1037.698] (-1049.338) (-1038.899) (-1035.644) * (-1037.851) [-1036.531] (-1045.993) (-1039.207) -- 0:03:34
89500 -- (-1043.238) (-1044.706) [-1033.875] (-1044.520) * (-1040.205) [-1038.114] (-1038.158) (-1044.875) -- 0:03:33
90000 -- (-1033.759) [-1039.722] (-1045.601) (-1044.567) * (-1051.637) [-1035.613] (-1036.155) (-1044.150) -- 0:03:32
Average standard deviation of split frequencies: 0.024511
90500 -- (-1043.139) (-1039.013) (-1041.648) [-1039.507] * (-1034.779) [-1035.198] (-1041.282) (-1037.601) -- 0:03:31
91000 -- (-1039.508) (-1046.182) [-1038.173] (-1043.346) * (-1043.057) (-1037.821) (-1038.959) [-1042.967] -- 0:03:29
91500 -- (-1036.828) (-1047.334) [-1040.069] (-1038.541) * (-1038.108) (-1039.636) [-1034.452] (-1034.358) -- 0:03:28
92000 -- (-1040.743) [-1034.112] (-1047.952) (-1038.671) * [-1042.151] (-1038.886) (-1036.047) (-1041.470) -- 0:03:27
92500 -- (-1037.797) [-1035.747] (-1049.969) (-1038.299) * (-1040.807) (-1044.468) [-1037.126] (-1043.937) -- 0:03:35
93000 -- (-1046.318) (-1034.943) (-1041.469) [-1043.669] * (-1045.838) [-1044.619] (-1035.764) (-1041.267) -- 0:03:34
93500 -- (-1041.816) [-1036.010] (-1043.931) (-1049.154) * [-1045.558] (-1045.036) (-1044.811) (-1040.309) -- 0:03:33
94000 -- (-1035.652) [-1036.519] (-1036.783) (-1040.129) * (-1036.812) [-1038.228] (-1049.327) (-1040.893) -- 0:03:32
94500 -- (-1040.359) (-1040.853) [-1038.343] (-1045.751) * [-1039.744] (-1040.287) (-1040.661) (-1043.394) -- 0:03:30
95000 -- (-1043.043) [-1042.577] (-1042.115) (-1038.015) * (-1041.467) [-1039.871] (-1043.349) (-1037.032) -- 0:03:29
Average standard deviation of split frequencies: 0.028060
95500 -- (-1038.208) [-1038.394] (-1042.712) (-1042.626) * (-1040.919) (-1044.884) (-1040.388) [-1044.472] -- 0:03:28
96000 -- (-1040.451) (-1049.243) (-1042.863) [-1038.274] * (-1038.227) (-1046.890) (-1038.310) [-1039.434] -- 0:03:27
96500 -- [-1037.010] (-1042.743) (-1045.322) (-1039.430) * (-1041.581) (-1042.303) (-1045.739) [-1040.581] -- 0:03:25
97000 -- (-1045.159) [-1041.010] (-1035.688) (-1037.211) * [-1048.334] (-1039.374) (-1047.809) (-1042.610) -- 0:03:34
97500 -- (-1045.331) (-1047.245) [-1040.237] (-1047.070) * (-1042.930) (-1037.957) [-1039.611] (-1045.543) -- 0:03:32
98000 -- (-1040.402) (-1039.698) [-1045.666] (-1039.827) * (-1040.232) (-1040.897) (-1040.102) [-1043.917] -- 0:03:31
98500 -- (-1039.730) [-1043.485] (-1044.861) (-1037.783) * [-1040.424] (-1045.215) (-1038.503) (-1046.903) -- 0:03:30
99000 -- (-1034.862) (-1048.676) (-1044.307) [-1036.052] * (-1042.603) [-1045.275] (-1042.315) (-1046.175) -- 0:03:29
99500 -- [-1034.385] (-1043.759) (-1051.495) (-1036.942) * (-1037.126) (-1040.680) (-1040.270) [-1039.360] -- 0:03:28
100000 -- [-1039.486] (-1036.899) (-1045.296) (-1032.743) * (-1040.441) [-1041.421] (-1039.423) (-1052.973) -- 0:03:27
Average standard deviation of split frequencies: 0.027428
100500 -- [-1033.170] (-1037.012) (-1038.554) (-1039.946) * [-1040.412] (-1048.231) (-1041.892) (-1044.936) -- 0:03:25
101000 -- (-1032.945) (-1041.107) [-1045.462] (-1037.449) * [-1045.535] (-1047.568) (-1040.564) (-1042.829) -- 0:03:33
101500 -- (-1045.176) [-1042.387] (-1040.317) (-1037.963) * (-1044.736) [-1041.606] (-1045.159) (-1040.002) -- 0:03:32
102000 -- (-1042.485) (-1043.891) (-1043.628) [-1039.739] * (-1036.950) [-1039.278] (-1045.428) (-1043.431) -- 0:03:31
102500 -- (-1040.440) (-1040.642) (-1033.080) [-1043.425] * (-1037.008) (-1038.041) [-1040.615] (-1039.170) -- 0:03:30
103000 -- (-1038.821) (-1042.611) [-1049.391] (-1045.419) * [-1037.715] (-1034.620) (-1046.289) (-1041.683) -- 0:03:29
103500 -- (-1036.832) (-1034.465) [-1036.995] (-1037.461) * [-1037.073] (-1039.330) (-1041.647) (-1040.695) -- 0:03:27
104000 -- [-1035.528] (-1038.287) (-1045.840) (-1042.716) * (-1037.544) [-1036.760] (-1057.541) (-1036.544) -- 0:03:26
104500 -- (-1042.244) (-1040.003) (-1044.129) [-1040.316] * (-1039.753) (-1050.078) [-1038.781] (-1039.473) -- 0:03:25
105000 -- (-1040.144) [-1036.448] (-1042.902) (-1037.653) * (-1045.218) [-1039.379] (-1037.541) (-1038.584) -- 0:03:24
Average standard deviation of split frequencies: 0.023507
105500 -- (-1048.255) (-1042.761) [-1041.652] (-1042.775) * (-1038.370) (-1039.597) (-1039.596) [-1039.378] -- 0:03:31
106000 -- [-1039.421] (-1032.525) (-1042.216) (-1044.329) * (-1045.623) (-1041.058) (-1048.513) [-1039.574] -- 0:03:30
106500 -- [-1039.726] (-1040.416) (-1042.689) (-1036.375) * (-1040.073) (-1037.255) (-1038.197) [-1042.056] -- 0:03:29
107000 -- (-1037.839) (-1040.412) (-1036.927) [-1034.815] * [-1038.665] (-1037.138) (-1039.438) (-1035.707) -- 0:03:28
107500 -- [-1033.058] (-1035.241) (-1051.127) (-1041.238) * (-1039.276) [-1038.534] (-1034.443) (-1039.723) -- 0:03:27
108000 -- (-1036.708) (-1042.437) (-1042.137) [-1043.687] * [-1041.724] (-1040.702) (-1039.373) (-1043.517) -- 0:03:26
108500 -- (-1042.673) (-1043.435) (-1048.236) [-1041.836] * (-1034.772) [-1036.036] (-1037.648) (-1037.880) -- 0:03:25
109000 -- (-1041.207) (-1044.442) [-1038.180] (-1045.243) * [-1040.374] (-1036.325) (-1033.605) (-1042.288) -- 0:03:24
109500 -- [-1040.781] (-1045.460) (-1040.514) (-1045.191) * (-1037.750) (-1053.222) (-1041.521) [-1041.500] -- 0:03:31
110000 -- [-1041.418] (-1044.189) (-1044.535) (-1037.746) * (-1043.826) (-1040.309) (-1038.386) [-1040.058] -- 0:03:30
Average standard deviation of split frequencies: 0.023732
110500 -- (-1044.932) (-1043.197) [-1037.232] (-1041.719) * (-1041.615) [-1039.938] (-1039.339) (-1046.823) -- 0:03:29
111000 -- (-1043.126) (-1042.619) [-1042.326] (-1044.828) * [-1039.681] (-1039.388) (-1043.537) (-1043.389) -- 0:03:28
111500 -- (-1039.954) (-1039.958) (-1041.198) [-1040.136] * (-1047.901) [-1036.665] (-1044.243) (-1046.026) -- 0:03:27
112000 -- [-1035.847] (-1038.008) (-1036.019) (-1041.807) * (-1041.989) [-1035.646] (-1036.293) (-1041.018) -- 0:03:26
112500 -- [-1038.020] (-1036.811) (-1040.465) (-1055.721) * (-1045.703) (-1044.144) [-1036.797] (-1041.383) -- 0:03:25
113000 -- (-1037.844) (-1041.563) (-1045.825) [-1042.345] * [-1038.531] (-1044.845) (-1044.658) (-1043.439) -- 0:03:24
113500 -- (-1040.620) (-1046.788) [-1041.810] (-1042.864) * [-1040.698] (-1043.759) (-1038.147) (-1040.370) -- 0:03:30
114000 -- [-1038.331] (-1037.410) (-1054.990) (-1036.456) * (-1036.386) [-1039.930] (-1042.306) (-1047.763) -- 0:03:29
114500 -- (-1042.741) (-1041.151) [-1044.448] (-1045.453) * [-1037.094] (-1047.488) (-1039.516) (-1039.384) -- 0:03:28
115000 -- (-1036.629) (-1056.061) (-1048.170) [-1050.216] * (-1043.925) (-1039.638) (-1043.231) [-1036.861] -- 0:03:27
Average standard deviation of split frequencies: 0.027286
115500 -- (-1046.873) (-1042.562) [-1038.632] (-1054.373) * (-1042.404) (-1046.163) (-1050.284) [-1037.965] -- 0:03:26
116000 -- (-1042.406) (-1043.392) (-1038.438) [-1045.370] * [-1040.476] (-1041.054) (-1048.428) (-1041.702) -- 0:03:25
116500 -- (-1045.157) (-1050.905) [-1041.059] (-1045.817) * (-1035.846) (-1044.820) [-1040.071] (-1045.638) -- 0:03:24
117000 -- (-1038.854) (-1039.959) [-1037.284] (-1041.195) * [-1038.099] (-1042.786) (-1045.421) (-1040.030) -- 0:03:23
117500 -- (-1042.809) (-1040.431) (-1044.088) [-1037.684] * [-1038.648] (-1037.339) (-1041.839) (-1045.023) -- 0:03:30
118000 -- [-1033.590] (-1047.892) (-1038.442) (-1036.034) * (-1051.250) (-1036.396) (-1038.793) [-1036.039] -- 0:03:29
118500 -- [-1038.062] (-1051.788) (-1039.101) (-1039.988) * (-1037.347) (-1041.597) [-1043.613] (-1036.605) -- 0:03:28
119000 -- (-1041.657) [-1038.760] (-1036.593) (-1045.727) * (-1039.415) [-1041.272] (-1037.408) (-1037.520) -- 0:03:27
119500 -- (-1042.629) [-1041.708] (-1042.944) (-1044.595) * [-1044.170] (-1046.288) (-1037.386) (-1042.170) -- 0:03:26
120000 -- [-1043.397] (-1039.998) (-1040.716) (-1051.484) * (-1046.378) (-1044.415) [-1038.175] (-1046.773) -- 0:03:25
Average standard deviation of split frequencies: 0.023998
120500 -- (-1038.128) [-1047.433] (-1041.215) (-1040.926) * (-1040.942) [-1045.570] (-1042.998) (-1038.432) -- 0:03:24
121000 -- [-1038.436] (-1043.285) (-1043.433) (-1038.169) * (-1055.123) [-1044.794] (-1036.852) (-1040.560) -- 0:03:23
121500 -- (-1039.663) (-1044.271) [-1040.126] (-1043.668) * [-1038.629] (-1043.328) (-1048.601) (-1039.113) -- 0:03:22
122000 -- [-1034.511] (-1046.115) (-1038.054) (-1045.456) * (-1038.319) (-1042.620) (-1045.219) [-1038.012] -- 0:03:28
122500 -- (-1040.605) (-1035.589) (-1044.867) [-1036.130] * [-1039.944] (-1039.307) (-1039.469) (-1044.797) -- 0:03:27
123000 -- (-1039.674) [-1036.539] (-1042.758) (-1045.488) * (-1041.613) (-1040.869) [-1037.950] (-1035.616) -- 0:03:26
123500 -- (-1041.539) (-1043.002) [-1044.181] (-1051.888) * [-1038.521] (-1046.678) (-1038.732) (-1041.665) -- 0:03:25
124000 -- (-1040.058) [-1037.422] (-1045.894) (-1042.231) * (-1034.236) (-1048.729) [-1035.558] (-1036.224) -- 0:03:24
124500 -- [-1037.854] (-1042.376) (-1039.155) (-1042.637) * [-1043.943] (-1038.498) (-1042.083) (-1039.275) -- 0:03:23
125000 -- (-1042.238) (-1035.023) [-1038.753] (-1040.012) * (-1045.549) (-1037.244) (-1040.776) [-1038.815] -- 0:03:23
Average standard deviation of split frequencies: 0.022448
125500 -- (-1042.111) (-1044.372) [-1038.339] (-1043.746) * (-1043.166) [-1041.368] (-1036.373) (-1041.274) -- 0:03:22
126000 -- (-1043.582) (-1045.473) (-1043.438) [-1036.405] * (-1041.940) (-1040.823) (-1038.669) [-1041.154] -- 0:03:28
126500 -- (-1038.926) (-1042.652) [-1041.520] (-1036.669) * (-1041.437) (-1040.258) (-1035.287) [-1041.144] -- 0:03:27
127000 -- (-1040.948) (-1046.047) [-1038.188] (-1042.509) * (-1047.589) (-1041.126) (-1047.379) [-1041.822] -- 0:03:26
127500 -- (-1037.741) (-1042.513) [-1039.310] (-1039.558) * (-1040.363) (-1039.103) (-1040.044) [-1034.939] -- 0:03:25
128000 -- (-1039.235) (-1042.225) [-1038.519] (-1042.422) * (-1039.965) (-1040.933) [-1040.141] (-1040.531) -- 0:03:24
128500 -- [-1034.368] (-1044.782) (-1044.429) (-1048.825) * (-1053.533) (-1038.790) [-1038.748] (-1039.085) -- 0:03:23
129000 -- (-1038.248) (-1039.060) (-1039.049) [-1035.624] * (-1047.630) (-1047.700) (-1041.000) [-1042.933] -- 0:03:22
129500 -- [-1042.819] (-1042.522) (-1039.742) (-1040.931) * (-1041.504) [-1046.603] (-1039.538) (-1040.308) -- 0:03:21
130000 -- (-1038.427) (-1036.401) [-1037.332] (-1036.742) * [-1042.152] (-1042.366) (-1037.797) (-1051.050) -- 0:03:27
Average standard deviation of split frequencies: 0.015977
130500 -- (-1035.957) (-1036.805) [-1041.246] (-1040.909) * (-1038.353) [-1045.879] (-1038.125) (-1046.151) -- 0:03:26
131000 -- [-1035.244] (-1037.897) (-1037.201) (-1041.227) * (-1040.791) [-1043.159] (-1039.296) (-1036.826) -- 0:03:25
131500 -- (-1040.142) (-1037.101) (-1043.012) [-1040.275] * (-1049.595) (-1039.479) [-1034.665] (-1040.394) -- 0:03:24
132000 -- (-1044.668) (-1038.813) (-1040.196) [-1040.144] * (-1043.586) [-1035.842] (-1037.088) (-1037.940) -- 0:03:23
132500 -- [-1038.277] (-1046.288) (-1043.386) (-1041.101) * (-1035.957) (-1048.472) [-1042.255] (-1045.265) -- 0:03:22
133000 -- (-1045.151) (-1049.504) [-1044.455] (-1044.014) * (-1046.109) (-1038.780) [-1037.822] (-1049.046) -- 0:03:22
133500 -- (-1041.902) [-1035.092] (-1046.084) (-1044.017) * (-1043.706) (-1038.428) [-1036.805] (-1044.257) -- 0:03:21
134000 -- (-1042.537) [-1037.278] (-1044.472) (-1040.390) * [-1043.690] (-1033.002) (-1044.244) (-1038.991) -- 0:03:20
134500 -- (-1044.778) (-1036.260) (-1042.321) [-1034.648] * (-1037.834) (-1045.240) (-1038.556) [-1036.877] -- 0:03:25
135000 -- (-1036.002) [-1038.685] (-1040.353) (-1042.934) * (-1038.741) [-1035.802] (-1039.866) (-1045.130) -- 0:03:25
Average standard deviation of split frequencies: 0.010894
135500 -- (-1042.597) [-1037.871] (-1044.485) (-1045.964) * (-1040.891) (-1037.984) [-1033.810] (-1035.143) -- 0:03:24
136000 -- (-1044.046) (-1041.080) (-1043.712) [-1037.738] * [-1042.155] (-1037.457) (-1036.012) (-1042.871) -- 0:03:23
136500 -- [-1038.755] (-1038.214) (-1040.669) (-1045.614) * [-1038.428] (-1036.924) (-1036.043) (-1039.954) -- 0:03:22
137000 -- (-1040.020) [-1037.578] (-1038.539) (-1044.832) * (-1042.791) [-1040.364] (-1036.616) (-1042.443) -- 0:03:21
137500 -- (-1040.635) [-1038.409] (-1036.822) (-1039.751) * [-1040.644] (-1034.730) (-1040.361) (-1036.897) -- 0:03:20
138000 -- (-1037.928) [-1038.241] (-1038.237) (-1036.943) * (-1049.562) (-1037.215) (-1043.162) [-1039.647] -- 0:03:19
138500 -- (-1046.981) [-1039.791] (-1046.730) (-1037.876) * (-1044.154) [-1038.914] (-1043.719) (-1039.866) -- 0:03:25
139000 -- (-1037.144) (-1038.540) (-1041.111) [-1041.485] * (-1042.198) (-1041.023) (-1041.361) [-1039.439] -- 0:03:24
139500 -- (-1046.551) (-1036.521) (-1040.351) [-1041.709] * (-1039.799) (-1042.360) [-1041.162] (-1045.580) -- 0:03:23
140000 -- (-1045.109) (-1040.776) (-1037.243) [-1038.389] * (-1042.248) (-1039.544) (-1042.576) [-1038.607] -- 0:03:22
Average standard deviation of split frequencies: 0.012447
140500 -- (-1041.236) (-1040.616) (-1035.743) [-1037.345] * (-1039.965) (-1039.193) (-1045.036) [-1037.066] -- 0:03:21
141000 -- [-1045.400] (-1039.342) (-1041.207) (-1038.109) * (-1037.517) (-1048.752) (-1037.715) [-1036.404] -- 0:03:21
141500 -- (-1042.733) [-1041.270] (-1036.080) (-1038.198) * (-1037.930) (-1047.803) [-1038.195] (-1039.987) -- 0:03:20
142000 -- (-1053.460) (-1038.303) (-1045.703) [-1038.154] * (-1041.130) (-1047.768) [-1039.666] (-1040.618) -- 0:03:19
142500 -- (-1038.541) (-1038.604) [-1038.490] (-1041.236) * (-1046.033) (-1044.286) [-1044.178] (-1035.185) -- 0:03:18
143000 -- [-1041.350] (-1039.735) (-1044.495) (-1041.006) * (-1040.454) (-1040.910) (-1037.963) [-1035.857] -- 0:03:23
143500 -- (-1038.350) (-1039.552) (-1043.788) [-1045.359] * (-1043.568) (-1039.910) [-1032.311] (-1036.939) -- 0:03:22
144000 -- [-1039.154] (-1041.620) (-1043.375) (-1043.801) * (-1036.624) [-1038.730] (-1036.824) (-1047.304) -- 0:03:22
144500 -- (-1041.949) (-1041.283) (-1041.627) [-1041.014] * (-1044.916) [-1045.572] (-1041.757) (-1044.212) -- 0:03:21
145000 -- [-1043.042] (-1050.078) (-1038.436) (-1042.943) * [-1046.898] (-1038.605) (-1043.311) (-1041.728) -- 0:03:20
Average standard deviation of split frequencies: 0.011531
145500 -- (-1039.096) (-1042.123) (-1046.483) [-1035.040] * [-1041.657] (-1037.874) (-1034.757) (-1043.273) -- 0:03:19
146000 -- (-1043.885) (-1047.647) (-1049.691) [-1039.460] * (-1040.439) (-1042.786) (-1042.178) [-1039.163] -- 0:03:18
146500 -- (-1045.875) (-1039.484) (-1042.709) [-1035.873] * (-1043.087) (-1041.362) [-1040.525] (-1041.940) -- 0:03:23
147000 -- [-1046.294] (-1046.704) (-1040.513) (-1037.463) * (-1047.861) (-1043.200) [-1031.676] (-1039.192) -- 0:03:23
147500 -- (-1048.298) (-1051.217) [-1039.424] (-1040.392) * (-1044.199) (-1047.266) (-1050.047) [-1036.879] -- 0:03:22
148000 -- (-1051.852) (-1052.501) [-1045.152] (-1036.183) * (-1041.165) [-1041.002] (-1038.003) (-1038.496) -- 0:03:21
148500 -- (-1040.843) (-1044.574) (-1037.798) [-1038.527] * (-1044.365) (-1040.023) [-1041.820] (-1036.507) -- 0:03:20
149000 -- (-1042.722) (-1047.149) [-1034.791] (-1038.973) * (-1040.848) [-1037.073] (-1039.926) (-1038.738) -- 0:03:19
149500 -- (-1042.351) (-1039.036) (-1034.562) [-1034.564] * (-1044.171) (-1035.893) [-1037.312] (-1044.537) -- 0:03:19
150000 -- (-1051.709) (-1036.708) [-1039.768] (-1045.660) * (-1050.560) (-1042.579) [-1042.495] (-1039.468) -- 0:03:18
Average standard deviation of split frequencies: 0.011621
150500 -- (-1043.850) (-1042.055) [-1042.924] (-1046.973) * (-1040.213) (-1040.584) [-1034.266] (-1045.596) -- 0:03:23
151000 -- (-1038.502) (-1041.019) [-1037.673] (-1048.215) * (-1035.329) [-1043.370] (-1038.085) (-1050.075) -- 0:03:22
151500 -- (-1044.453) [-1044.654] (-1044.874) (-1044.877) * (-1041.115) (-1040.780) (-1042.823) [-1036.517] -- 0:03:21
152000 -- (-1040.755) (-1036.239) (-1043.542) [-1037.504] * [-1041.874] (-1038.835) (-1047.652) (-1037.755) -- 0:03:20
152500 -- (-1043.772) [-1041.702] (-1039.860) (-1051.292) * (-1041.458) (-1040.413) [-1036.295] (-1039.668) -- 0:03:20
153000 -- [-1040.130] (-1038.638) (-1047.317) (-1044.479) * [-1046.309] (-1041.811) (-1041.985) (-1046.861) -- 0:03:19
153500 -- (-1043.697) (-1045.996) [-1045.711] (-1047.438) * (-1036.727) (-1042.611) [-1037.570] (-1036.539) -- 0:03:18
154000 -- (-1042.554) (-1045.677) [-1037.718] (-1040.161) * (-1039.211) [-1041.928] (-1039.619) (-1046.738) -- 0:03:17
154500 -- (-1047.178) [-1039.584] (-1044.271) (-1042.719) * (-1040.746) (-1043.728) [-1038.183] (-1039.987) -- 0:03:17
155000 -- (-1038.433) [-1038.438] (-1036.026) (-1047.790) * (-1056.825) (-1038.644) (-1035.394) [-1038.622] -- 0:03:21
Average standard deviation of split frequencies: 0.012951
155500 -- (-1043.621) (-1036.092) [-1038.575] (-1048.939) * [-1034.251] (-1042.114) (-1038.872) (-1041.409) -- 0:03:20
156000 -- (-1044.385) [-1034.808] (-1038.081) (-1042.641) * (-1046.158) (-1041.442) [-1041.242] (-1044.015) -- 0:03:20
156500 -- (-1039.078) (-1041.972) [-1040.864] (-1038.356) * (-1038.531) (-1038.913) (-1038.449) [-1039.142] -- 0:03:19
157000 -- [-1039.190] (-1047.535) (-1044.659) (-1041.805) * (-1039.848) (-1036.660) (-1043.798) [-1040.021] -- 0:03:18
157500 -- (-1038.941) [-1041.003] (-1043.511) (-1033.757) * (-1036.376) (-1042.311) (-1041.611) [-1038.404] -- 0:03:17
158000 -- (-1046.253) (-1034.635) (-1040.040) [-1038.192] * (-1051.193) (-1055.774) (-1039.349) [-1042.582] -- 0:03:17
158500 -- (-1041.683) (-1039.024) [-1039.692] (-1046.210) * (-1040.904) (-1045.921) [-1036.488] (-1040.083) -- 0:03:16
159000 -- (-1037.002) [-1037.275] (-1042.737) (-1045.336) * (-1038.200) [-1039.032] (-1042.878) (-1037.853) -- 0:03:15
159500 -- [-1040.770] (-1040.461) (-1048.951) (-1042.619) * (-1042.700) [-1039.219] (-1037.269) (-1057.948) -- 0:03:20
160000 -- [-1034.731] (-1043.358) (-1046.441) (-1044.742) * (-1044.430) [-1047.500] (-1051.722) (-1044.953) -- 0:03:19
Average standard deviation of split frequencies: 0.015509
160500 -- (-1045.287) [-1043.969] (-1040.905) (-1042.762) * (-1041.260) [-1036.931] (-1045.921) (-1036.098) -- 0:03:18
161000 -- (-1037.108) [-1045.823] (-1041.055) (-1040.782) * (-1041.406) (-1041.620) (-1036.718) [-1041.218] -- 0:03:18
161500 -- (-1041.868) (-1044.672) (-1043.777) [-1040.733] * (-1045.790) (-1037.176) (-1046.734) [-1035.662] -- 0:03:17
162000 -- (-1038.684) (-1042.944) (-1051.998) [-1046.517] * [-1045.089] (-1036.599) (-1049.138) (-1041.816) -- 0:03:16
162500 -- (-1041.217) (-1037.838) [-1036.155] (-1040.900) * [-1040.679] (-1042.059) (-1041.135) (-1036.423) -- 0:03:15
163000 -- [-1040.251] (-1039.636) (-1037.851) (-1041.275) * (-1041.377) (-1040.351) (-1046.382) [-1034.703] -- 0:03:15
163500 -- (-1045.846) (-1039.196) (-1043.367) [-1042.472] * (-1041.606) [-1042.410] (-1047.385) (-1034.226) -- 0:03:14
164000 -- (-1043.040) (-1047.986) [-1036.839] (-1035.289) * (-1042.733) [-1038.591] (-1045.728) (-1036.984) -- 0:03:18
164500 -- (-1039.203) (-1039.972) [-1038.782] (-1032.511) * (-1040.633) (-1036.930) (-1041.007) [-1048.001] -- 0:03:18
165000 -- (-1042.984) (-1036.944) (-1039.192) [-1043.490] * [-1041.185] (-1051.704) (-1041.915) (-1039.602) -- 0:03:17
Average standard deviation of split frequencies: 0.012576
165500 -- (-1047.123) (-1039.009) (-1034.939) [-1039.319] * [-1042.893] (-1039.203) (-1044.077) (-1040.807) -- 0:03:16
166000 -- (-1043.943) (-1039.896) [-1032.638] (-1042.311) * (-1039.730) [-1043.038] (-1043.851) (-1055.337) -- 0:03:15
166500 -- (-1042.719) (-1036.930) [-1040.179] (-1040.863) * [-1040.259] (-1042.325) (-1044.261) (-1040.582) -- 0:03:15
167000 -- (-1042.324) (-1038.275) [-1040.035] (-1037.630) * [-1037.170] (-1033.343) (-1041.245) (-1047.686) -- 0:03:14
167500 -- (-1037.383) [-1042.337] (-1045.838) (-1033.821) * [-1036.744] (-1041.511) (-1046.269) (-1039.027) -- 0:03:13
168000 -- (-1034.035) [-1037.209] (-1042.671) (-1041.555) * (-1042.954) [-1039.896] (-1044.775) (-1041.697) -- 0:03:13
168500 -- (-1037.897) [-1037.126] (-1047.746) (-1043.951) * (-1037.753) (-1037.585) [-1046.800] (-1042.899) -- 0:03:17
169000 -- (-1039.394) [-1037.687] (-1041.003) (-1039.386) * (-1035.313) (-1043.610) (-1042.399) [-1040.203] -- 0:03:16
169500 -- (-1041.305) (-1037.730) [-1039.774] (-1041.168) * (-1042.702) (-1044.534) (-1034.669) [-1034.980] -- 0:03:15
170000 -- [-1034.964] (-1035.291) (-1033.114) (-1038.631) * (-1043.180) [-1037.942] (-1037.875) (-1038.943) -- 0:03:15
Average standard deviation of split frequencies: 0.015389
170500 -- [-1040.641] (-1040.594) (-1035.674) (-1046.274) * (-1037.517) [-1039.932] (-1040.187) (-1042.713) -- 0:03:14
171000 -- (-1047.482) (-1037.736) (-1042.894) [-1037.517] * (-1042.606) (-1049.297) [-1044.301] (-1041.815) -- 0:03:13
171500 -- (-1043.378) [-1036.875] (-1039.280) (-1040.022) * (-1042.947) (-1039.130) (-1047.125) [-1038.316] -- 0:03:13
172000 -- (-1046.870) [-1033.933] (-1046.723) (-1050.661) * (-1041.012) (-1041.580) [-1040.025] (-1046.906) -- 0:03:12
172500 -- [-1040.540] (-1039.683) (-1040.416) (-1032.644) * (-1044.764) [-1038.461] (-1044.511) (-1038.550) -- 0:03:11
173000 -- (-1040.383) [-1045.766] (-1037.017) (-1048.876) * [-1035.729] (-1047.438) (-1041.281) (-1048.606) -- 0:03:15
173500 -- [-1034.319] (-1041.475) (-1036.203) (-1041.709) * [-1040.674] (-1040.234) (-1045.737) (-1047.074) -- 0:03:15
174000 -- (-1037.885) (-1043.331) [-1041.940] (-1045.801) * [-1040.628] (-1038.290) (-1043.427) (-1035.177) -- 0:03:14
174500 -- [-1035.179] (-1048.689) (-1039.485) (-1039.211) * (-1040.188) (-1037.629) (-1045.513) [-1037.397] -- 0:03:13
175000 -- (-1038.190) [-1035.284] (-1039.361) (-1038.647) * [-1038.209] (-1042.320) (-1047.647) (-1040.992) -- 0:03:13
Average standard deviation of split frequencies: 0.014157
175500 -- (-1035.342) [-1041.694] (-1040.315) (-1041.403) * [-1033.573] (-1040.664) (-1040.614) (-1037.335) -- 0:03:12
176000 -- (-1039.361) (-1038.030) (-1038.643) [-1039.767] * (-1045.616) (-1042.146) [-1040.804] (-1047.906) -- 0:03:11
176500 -- [-1034.888] (-1040.540) (-1044.739) (-1044.559) * (-1045.342) (-1036.541) (-1048.906) [-1044.502] -- 0:03:11
177000 -- [-1034.819] (-1050.826) (-1038.293) (-1046.272) * (-1042.820) [-1034.716] (-1039.570) (-1047.191) -- 0:03:15
177500 -- [-1037.245] (-1040.101) (-1041.456) (-1041.446) * (-1046.979) (-1039.669) (-1044.705) [-1039.448] -- 0:03:14
178000 -- (-1043.829) (-1039.223) [-1035.604] (-1042.252) * (-1052.398) (-1038.893) (-1041.326) [-1043.664] -- 0:03:13
178500 -- (-1039.812) [-1043.306] (-1047.296) (-1046.609) * (-1049.880) (-1040.139) [-1042.110] (-1035.760) -- 0:03:13
179000 -- [-1042.551] (-1045.780) (-1036.824) (-1041.870) * (-1048.264) (-1041.705) [-1047.612] (-1041.188) -- 0:03:12
179500 -- (-1047.909) (-1047.890) [-1038.981] (-1046.426) * (-1044.835) (-1041.712) [-1037.835] (-1038.436) -- 0:03:11
180000 -- (-1046.238) (-1048.364) [-1037.467] (-1040.364) * (-1048.117) [-1039.281] (-1046.015) (-1044.660) -- 0:03:11
Average standard deviation of split frequencies: 0.011555
180500 -- (-1043.480) (-1045.962) (-1045.849) [-1050.348] * (-1046.420) (-1034.689) [-1040.804] (-1043.166) -- 0:03:10
181000 -- (-1038.685) (-1051.961) [-1042.245] (-1034.204) * (-1042.577) (-1038.778) [-1048.374] (-1038.810) -- 0:03:10
181500 -- (-1039.926) [-1045.988] (-1034.975) (-1042.085) * (-1040.306) (-1045.620) (-1039.916) [-1047.523] -- 0:03:13
182000 -- [-1037.283] (-1048.363) (-1044.692) (-1047.989) * (-1043.665) (-1041.195) (-1036.299) [-1042.706] -- 0:03:13
182500 -- (-1038.983) (-1050.047) [-1044.864] (-1043.478) * (-1042.641) (-1039.586) (-1046.198) [-1043.145] -- 0:03:12
183000 -- (-1042.519) (-1048.882) (-1048.819) [-1040.439] * (-1040.739) (-1040.690) [-1032.974] (-1049.806) -- 0:03:11
183500 -- (-1039.386) [-1045.372] (-1042.235) (-1042.425) * (-1044.158) (-1040.454) (-1044.609) [-1040.950] -- 0:03:11
184000 -- (-1042.605) (-1042.243) [-1045.023] (-1040.377) * (-1039.644) (-1039.532) [-1037.454] (-1039.801) -- 0:03:10
184500 -- (-1044.920) (-1037.379) (-1040.110) [-1034.371] * (-1044.469) (-1038.091) (-1045.846) [-1040.888] -- 0:03:10
185000 -- (-1047.432) (-1041.172) (-1046.357) [-1038.938] * (-1040.043) (-1035.512) [-1038.708] (-1044.847) -- 0:03:09
Average standard deviation of split frequencies: 0.010500
185500 -- (-1049.416) [-1037.531] (-1044.103) (-1043.179) * [-1039.567] (-1039.571) (-1041.845) (-1037.716) -- 0:03:13
186000 -- (-1033.997) [-1039.860] (-1046.519) (-1041.358) * (-1038.835) [-1042.820] (-1036.898) (-1040.601) -- 0:03:12
186500 -- (-1038.202) [-1035.979] (-1048.144) (-1039.229) * (-1037.667) [-1037.246] (-1036.802) (-1045.117) -- 0:03:11
187000 -- (-1039.310) [-1043.440] (-1048.112) (-1042.623) * [-1043.629] (-1043.809) (-1039.521) (-1044.332) -- 0:03:11
187500 -- (-1043.073) [-1039.052] (-1053.655) (-1041.720) * [-1040.775] (-1042.609) (-1040.597) (-1041.074) -- 0:03:10
188000 -- [-1040.924] (-1040.645) (-1048.171) (-1040.926) * [-1040.762] (-1041.669) (-1034.722) (-1051.339) -- 0:03:10
188500 -- [-1036.113] (-1039.572) (-1054.485) (-1035.932) * (-1039.630) [-1042.821] (-1041.798) (-1039.475) -- 0:03:09
189000 -- (-1048.927) (-1034.809) [-1033.077] (-1044.096) * [-1048.616] (-1039.174) (-1038.519) (-1040.210) -- 0:03:08
189500 -- (-1045.125) (-1040.934) (-1041.002) [-1039.658] * [-1045.844] (-1035.195) (-1039.568) (-1042.935) -- 0:03:08
190000 -- (-1041.249) [-1035.001] (-1049.181) (-1037.422) * (-1039.766) [-1042.619] (-1045.575) (-1037.930) -- 0:03:11
Average standard deviation of split frequencies: 0.011302
190500 -- [-1036.154] (-1038.655) (-1048.490) (-1042.954) * [-1039.662] (-1043.074) (-1041.135) (-1043.978) -- 0:03:11
191000 -- (-1043.806) [-1048.729] (-1042.038) (-1040.805) * (-1037.288) (-1037.986) (-1049.424) [-1035.951] -- 0:03:10
191500 -- (-1041.420) (-1043.930) (-1038.149) [-1037.329] * (-1042.880) (-1044.042) (-1044.769) [-1043.003] -- 0:03:09
192000 -- [-1040.285] (-1039.603) (-1038.670) (-1043.701) * (-1042.224) (-1039.061) [-1040.247] (-1040.142) -- 0:03:09
192500 -- (-1039.038) (-1043.223) (-1044.147) [-1040.704] * (-1044.531) (-1043.097) [-1036.885] (-1040.828) -- 0:03:08
193000 -- (-1041.974) [-1040.163] (-1038.491) (-1040.956) * (-1037.731) (-1042.816) [-1036.345] (-1045.957) -- 0:03:08
193500 -- (-1046.438) (-1040.323) [-1038.427] (-1041.121) * [-1040.982] (-1040.512) (-1041.563) (-1040.914) -- 0:03:07
194000 -- (-1040.517) (-1038.248) [-1038.096] (-1038.680) * (-1045.907) (-1040.201) (-1037.357) [-1035.621] -- 0:03:11
194500 -- (-1044.929) [-1041.641] (-1040.660) (-1046.591) * (-1044.135) [-1040.116] (-1043.933) (-1048.487) -- 0:03:10
195000 -- [-1043.903] (-1039.765) (-1044.445) (-1043.434) * [-1043.772] (-1041.507) (-1039.387) (-1040.213) -- 0:03:09
Average standard deviation of split frequencies: 0.013744
195500 -- [-1043.823] (-1043.018) (-1047.180) (-1046.753) * (-1044.616) (-1038.640) [-1044.877] (-1046.601) -- 0:03:09
196000 -- (-1043.198) (-1045.985) (-1040.321) [-1044.518] * (-1045.527) (-1036.118) [-1040.039] (-1049.653) -- 0:03:08
196500 -- (-1039.882) [-1046.383] (-1036.476) (-1044.676) * [-1044.095] (-1042.162) (-1040.228) (-1037.905) -- 0:03:08
197000 -- (-1038.025) [-1039.386] (-1057.729) (-1045.578) * [-1037.560] (-1044.690) (-1037.939) (-1047.825) -- 0:03:07
197500 -- (-1035.209) (-1046.318) [-1045.326] (-1045.071) * (-1038.485) (-1038.303) (-1039.296) [-1038.393] -- 0:03:06
198000 -- (-1041.184) (-1042.308) (-1040.190) [-1035.736] * (-1040.782) [-1037.325] (-1035.682) (-1040.369) -- 0:03:06
198500 -- (-1041.127) (-1041.639) [-1038.043] (-1048.607) * (-1036.015) [-1041.852] (-1036.637) (-1037.223) -- 0:03:09
199000 -- [-1037.955] (-1037.408) (-1050.872) (-1046.658) * (-1040.341) [-1035.297] (-1046.503) (-1043.050) -- 0:03:09
199500 -- (-1042.277) [-1032.621] (-1054.669) (-1043.395) * (-1043.746) (-1040.157) (-1045.163) [-1045.569] -- 0:03:08
200000 -- (-1038.821) [-1037.440] (-1046.570) (-1052.224) * [-1033.790] (-1050.447) (-1041.382) (-1044.559) -- 0:03:08
Average standard deviation of split frequencies: 0.012753
200500 -- (-1040.048) [-1046.532] (-1053.284) (-1045.329) * (-1038.899) (-1037.060) (-1039.740) [-1040.797] -- 0:03:07
201000 -- (-1040.039) (-1048.788) [-1045.703] (-1039.570) * (-1038.540) (-1038.757) (-1036.316) [-1041.340] -- 0:03:06
201500 -- (-1035.264) (-1040.711) (-1053.496) [-1039.521] * (-1037.782) [-1050.187] (-1036.498) (-1047.516) -- 0:03:06
202000 -- (-1041.145) [-1038.422] (-1044.322) (-1045.039) * (-1044.849) (-1038.684) [-1041.054] (-1048.749) -- 0:03:05
202500 -- (-1042.260) (-1044.929) (-1036.066) [-1038.959] * (-1040.044) (-1032.647) (-1049.550) [-1047.921] -- 0:03:09
203000 -- (-1043.909) [-1038.792] (-1043.601) (-1041.780) * (-1042.818) (-1039.888) [-1040.932] (-1040.531) -- 0:03:08
203500 -- (-1043.294) [-1034.277] (-1043.882) (-1037.667) * [-1042.440] (-1035.700) (-1041.084) (-1036.232) -- 0:03:07
204000 -- (-1041.485) (-1038.609) [-1044.867] (-1040.090) * (-1042.131) (-1034.660) [-1038.267] (-1040.426) -- 0:03:07
204500 -- (-1046.559) (-1033.294) (-1040.612) [-1038.329] * (-1039.555) (-1041.690) (-1046.258) [-1039.376] -- 0:03:06
205000 -- (-1046.371) [-1044.084] (-1048.149) (-1039.227) * (-1044.181) (-1043.647) [-1044.979] (-1036.013) -- 0:03:06
Average standard deviation of split frequencies: 0.013730
205500 -- (-1048.431) (-1042.709) (-1043.979) [-1037.775] * (-1055.012) (-1053.734) (-1040.298) [-1035.845] -- 0:03:05
206000 -- (-1046.359) [-1041.230] (-1039.555) (-1040.433) * [-1042.252] (-1043.455) (-1041.147) (-1036.004) -- 0:03:05
206500 -- [-1042.273] (-1039.728) (-1045.482) (-1038.179) * (-1049.444) [-1038.621] (-1038.710) (-1041.754) -- 0:03:04
207000 -- (-1039.570) [-1039.587] (-1054.181) (-1039.565) * [-1037.425] (-1039.521) (-1036.575) (-1045.262) -- 0:03:07
207500 -- (-1048.640) [-1037.591] (-1048.817) (-1045.714) * (-1040.698) (-1042.885) [-1039.360] (-1043.334) -- 0:03:07
208000 -- (-1051.031) (-1045.056) (-1045.087) [-1044.626] * (-1039.439) [-1041.932] (-1042.226) (-1040.689) -- 0:03:06
208500 -- (-1048.152) (-1048.303) (-1046.454) [-1045.074] * (-1039.133) (-1037.073) [-1040.727] (-1039.534) -- 0:03:06
209000 -- [-1040.567] (-1044.497) (-1045.036) (-1048.131) * (-1047.732) (-1047.336) (-1040.875) [-1043.702] -- 0:03:05
209500 -- (-1038.485) [-1037.023] (-1042.436) (-1047.479) * [-1041.339] (-1037.477) (-1040.200) (-1044.615) -- 0:03:04
210000 -- (-1043.608) [-1037.902] (-1039.963) (-1044.196) * [-1044.841] (-1042.149) (-1044.115) (-1052.448) -- 0:03:04
Average standard deviation of split frequencies: 0.015664
210500 -- (-1036.987) (-1038.102) [-1038.220] (-1036.782) * [-1045.561] (-1048.656) (-1043.385) (-1035.657) -- 0:03:03
211000 -- [-1038.105] (-1041.280) (-1040.242) (-1036.800) * (-1046.482) (-1044.821) (-1046.747) [-1037.649] -- 0:03:06
211500 -- [-1035.330] (-1039.368) (-1040.265) (-1037.723) * (-1037.837) [-1043.165] (-1046.040) (-1039.016) -- 0:03:06
212000 -- (-1041.860) [-1047.320] (-1043.583) (-1039.699) * [-1039.532] (-1049.721) (-1041.563) (-1042.272) -- 0:03:05
212500 -- (-1046.404) (-1043.718) (-1041.366) [-1044.320] * (-1035.180) [-1038.887] (-1041.621) (-1039.513) -- 0:03:05
213000 -- (-1046.208) (-1052.512) (-1034.093) [-1038.634] * (-1043.441) [-1038.088] (-1043.552) (-1043.247) -- 0:03:04
213500 -- [-1038.112] (-1045.127) (-1041.087) (-1039.312) * (-1044.546) [-1036.591] (-1040.016) (-1039.525) -- 0:03:04
214000 -- (-1043.237) (-1041.323) (-1038.075) [-1041.248] * (-1039.734) (-1040.056) [-1036.802] (-1041.759) -- 0:03:03
214500 -- (-1044.375) [-1045.576] (-1041.435) (-1040.257) * (-1039.027) [-1039.027] (-1039.288) (-1038.815) -- 0:03:03
215000 -- (-1042.330) (-1037.577) [-1037.561] (-1044.360) * (-1042.791) (-1042.302) (-1040.064) [-1040.692] -- 0:03:02
Average standard deviation of split frequencies: 0.016836
215500 -- (-1043.278) [-1042.733] (-1034.601) (-1046.183) * (-1043.554) (-1041.439) (-1042.594) [-1044.931] -- 0:03:05
216000 -- (-1044.155) (-1039.408) [-1036.370] (-1037.235) * (-1046.956) (-1045.499) (-1046.688) [-1037.204] -- 0:03:05
216500 -- [-1042.875] (-1040.678) (-1051.440) (-1035.927) * [-1039.715] (-1037.018) (-1045.131) (-1040.301) -- 0:03:04
217000 -- (-1041.598) (-1036.500) (-1033.930) [-1037.530] * (-1042.781) (-1042.330) (-1036.233) [-1040.465] -- 0:03:04
217500 -- (-1044.268) [-1039.898] (-1036.350) (-1044.836) * (-1039.256) [-1043.505] (-1041.726) (-1035.380) -- 0:03:03
218000 -- (-1037.486) [-1044.277] (-1047.607) (-1041.103) * (-1037.167) (-1040.936) (-1041.038) [-1040.881] -- 0:03:02
218500 -- [-1040.693] (-1040.228) (-1051.481) (-1045.262) * (-1039.339) [-1043.539] (-1038.376) (-1052.680) -- 0:03:02
219000 -- (-1043.123) (-1045.662) [-1039.361] (-1038.093) * [-1040.937] (-1042.294) (-1040.158) (-1041.911) -- 0:03:01
219500 -- (-1046.699) (-1042.564) (-1046.409) [-1034.273] * (-1046.479) (-1045.451) [-1046.756] (-1045.280) -- 0:03:01
220000 -- [-1037.409] (-1038.764) (-1042.400) (-1041.114) * (-1047.098) [-1042.070] (-1045.690) (-1041.415) -- 0:03:04
Average standard deviation of split frequencies: 0.015259
220500 -- [-1037.220] (-1043.794) (-1039.403) (-1042.288) * (-1048.095) (-1042.365) [-1036.749] (-1042.717) -- 0:03:03
221000 -- [-1039.352] (-1040.030) (-1038.723) (-1059.533) * (-1042.489) (-1038.288) (-1041.943) [-1048.044] -- 0:03:03
221500 -- (-1041.698) (-1045.065) [-1036.305] (-1036.642) * (-1044.217) (-1040.555) [-1038.873] (-1043.425) -- 0:03:02
222000 -- [-1040.870] (-1045.213) (-1038.194) (-1045.593) * (-1038.137) (-1042.186) [-1035.183] (-1041.979) -- 0:03:02
222500 -- (-1036.488) [-1039.554] (-1045.450) (-1036.885) * (-1049.241) (-1036.477) (-1052.647) [-1042.563] -- 0:03:01
223000 -- (-1040.708) (-1039.336) (-1038.283) [-1037.707] * (-1048.174) (-1048.451) (-1042.034) [-1036.060] -- 0:03:01
223500 -- (-1037.403) (-1045.063) (-1036.988) [-1034.791] * (-1041.767) (-1042.189) (-1043.799) [-1043.006] -- 0:03:00
224000 -- (-1042.495) (-1043.660) [-1039.814] (-1043.341) * (-1045.701) [-1039.760] (-1039.406) (-1047.305) -- 0:03:03
224500 -- (-1037.323) (-1040.709) (-1037.004) [-1036.642] * (-1044.118) (-1045.000) (-1046.571) [-1043.419] -- 0:03:03
225000 -- [-1039.592] (-1038.088) (-1041.719) (-1037.777) * (-1043.353) (-1040.251) [-1043.120] (-1039.084) -- 0:03:02
Average standard deviation of split frequencies: 0.015197
225500 -- [-1039.040] (-1040.709) (-1037.148) (-1038.087) * (-1040.481) (-1036.277) (-1040.591) [-1038.259] -- 0:03:02
226000 -- [-1035.807] (-1044.182) (-1040.519) (-1042.123) * (-1042.137) (-1038.995) [-1042.079] (-1033.139) -- 0:03:01
226500 -- [-1045.415] (-1043.287) (-1046.474) (-1044.320) * (-1039.117) [-1038.622] (-1041.076) (-1037.276) -- 0:03:00
227000 -- (-1039.216) (-1046.238) (-1036.358) [-1036.590] * (-1040.629) (-1044.639) (-1040.856) [-1037.431] -- 0:03:00
227500 -- (-1037.711) (-1037.821) (-1045.337) [-1037.622] * (-1045.399) (-1038.131) (-1034.770) [-1038.849] -- 0:02:59
228000 -- [-1039.335] (-1043.490) (-1045.793) (-1037.774) * (-1040.466) (-1043.404) [-1037.945] (-1038.090) -- 0:03:02
228500 -- [-1037.147] (-1042.715) (-1048.907) (-1041.390) * (-1040.478) (-1043.419) [-1038.755] (-1036.820) -- 0:03:02
229000 -- (-1038.056) [-1040.457] (-1050.808) (-1042.396) * (-1040.984) [-1034.734] (-1039.327) (-1040.552) -- 0:03:01
229500 -- (-1039.153) (-1038.302) (-1048.239) [-1037.009] * (-1041.588) (-1042.298) [-1038.331] (-1040.142) -- 0:03:01
230000 -- [-1038.575] (-1038.025) (-1042.643) (-1035.129) * (-1041.244) (-1040.187) [-1039.171] (-1044.748) -- 0:03:00
Average standard deviation of split frequencies: 0.016057
230500 -- [-1039.779] (-1043.500) (-1045.281) (-1042.591) * [-1036.990] (-1036.094) (-1042.964) (-1039.345) -- 0:03:00
231000 -- [-1033.417] (-1049.147) (-1042.850) (-1043.111) * (-1048.487) [-1043.290] (-1040.668) (-1040.502) -- 0:02:59
231500 -- (-1037.026) (-1045.155) (-1042.187) [-1043.046] * (-1040.300) (-1044.230) (-1042.288) [-1036.517] -- 0:02:59
232000 -- [-1039.241] (-1043.298) (-1039.288) (-1041.023) * (-1046.859) (-1040.541) (-1037.971) [-1043.410] -- 0:03:02
232500 -- [-1040.730] (-1041.604) (-1043.743) (-1042.510) * (-1044.109) (-1036.719) (-1042.893) [-1035.422] -- 0:03:01
233000 -- (-1046.017) (-1045.300) (-1041.467) [-1042.621] * [-1041.183] (-1043.655) (-1037.409) (-1043.905) -- 0:03:01
233500 -- [-1038.023] (-1038.411) (-1043.212) (-1040.220) * (-1043.296) [-1041.313] (-1039.750) (-1042.993) -- 0:03:00
234000 -- (-1044.262) [-1046.091] (-1036.507) (-1041.393) * (-1039.538) [-1038.173] (-1036.845) (-1033.871) -- 0:03:00
234500 -- (-1038.413) (-1045.048) [-1047.656] (-1042.703) * (-1039.448) (-1047.153) (-1035.078) [-1034.194] -- 0:02:59
235000 -- (-1038.304) (-1042.837) (-1042.004) [-1039.617] * (-1034.772) [-1036.086] (-1045.056) (-1039.206) -- 0:02:59
Average standard deviation of split frequencies: 0.015694
235500 -- (-1043.701) (-1040.698) [-1036.483] (-1052.130) * (-1039.683) [-1036.994] (-1038.978) (-1038.725) -- 0:02:58
236000 -- (-1047.554) [-1048.183] (-1037.617) (-1043.269) * (-1048.306) [-1043.241] (-1037.793) (-1037.811) -- 0:02:58
236500 -- (-1044.683) (-1040.304) [-1042.381] (-1043.469) * (-1043.204) (-1036.285) [-1041.442] (-1038.796) -- 0:03:00
237000 -- (-1042.665) [-1044.169] (-1040.602) (-1047.862) * (-1035.197) (-1038.229) (-1038.496) [-1045.776] -- 0:03:00
237500 -- [-1039.594] (-1043.875) (-1047.488) (-1041.380) * (-1038.269) (-1045.506) (-1038.808) [-1035.219] -- 0:02:59
238000 -- (-1043.191) [-1038.672] (-1039.593) (-1038.446) * (-1042.521) (-1038.405) (-1051.156) [-1044.536] -- 0:02:59
238500 -- (-1037.955) (-1040.788) (-1037.966) [-1046.676] * [-1038.605] (-1044.469) (-1040.721) (-1044.965) -- 0:02:58
239000 -- (-1051.041) (-1043.949) (-1045.347) [-1037.786] * (-1038.823) (-1040.650) [-1043.682] (-1048.007) -- 0:02:58
239500 -- (-1050.087) (-1046.413) (-1044.575) [-1044.124] * (-1041.047) (-1045.399) (-1040.242) [-1051.043] -- 0:02:57
240000 -- [-1043.222] (-1041.320) (-1036.279) (-1045.348) * [-1039.073] (-1043.894) (-1040.087) (-1044.382) -- 0:02:57
Average standard deviation of split frequencies: 0.014271
240500 -- [-1039.932] (-1042.123) (-1044.308) (-1050.286) * [-1043.847] (-1043.469) (-1042.710) (-1042.474) -- 0:03:00
241000 -- (-1039.692) [-1040.588] (-1043.516) (-1039.205) * (-1040.599) [-1040.956] (-1036.225) (-1046.874) -- 0:02:59
241500 -- (-1043.002) (-1036.164) (-1046.297) [-1037.515] * (-1041.507) (-1040.650) [-1036.564] (-1038.152) -- 0:02:59
242000 -- (-1046.189) (-1033.184) (-1046.813) [-1039.793] * (-1040.923) [-1042.879] (-1047.968) (-1061.268) -- 0:02:58
242500 -- (-1037.468) (-1041.702) (-1043.761) [-1042.637] * [-1044.910] (-1047.503) (-1036.842) (-1043.146) -- 0:02:58
243000 -- (-1041.725) (-1041.406) [-1041.891] (-1042.807) * (-1037.963) [-1035.542] (-1044.347) (-1043.748) -- 0:02:57
243500 -- (-1038.246) (-1040.458) [-1047.438] (-1047.779) * (-1038.298) [-1037.568] (-1042.416) (-1054.098) -- 0:02:57
244000 -- (-1054.315) (-1047.778) (-1048.568) [-1042.582] * (-1040.281) (-1039.210) (-1037.850) [-1042.277] -- 0:02:56
244500 -- (-1049.872) (-1039.658) (-1046.012) [-1042.259] * [-1037.706] (-1041.822) (-1042.486) (-1043.751) -- 0:02:56
245000 -- (-1040.717) [-1041.208] (-1045.906) (-1041.368) * (-1039.073) (-1042.107) (-1040.272) [-1040.915] -- 0:02:58
Average standard deviation of split frequencies: 0.012593
245500 -- (-1041.648) (-1047.849) [-1042.091] (-1043.465) * (-1036.998) [-1036.965] (-1031.825) (-1045.688) -- 0:02:58
246000 -- (-1037.059) [-1036.351] (-1042.122) (-1036.502) * (-1044.854) (-1038.119) (-1041.444) [-1035.807] -- 0:02:57
246500 -- (-1036.106) [-1035.631] (-1037.948) (-1039.524) * (-1044.457) (-1043.400) [-1041.377] (-1048.332) -- 0:02:57
247000 -- (-1041.166) (-1037.940) [-1040.231] (-1042.077) * (-1041.779) (-1038.302) (-1036.059) [-1048.793] -- 0:02:56
247500 -- (-1051.796) (-1044.137) [-1044.981] (-1035.572) * (-1037.336) [-1039.216] (-1039.165) (-1041.493) -- 0:02:56
248000 -- [-1038.013] (-1049.005) (-1039.941) (-1047.653) * (-1040.105) (-1038.088) [-1040.697] (-1045.279) -- 0:02:55
248500 -- (-1036.723) [-1036.579] (-1042.201) (-1043.045) * (-1035.706) (-1036.556) [-1046.373] (-1046.573) -- 0:02:55
249000 -- (-1035.854) [-1040.013] (-1042.654) (-1046.784) * [-1044.456] (-1043.168) (-1043.708) (-1046.980) -- 0:02:57
249500 -- [-1034.806] (-1042.115) (-1042.241) (-1036.255) * (-1037.860) (-1040.159) (-1041.392) [-1040.380] -- 0:02:57
250000 -- (-1043.225) (-1037.125) (-1040.333) [-1039.264] * (-1043.950) (-1040.603) [-1035.856] (-1038.608) -- 0:02:57
Average standard deviation of split frequencies: 0.013164
250500 -- (-1041.823) (-1046.463) [-1043.709] (-1044.484) * (-1039.704) [-1041.388] (-1036.351) (-1044.686) -- 0:02:56
251000 -- [-1038.510] (-1038.182) (-1037.147) (-1043.265) * (-1041.145) [-1038.593] (-1038.258) (-1040.559) -- 0:02:56
251500 -- [-1043.023] (-1045.437) (-1039.951) (-1042.710) * (-1038.595) (-1042.215) [-1031.339] (-1045.821) -- 0:02:55
252000 -- (-1040.919) (-1041.722) [-1034.351] (-1037.124) * (-1039.262) [-1040.941] (-1042.005) (-1035.299) -- 0:02:55
252500 -- [-1037.630] (-1042.105) (-1042.718) (-1034.438) * (-1036.438) (-1043.479) (-1043.822) [-1037.005] -- 0:02:54
253000 -- (-1042.803) [-1041.512] (-1038.587) (-1036.788) * (-1039.980) (-1040.428) [-1038.967] (-1037.466) -- 0:02:54
253500 -- [-1037.653] (-1035.820) (-1041.779) (-1039.798) * (-1041.827) (-1039.482) (-1039.697) [-1036.044] -- 0:02:56
254000 -- (-1036.542) [-1041.346] (-1035.865) (-1040.933) * (-1041.794) (-1040.103) [-1033.907] (-1048.982) -- 0:02:56
254500 -- (-1038.942) [-1042.839] (-1037.800) (-1039.633) * (-1037.446) [-1036.609] (-1049.240) (-1046.844) -- 0:02:55
255000 -- [-1046.024] (-1048.460) (-1042.755) (-1042.381) * (-1041.255) [-1037.358] (-1036.642) (-1039.621) -- 0:02:55
Average standard deviation of split frequencies: 0.013679
255500 -- (-1042.824) (-1042.819) (-1045.559) [-1037.116] * (-1047.587) [-1040.195] (-1042.943) (-1039.752) -- 0:02:54
256000 -- (-1039.374) [-1037.992] (-1043.253) (-1036.946) * (-1043.369) (-1043.827) [-1042.925] (-1044.786) -- 0:02:54
256500 -- (-1037.132) (-1048.185) [-1039.552] (-1045.117) * (-1046.030) (-1041.572) [-1039.137] (-1035.919) -- 0:02:53
257000 -- (-1045.022) (-1047.105) [-1045.140] (-1038.408) * (-1039.601) (-1048.322) [-1041.161] (-1040.888) -- 0:02:53
257500 -- (-1037.230) [-1040.833] (-1051.557) (-1043.618) * [-1039.057] (-1042.642) (-1038.333) (-1038.492) -- 0:02:53
258000 -- (-1044.594) [-1042.446] (-1037.028) (-1044.308) * (-1049.319) (-1044.101) (-1041.522) [-1043.106] -- 0:02:55
258500 -- [-1031.930] (-1049.532) (-1040.404) (-1043.431) * [-1036.386] (-1043.524) (-1044.718) (-1045.109) -- 0:02:54
259000 -- (-1042.218) [-1037.607] (-1043.641) (-1040.537) * (-1044.394) (-1045.310) [-1042.405] (-1037.157) -- 0:02:54
259500 -- [-1037.703] (-1040.298) (-1046.821) (-1047.268) * (-1039.388) (-1056.183) [-1039.098] (-1041.099) -- 0:02:54
260000 -- (-1039.949) [-1039.678] (-1042.461) (-1045.804) * (-1044.645) (-1038.851) [-1039.316] (-1039.446) -- 0:02:53
Average standard deviation of split frequencies: 0.012659
260500 -- (-1036.166) (-1047.539) [-1044.080] (-1053.057) * (-1036.984) (-1039.775) [-1039.477] (-1045.459) -- 0:02:53
261000 -- (-1041.836) [-1033.847] (-1038.363) (-1057.347) * (-1041.043) [-1039.882] (-1042.230) (-1040.260) -- 0:02:52
261500 -- [-1038.295] (-1044.257) (-1040.509) (-1041.330) * (-1043.569) (-1050.836) [-1040.771] (-1043.169) -- 0:02:52
262000 -- (-1043.151) [-1040.019] (-1039.474) (-1043.246) * (-1043.493) [-1033.773] (-1040.696) (-1041.432) -- 0:02:51
262500 -- (-1032.901) (-1043.499) [-1043.573] (-1039.154) * [-1041.971] (-1038.364) (-1048.710) (-1043.330) -- 0:02:54
263000 -- (-1039.660) (-1048.397) (-1039.738) [-1043.857] * [-1036.900] (-1039.486) (-1039.304) (-1041.313) -- 0:02:53
263500 -- (-1042.987) [-1037.514] (-1046.120) (-1034.511) * (-1036.259) (-1047.360) (-1037.538) [-1040.946] -- 0:02:53
264000 -- (-1036.154) [-1039.884] (-1041.132) (-1044.235) * [-1036.449] (-1046.176) (-1037.917) (-1045.482) -- 0:02:52
264500 -- (-1039.829) (-1057.824) [-1039.382] (-1049.166) * (-1040.164) [-1043.735] (-1039.356) (-1046.585) -- 0:02:52
265000 -- (-1046.161) (-1039.265) [-1041.602] (-1037.493) * (-1040.873) (-1052.853) (-1034.754) [-1036.778] -- 0:02:51
Average standard deviation of split frequencies: 0.012659
265500 -- (-1042.433) (-1038.356) [-1033.091] (-1044.649) * (-1040.862) [-1042.770] (-1043.815) (-1038.970) -- 0:02:51
266000 -- (-1037.496) (-1041.613) [-1036.528] (-1039.449) * (-1042.327) [-1043.557] (-1047.320) (-1042.008) -- 0:02:51
266500 -- (-1041.856) (-1042.289) (-1044.254) [-1040.637] * [-1036.124] (-1037.076) (-1040.974) (-1039.246) -- 0:02:50
267000 -- (-1039.611) [-1036.976] (-1045.225) (-1043.502) * (-1040.476) (-1040.559) (-1041.562) [-1039.364] -- 0:02:52
267500 -- [-1043.043] (-1040.067) (-1045.870) (-1038.126) * (-1036.334) (-1040.473) [-1045.499] (-1043.139) -- 0:02:52
268000 -- (-1045.351) (-1041.315) [-1039.760] (-1050.547) * (-1050.356) (-1037.631) (-1036.254) [-1037.562] -- 0:02:52
268500 -- (-1038.527) [-1040.262] (-1045.058) (-1039.621) * [-1043.365] (-1047.066) (-1044.412) (-1040.448) -- 0:02:51
269000 -- (-1037.534) (-1036.994) (-1048.607) [-1039.113] * [-1035.864] (-1034.620) (-1040.520) (-1040.856) -- 0:02:51
269500 -- (-1037.022) [-1033.363] (-1043.214) (-1041.580) * (-1038.214) (-1045.634) (-1046.658) [-1046.706] -- 0:02:50
270000 -- (-1039.260) [-1041.781] (-1037.627) (-1044.104) * [-1037.435] (-1040.081) (-1044.074) (-1048.354) -- 0:02:50
Average standard deviation of split frequencies: 0.011943
270500 -- (-1037.932) (-1041.830) (-1040.312) [-1042.037] * (-1039.294) [-1039.505] (-1040.902) (-1050.684) -- 0:02:49
271000 -- (-1039.064) [-1037.052] (-1036.776) (-1038.434) * (-1045.484) [-1037.878] (-1048.150) (-1044.394) -- 0:02:49
271500 -- (-1039.870) (-1039.473) [-1040.135] (-1038.846) * [-1040.606] (-1040.150) (-1048.575) (-1039.081) -- 0:02:51
272000 -- [-1039.998] (-1042.525) (-1039.983) (-1043.101) * (-1043.358) [-1038.564] (-1049.999) (-1048.465) -- 0:02:51
272500 -- [-1040.582] (-1041.661) (-1037.810) (-1034.202) * (-1041.626) [-1038.950] (-1044.917) (-1045.755) -- 0:02:50
273000 -- [-1038.632] (-1044.031) (-1047.732) (-1041.037) * (-1036.612) [-1040.556] (-1049.090) (-1049.855) -- 0:02:50
273500 -- (-1044.882) (-1041.020) (-1041.296) [-1042.808] * (-1043.764) [-1035.977] (-1037.623) (-1045.959) -- 0:02:50
274000 -- (-1044.814) (-1039.589) [-1043.179] (-1039.321) * [-1037.281] (-1043.330) (-1040.285) (-1052.369) -- 0:02:49
274500 -- (-1042.231) [-1042.127] (-1036.410) (-1043.814) * [-1041.135] (-1039.552) (-1040.595) (-1051.172) -- 0:02:49
275000 -- (-1038.292) [-1050.622] (-1036.988) (-1043.760) * [-1037.614] (-1051.993) (-1037.824) (-1054.991) -- 0:02:48
Average standard deviation of split frequencies: 0.011742
275500 -- (-1039.352) (-1038.552) [-1038.762] (-1041.608) * (-1037.777) [-1050.852] (-1037.650) (-1044.899) -- 0:02:48
276000 -- [-1045.489] (-1058.121) (-1037.803) (-1043.996) * [-1035.238] (-1040.612) (-1038.500) (-1049.550) -- 0:02:50
276500 -- (-1038.519) (-1057.667) [-1040.741] (-1048.281) * [-1035.199] (-1040.239) (-1050.963) (-1040.398) -- 0:02:50
277000 -- [-1037.494] (-1048.273) (-1041.146) (-1040.828) * (-1042.947) (-1052.349) (-1046.868) [-1045.775] -- 0:02:49
277500 -- [-1037.067] (-1045.816) (-1046.295) (-1041.061) * (-1039.857) (-1057.719) (-1039.717) [-1037.163] -- 0:02:49
278000 -- (-1039.063) [-1044.756] (-1044.643) (-1043.674) * [-1038.937] (-1058.031) (-1042.266) (-1039.378) -- 0:02:48
278500 -- (-1042.754) (-1043.375) (-1045.366) [-1042.791] * (-1045.724) (-1046.266) [-1037.403] (-1039.340) -- 0:02:48
279000 -- [-1034.652] (-1038.271) (-1049.845) (-1042.687) * (-1038.939) [-1038.692] (-1040.120) (-1034.573) -- 0:02:47
279500 -- [-1035.489] (-1048.097) (-1045.995) (-1043.988) * (-1043.905) [-1040.571] (-1040.964) (-1040.667) -- 0:02:47
280000 -- [-1048.051] (-1049.669) (-1047.760) (-1039.450) * [-1035.584] (-1041.200) (-1040.909) (-1038.429) -- 0:02:47
Average standard deviation of split frequencies: 0.012597
280500 -- [-1039.682] (-1047.247) (-1041.267) (-1042.492) * (-1038.770) [-1038.940] (-1039.224) (-1039.395) -- 0:02:49
281000 -- (-1035.998) (-1037.803) [-1043.264] (-1042.021) * [-1038.948] (-1036.757) (-1041.041) (-1040.496) -- 0:02:48
281500 -- (-1044.593) [-1043.296] (-1043.838) (-1046.707) * (-1046.282) (-1041.231) (-1045.973) [-1038.384] -- 0:02:48
282000 -- (-1041.106) (-1057.396) (-1041.245) [-1037.470] * (-1034.940) [-1041.256] (-1052.060) (-1043.905) -- 0:02:48
282500 -- (-1034.514) (-1049.354) (-1043.099) [-1045.901] * [-1038.415] (-1040.779) (-1041.371) (-1041.400) -- 0:02:47
283000 -- [-1039.365] (-1037.755) (-1035.531) (-1038.543) * (-1045.918) (-1040.633) (-1040.253) [-1038.732] -- 0:02:47
283500 -- [-1036.029] (-1038.973) (-1045.874) (-1036.014) * (-1043.893) (-1042.497) [-1038.280] (-1047.448) -- 0:02:46
284000 -- [-1039.950] (-1038.829) (-1046.725) (-1039.210) * (-1039.502) [-1045.209] (-1041.095) (-1040.529) -- 0:02:46
284500 -- (-1037.845) (-1039.103) [-1046.105] (-1048.952) * (-1039.148) [-1039.019] (-1038.509) (-1037.714) -- 0:02:48
285000 -- [-1035.707] (-1039.159) (-1048.956) (-1041.363) * (-1036.763) [-1036.150] (-1043.491) (-1042.969) -- 0:02:48
Average standard deviation of split frequencies: 0.013392
285500 -- [-1042.544] (-1044.866) (-1047.269) (-1044.097) * [-1038.704] (-1040.645) (-1042.016) (-1043.742) -- 0:02:47
286000 -- (-1036.409) (-1038.648) (-1045.570) [-1038.764] * (-1041.524) [-1035.103] (-1037.817) (-1044.302) -- 0:02:47
286500 -- (-1042.278) [-1042.652] (-1045.448) (-1038.631) * [-1051.217] (-1041.573) (-1035.712) (-1043.145) -- 0:02:46
287000 -- (-1037.778) (-1046.158) (-1047.418) [-1048.411] * (-1042.689) (-1039.997) [-1039.602] (-1043.831) -- 0:02:46
287500 -- (-1038.105) (-1049.571) (-1043.039) [-1039.168] * [-1041.140] (-1046.203) (-1043.449) (-1043.002) -- 0:02:46
288000 -- [-1039.505] (-1047.097) (-1037.661) (-1042.912) * [-1035.832] (-1039.210) (-1044.643) (-1044.436) -- 0:02:45
288500 -- (-1043.972) (-1043.156) [-1042.733] (-1039.394) * [-1040.078] (-1036.944) (-1039.178) (-1040.015) -- 0:02:45
289000 -- (-1038.948) (-1043.666) [-1041.479] (-1050.606) * (-1047.079) (-1035.862) [-1040.697] (-1041.489) -- 0:02:47
289500 -- (-1045.464) (-1048.184) (-1038.674) [-1037.727] * [-1039.097] (-1047.570) (-1038.224) (-1037.807) -- 0:02:46
290000 -- (-1035.581) (-1039.859) (-1038.254) [-1039.047] * (-1040.181) [-1046.749] (-1043.707) (-1040.712) -- 0:02:46
Average standard deviation of split frequencies: 0.013177
290500 -- (-1037.537) (-1045.935) (-1042.501) [-1041.469] * (-1043.430) [-1038.518] (-1039.613) (-1037.289) -- 0:02:46
291000 -- [-1037.362] (-1037.068) (-1042.106) (-1047.930) * (-1037.136) [-1039.425] (-1039.221) (-1040.333) -- 0:02:45
291500 -- (-1042.500) (-1037.092) [-1039.460] (-1044.521) * [-1038.253] (-1039.433) (-1035.028) (-1049.472) -- 0:02:45
292000 -- (-1037.817) (-1040.600) (-1040.567) [-1038.480] * (-1037.869) [-1039.342] (-1036.870) (-1043.524) -- 0:02:44
292500 -- [-1042.715] (-1049.989) (-1044.899) (-1035.758) * [-1039.788] (-1042.516) (-1038.097) (-1039.482) -- 0:02:44
293000 -- (-1044.028) (-1047.148) (-1036.153) [-1040.185] * (-1041.992) (-1035.714) [-1038.529] (-1035.822) -- 0:02:44
293500 -- (-1045.971) [-1044.774] (-1043.239) (-1037.489) * (-1042.398) (-1041.531) [-1041.025] (-1043.717) -- 0:02:46
294000 -- (-1049.399) (-1044.615) (-1043.414) [-1037.519] * (-1047.903) (-1040.811) [-1040.911] (-1037.663) -- 0:02:45
294500 -- (-1038.481) [-1042.532] (-1044.575) (-1039.007) * (-1040.568) [-1040.488] (-1035.318) (-1040.025) -- 0:02:45
295000 -- (-1043.611) [-1048.634] (-1040.085) (-1041.020) * (-1044.486) [-1046.703] (-1038.441) (-1036.658) -- 0:02:44
Average standard deviation of split frequencies: 0.013736
295500 -- (-1043.924) [-1033.817] (-1049.275) (-1040.530) * (-1047.715) (-1042.360) (-1037.582) [-1034.638] -- 0:02:44
296000 -- [-1034.433] (-1038.396) (-1050.389) (-1043.065) * (-1048.144) (-1048.054) [-1034.432] (-1043.864) -- 0:02:44
296500 -- [-1043.514] (-1050.328) (-1051.362) (-1036.172) * [-1037.368] (-1043.233) (-1040.405) (-1043.562) -- 0:02:43
297000 -- (-1039.721) (-1045.295) (-1049.773) [-1033.964] * (-1045.044) [-1040.859] (-1043.603) (-1036.072) -- 0:02:43
297500 -- [-1039.123] (-1038.385) (-1045.412) (-1036.230) * (-1044.130) (-1046.777) (-1041.894) [-1044.149] -- 0:02:42
298000 -- [-1045.439] (-1041.718) (-1043.771) (-1039.927) * [-1035.306] (-1049.757) (-1040.595) (-1040.147) -- 0:02:44
298500 -- [-1036.949] (-1038.894) (-1043.247) (-1047.444) * (-1034.918) (-1055.012) (-1038.362) [-1037.070] -- 0:02:44
299000 -- [-1044.472] (-1036.935) (-1038.982) (-1036.909) * (-1040.916) (-1043.011) [-1037.625] (-1039.247) -- 0:02:44
299500 -- (-1038.620) [-1043.221] (-1040.914) (-1041.733) * [-1041.064] (-1036.306) (-1039.576) (-1036.768) -- 0:02:43
300000 -- (-1038.638) (-1037.842) [-1035.177] (-1038.915) * (-1043.957) (-1042.740) [-1036.559] (-1039.930) -- 0:02:43
Average standard deviation of split frequencies: 0.014111
300500 -- (-1041.082) (-1041.564) [-1035.603] (-1041.686) * [-1042.610] (-1044.568) (-1047.551) (-1040.265) -- 0:02:42
301000 -- (-1037.309) (-1040.280) [-1042.624] (-1038.309) * (-1034.647) [-1037.905] (-1050.560) (-1041.837) -- 0:02:42
301500 -- (-1045.221) (-1037.263) [-1033.492] (-1044.666) * [-1038.214] (-1047.253) (-1038.986) (-1041.046) -- 0:02:42
302000 -- (-1049.782) (-1037.066) [-1035.728] (-1040.868) * [-1036.762] (-1042.135) (-1039.061) (-1047.510) -- 0:02:41
302500 -- (-1041.565) (-1036.586) [-1037.249] (-1042.458) * (-1042.531) (-1044.421) [-1043.644] (-1040.621) -- 0:02:43
303000 -- (-1038.022) [-1036.125] (-1039.795) (-1046.813) * (-1039.084) (-1045.508) [-1034.385] (-1042.724) -- 0:02:43
303500 -- (-1034.491) (-1042.433) [-1034.093] (-1044.010) * (-1047.581) [-1040.074] (-1042.817) (-1056.485) -- 0:02:42
304000 -- (-1043.820) (-1042.654) (-1041.305) [-1044.798] * (-1047.291) (-1040.662) (-1041.356) [-1042.923] -- 0:02:42
304500 -- (-1051.131) (-1039.778) [-1036.976] (-1038.076) * [-1039.284] (-1040.261) (-1040.150) (-1047.059) -- 0:02:42
305000 -- (-1042.517) (-1038.433) [-1039.720] (-1041.531) * (-1042.629) (-1044.451) (-1040.681) [-1042.842] -- 0:02:41
Average standard deviation of split frequencies: 0.013645
305500 -- [-1039.502] (-1037.704) (-1046.067) (-1040.133) * (-1044.256) (-1037.666) [-1046.597] (-1035.581) -- 0:02:41
306000 -- [-1034.762] (-1037.488) (-1048.440) (-1041.939) * (-1048.151) (-1041.554) (-1042.045) [-1036.261] -- 0:02:41
306500 -- [-1037.837] (-1041.281) (-1036.612) (-1039.007) * (-1040.466) (-1038.742) [-1034.382] (-1044.959) -- 0:02:42
307000 -- (-1044.724) (-1043.146) [-1040.581] (-1041.024) * (-1036.577) [-1045.971] (-1037.016) (-1039.732) -- 0:02:42
307500 -- (-1039.798) (-1042.272) [-1043.150] (-1035.909) * (-1036.530) (-1046.416) (-1043.348) [-1040.823] -- 0:02:42
308000 -- [-1038.903] (-1040.630) (-1037.919) (-1044.490) * (-1037.565) (-1041.149) [-1043.007] (-1039.574) -- 0:02:41
308500 -- (-1041.774) (-1045.113) [-1037.839] (-1044.614) * (-1036.268) (-1043.701) [-1039.085] (-1044.228) -- 0:02:41
309000 -- (-1044.916) [-1046.178] (-1037.158) (-1052.525) * [-1041.687] (-1043.442) (-1042.556) (-1040.343) -- 0:02:41
309500 -- [-1049.982] (-1048.144) (-1037.898) (-1041.996) * (-1038.449) (-1040.542) [-1041.508] (-1044.196) -- 0:02:40
310000 -- (-1044.986) (-1040.695) (-1043.203) [-1047.891] * (-1044.134) [-1044.699] (-1040.344) (-1051.079) -- 0:02:40
Average standard deviation of split frequencies: 0.014226
310500 -- (-1040.120) [-1041.925] (-1040.233) (-1041.444) * (-1044.391) (-1045.796) [-1040.073] (-1037.960) -- 0:02:39
311000 -- [-1039.537] (-1036.536) (-1039.569) (-1037.834) * (-1044.686) [-1038.635] (-1044.964) (-1049.646) -- 0:02:41
311500 -- (-1042.993) (-1040.125) [-1035.842] (-1039.749) * (-1038.288) (-1054.468) (-1042.235) [-1037.665] -- 0:02:41
312000 -- (-1041.624) [-1035.833] (-1037.834) (-1037.344) * (-1038.925) (-1050.387) (-1045.678) [-1040.404] -- 0:02:40
312500 -- (-1045.060) (-1042.369) (-1039.372) [-1043.008] * [-1038.719] (-1037.881) (-1039.199) (-1047.510) -- 0:02:40
313000 -- [-1041.077] (-1042.948) (-1041.165) (-1049.885) * (-1038.564) [-1035.535] (-1034.945) (-1053.539) -- 0:02:40
313500 -- [-1044.258] (-1036.588) (-1044.842) (-1047.637) * [-1044.167] (-1044.854) (-1045.035) (-1041.347) -- 0:02:39
314000 -- (-1042.084) (-1039.804) (-1042.056) [-1034.198] * (-1040.280) [-1043.358] (-1043.640) (-1037.934) -- 0:02:39
314500 -- (-1041.465) (-1040.028) [-1037.545] (-1043.346) * (-1042.856) (-1037.565) (-1047.357) [-1044.272] -- 0:02:39
315000 -- (-1042.538) [-1039.157] (-1039.874) (-1036.647) * (-1041.621) (-1043.553) (-1046.597) [-1040.234] -- 0:02:38
Average standard deviation of split frequencies: 0.013426
315500 -- (-1043.990) [-1038.177] (-1040.139) (-1040.209) * (-1035.834) [-1038.320] (-1041.862) (-1040.040) -- 0:02:40
316000 -- (-1040.994) (-1041.855) (-1036.724) [-1039.935] * (-1041.050) [-1041.954] (-1044.081) (-1043.593) -- 0:02:40
316500 -- (-1043.123) (-1041.218) [-1040.982] (-1040.904) * (-1045.601) (-1042.570) [-1040.180] (-1045.453) -- 0:02:39
317000 -- (-1042.027) (-1048.129) [-1040.235] (-1043.941) * (-1042.570) (-1040.403) (-1034.888) [-1040.437] -- 0:02:39
317500 -- [-1035.003] (-1043.546) (-1039.637) (-1043.822) * (-1042.455) (-1050.591) [-1044.100] (-1041.195) -- 0:02:39
318000 -- (-1039.375) [-1035.595] (-1042.543) (-1046.943) * [-1042.295] (-1043.343) (-1037.920) (-1042.888) -- 0:02:38
318500 -- (-1037.777) [-1042.983] (-1034.467) (-1042.837) * (-1043.646) (-1037.579) [-1040.819] (-1041.084) -- 0:02:38
319000 -- [-1039.633] (-1037.706) (-1042.605) (-1039.281) * (-1046.823) (-1042.956) (-1039.410) [-1041.405] -- 0:02:37
319500 -- [-1042.861] (-1044.122) (-1047.898) (-1041.155) * (-1038.767) [-1042.338] (-1041.187) (-1045.074) -- 0:02:37
320000 -- (-1039.817) (-1042.692) [-1034.385] (-1040.641) * (-1037.220) (-1040.140) (-1048.820) [-1034.912] -- 0:02:39
Average standard deviation of split frequencies: 0.012181
320500 -- (-1039.539) (-1041.016) [-1038.578] (-1040.323) * (-1041.290) (-1040.862) [-1042.074] (-1036.580) -- 0:02:39
321000 -- (-1036.326) [-1036.783] (-1041.359) (-1040.537) * (-1042.396) [-1036.036] (-1041.669) (-1047.214) -- 0:02:38
321500 -- (-1043.008) (-1040.181) [-1038.586] (-1041.281) * (-1038.894) (-1040.881) [-1044.000] (-1049.193) -- 0:02:38
322000 -- (-1042.123) (-1040.398) (-1039.964) [-1037.064] * (-1039.515) [-1041.489] (-1053.998) (-1041.366) -- 0:02:37
322500 -- (-1045.432) (-1045.808) (-1036.721) [-1036.106] * (-1042.336) [-1040.874] (-1046.277) (-1056.161) -- 0:02:37
323000 -- (-1044.529) [-1043.939] (-1043.480) (-1043.883) * (-1059.164) (-1041.239) (-1044.737) [-1042.892] -- 0:02:37
323500 -- (-1053.426) [-1037.719] (-1038.840) (-1039.360) * (-1047.235) (-1039.428) [-1040.615] (-1042.760) -- 0:02:36
324000 -- (-1046.224) (-1049.208) [-1035.794] (-1039.035) * (-1051.124) (-1043.227) (-1040.283) [-1036.018] -- 0:02:38
324500 -- (-1045.780) [-1036.827] (-1044.400) (-1040.424) * (-1041.487) (-1039.381) (-1041.121) [-1035.530] -- 0:02:38
325000 -- (-1047.013) (-1036.023) [-1041.000] (-1041.254) * [-1038.339] (-1040.954) (-1042.744) (-1040.874) -- 0:02:37
Average standard deviation of split frequencies: 0.011775
325500 -- (-1040.830) (-1034.910) (-1046.773) [-1045.529] * (-1042.367) (-1038.299) (-1042.254) [-1036.702] -- 0:02:37
326000 -- (-1043.979) (-1042.724) [-1042.479] (-1038.402) * (-1043.544) (-1041.750) (-1043.737) [-1042.476] -- 0:02:37
326500 -- (-1045.668) (-1037.641) (-1038.561) [-1037.702] * (-1037.751) [-1046.678] (-1042.860) (-1048.702) -- 0:02:36
327000 -- (-1039.534) (-1036.620) [-1036.398] (-1041.158) * (-1034.775) (-1044.711) (-1044.559) [-1039.042] -- 0:02:36
327500 -- [-1044.457] (-1044.595) (-1037.427) (-1042.672) * (-1037.103) (-1035.431) (-1042.904) [-1038.284] -- 0:02:36
328000 -- (-1040.361) (-1037.509) [-1040.008] (-1040.977) * (-1048.226) [-1038.049] (-1042.152) (-1043.278) -- 0:02:35
328500 -- [-1038.043] (-1037.350) (-1043.235) (-1044.028) * [-1042.933] (-1042.572) (-1044.900) (-1037.815) -- 0:02:37
329000 -- [-1033.954] (-1042.319) (-1043.850) (-1036.557) * (-1047.419) [-1041.901] (-1044.324) (-1042.562) -- 0:02:37
329500 -- (-1043.851) (-1036.334) [-1042.078] (-1043.834) * [-1040.530] (-1042.269) (-1042.776) (-1035.620) -- 0:02:36
330000 -- [-1040.406] (-1035.629) (-1043.799) (-1042.111) * (-1044.444) (-1040.587) [-1039.209] (-1045.910) -- 0:02:36
Average standard deviation of split frequencies: 0.010998
330500 -- (-1046.894) [-1036.271] (-1051.312) (-1054.813) * (-1039.352) (-1040.221) (-1039.758) [-1040.425] -- 0:02:35
331000 -- (-1042.777) (-1038.922) [-1044.147] (-1048.949) * (-1045.817) (-1037.905) [-1035.899] (-1051.754) -- 0:02:35
331500 -- (-1037.710) (-1038.982) [-1042.912] (-1047.016) * (-1042.422) [-1042.205] (-1048.169) (-1045.793) -- 0:02:35
332000 -- (-1044.564) [-1039.797] (-1042.727) (-1043.117) * (-1044.957) [-1041.572] (-1050.199) (-1040.707) -- 0:02:34
332500 -- (-1042.641) (-1039.893) [-1042.961] (-1039.661) * (-1038.538) (-1047.092) (-1038.262) [-1035.209] -- 0:02:36
333000 -- (-1044.206) (-1047.823) [-1036.435] (-1042.832) * (-1043.003) (-1042.790) [-1041.527] (-1039.839) -- 0:02:36
333500 -- (-1044.402) (-1045.878) [-1036.130] (-1047.048) * (-1046.537) (-1044.762) (-1037.663) [-1037.626] -- 0:02:35
334000 -- (-1052.387) [-1039.194] (-1042.321) (-1043.438) * (-1044.269) (-1042.039) (-1039.671) [-1038.114] -- 0:02:35
334500 -- (-1037.889) (-1039.369) (-1041.292) [-1043.308] * (-1049.777) [-1049.177] (-1048.988) (-1035.187) -- 0:02:35
335000 -- (-1035.226) (-1035.333) [-1042.693] (-1036.998) * [-1040.640] (-1045.680) (-1042.278) (-1045.142) -- 0:02:34
Average standard deviation of split frequencies: 0.009821
335500 -- (-1040.510) (-1039.133) (-1044.598) [-1034.906] * (-1036.860) [-1036.567] (-1044.418) (-1049.591) -- 0:02:34
336000 -- (-1038.705) (-1035.102) (-1037.820) [-1039.206] * (-1037.880) [-1046.326] (-1038.590) (-1046.120) -- 0:02:34
336500 -- [-1035.589] (-1034.423) (-1039.499) (-1039.048) * (-1033.658) (-1047.887) (-1042.620) [-1039.532] -- 0:02:33
337000 -- [-1037.767] (-1041.934) (-1041.221) (-1045.292) * (-1040.157) [-1037.730] (-1039.902) (-1038.385) -- 0:02:35
337500 -- [-1042.682] (-1045.750) (-1039.935) (-1037.135) * (-1046.529) [-1036.163] (-1039.512) (-1045.700) -- 0:02:35
338000 -- [-1036.144] (-1039.943) (-1048.298) (-1037.429) * [-1035.601] (-1034.995) (-1040.739) (-1044.209) -- 0:02:34
338500 -- (-1043.460) [-1037.231] (-1043.357) (-1040.822) * (-1038.895) [-1037.124] (-1039.152) (-1040.034) -- 0:02:34
339000 -- (-1052.372) [-1039.878] (-1038.262) (-1041.904) * (-1041.271) (-1041.599) [-1048.206] (-1040.572) -- 0:02:34
339500 -- [-1038.396] (-1039.166) (-1037.260) (-1043.873) * (-1035.958) (-1046.037) [-1042.160] (-1038.248) -- 0:02:33
340000 -- [-1040.055] (-1038.315) (-1046.266) (-1038.767) * (-1043.226) (-1042.415) (-1038.557) [-1037.294] -- 0:02:33
Average standard deviation of split frequencies: 0.010279
340500 -- [-1044.936] (-1040.674) (-1038.762) (-1041.815) * (-1044.071) (-1041.009) [-1042.875] (-1038.971) -- 0:02:33
341000 -- (-1052.397) (-1040.348) [-1036.734] (-1036.874) * (-1043.951) [-1037.607] (-1046.883) (-1042.506) -- 0:02:32
341500 -- (-1043.187) (-1040.380) (-1040.377) [-1037.485] * (-1045.642) [-1031.558] (-1035.218) (-1045.702) -- 0:02:34
342000 -- (-1044.131) (-1040.901) [-1043.606] (-1042.016) * (-1039.027) [-1039.632] (-1036.494) (-1044.585) -- 0:02:33
342500 -- (-1044.703) [-1034.949] (-1038.995) (-1042.191) * (-1051.223) (-1040.255) [-1042.590] (-1038.201) -- 0:02:33
343000 -- (-1041.374) (-1041.595) (-1041.472) [-1038.151] * (-1043.284) (-1051.166) (-1041.866) [-1037.463] -- 0:02:33
343500 -- (-1035.424) (-1038.860) (-1044.332) [-1036.470] * (-1042.993) [-1038.824] (-1036.987) (-1039.364) -- 0:02:32
344000 -- (-1050.173) [-1040.445] (-1036.013) (-1042.661) * (-1043.040) (-1045.914) [-1042.584] (-1038.747) -- 0:02:32
344500 -- (-1044.326) (-1039.411) (-1043.214) [-1046.535] * (-1045.785) (-1041.658) [-1043.180] (-1051.452) -- 0:02:32
345000 -- (-1037.030) (-1041.069) (-1047.368) [-1038.331] * (-1045.447) (-1051.217) [-1040.134] (-1042.547) -- 0:02:31
Average standard deviation of split frequencies: 0.010316
345500 -- (-1037.266) (-1045.127) (-1049.749) [-1039.840] * (-1045.587) (-1050.359) [-1041.164] (-1037.471) -- 0:02:31
346000 -- (-1043.168) (-1043.553) [-1045.230] (-1037.392) * [-1042.872] (-1041.829) (-1042.765) (-1039.465) -- 0:02:33
346500 -- (-1034.553) (-1038.090) [-1037.502] (-1040.412) * [-1037.312] (-1040.059) (-1039.732) (-1044.596) -- 0:02:32
347000 -- [-1041.636] (-1038.141) (-1039.926) (-1044.908) * (-1042.830) [-1044.542] (-1039.027) (-1040.579) -- 0:02:32
347500 -- (-1034.238) (-1041.842) [-1039.179] (-1039.516) * (-1041.297) (-1037.933) [-1042.266] (-1048.392) -- 0:02:32
348000 -- [-1039.242] (-1050.954) (-1037.225) (-1038.359) * (-1045.018) [-1045.861] (-1041.255) (-1034.520) -- 0:02:31
348500 -- (-1042.691) [-1033.887] (-1039.030) (-1038.942) * (-1044.012) (-1040.081) (-1043.579) [-1037.770] -- 0:02:31
349000 -- (-1046.337) (-1039.582) (-1041.871) [-1035.921] * (-1052.557) [-1045.036] (-1044.935) (-1039.850) -- 0:02:31
349500 -- (-1045.179) (-1039.003) (-1034.638) [-1042.508] * (-1046.968) [-1038.824] (-1049.998) (-1042.499) -- 0:02:30
350000 -- (-1043.048) (-1035.326) (-1048.052) [-1039.346] * (-1058.875) (-1045.361) [-1043.839] (-1037.680) -- 0:02:30
Average standard deviation of split frequencies: 0.009410
350500 -- (-1040.609) (-1040.908) [-1044.726] (-1042.880) * (-1049.494) (-1044.870) [-1039.781] (-1035.662) -- 0:02:31
351000 -- (-1045.211) (-1037.892) (-1044.599) [-1036.426] * (-1049.614) (-1046.748) (-1040.879) [-1041.079] -- 0:02:31
351500 -- [-1048.294] (-1042.627) (-1045.339) (-1054.495) * (-1046.998) (-1042.684) (-1045.419) [-1046.124] -- 0:02:31
352000 -- (-1045.879) [-1041.503] (-1039.121) (-1043.179) * (-1045.043) (-1043.262) [-1040.594] (-1038.441) -- 0:02:30
352500 -- (-1034.761) [-1042.277] (-1038.827) (-1050.324) * (-1044.427) [-1043.366] (-1039.995) (-1058.038) -- 0:02:30
353000 -- (-1036.334) (-1041.254) [-1039.086] (-1037.051) * [-1039.930] (-1038.463) (-1043.375) (-1051.752) -- 0:02:30
353500 -- [-1038.057] (-1043.147) (-1043.318) (-1038.206) * (-1040.461) [-1044.937] (-1047.014) (-1042.957) -- 0:02:29
354000 -- (-1045.508) (-1045.557) [-1036.010] (-1039.179) * (-1040.811) (-1040.346) [-1035.741] (-1039.109) -- 0:02:29
354500 -- (-1044.907) [-1035.460] (-1045.363) (-1037.965) * [-1039.839] (-1041.448) (-1043.273) (-1041.588) -- 0:02:31
355000 -- (-1036.005) (-1043.816) [-1037.949] (-1041.877) * (-1039.585) [-1038.781] (-1038.684) (-1045.958) -- 0:02:30
Average standard deviation of split frequencies: 0.011728
355500 -- (-1036.405) (-1045.176) (-1037.386) [-1038.775] * (-1041.370) [-1036.524] (-1039.497) (-1046.004) -- 0:02:30
356000 -- [-1040.957] (-1039.747) (-1039.843) (-1052.658) * (-1034.497) [-1034.887] (-1044.119) (-1043.186) -- 0:02:30
356500 -- (-1038.218) [-1043.146] (-1044.910) (-1038.790) * (-1037.185) (-1042.686) [-1039.371] (-1040.885) -- 0:02:29
357000 -- (-1039.240) (-1046.491) (-1056.192) [-1033.931] * (-1039.157) [-1037.893] (-1038.645) (-1037.424) -- 0:02:29
357500 -- [-1040.245] (-1050.334) (-1049.542) (-1039.001) * (-1041.503) (-1049.186) [-1049.215] (-1040.727) -- 0:02:29
358000 -- [-1037.219] (-1042.770) (-1041.353) (-1041.951) * [-1044.193] (-1052.254) (-1039.973) (-1047.726) -- 0:02:28
358500 -- (-1043.652) [-1038.577] (-1037.869) (-1046.889) * (-1038.313) [-1039.996] (-1039.939) (-1041.425) -- 0:02:28
359000 -- (-1040.716) [-1045.537] (-1041.277) (-1045.812) * (-1049.799) (-1042.646) (-1041.079) [-1048.725] -- 0:02:29
359500 -- (-1040.786) [-1040.605] (-1042.969) (-1044.719) * (-1040.004) [-1034.320] (-1044.076) (-1044.366) -- 0:02:29
360000 -- (-1038.555) (-1037.500) (-1039.078) [-1037.184] * (-1046.333) (-1038.141) [-1041.454] (-1036.805) -- 0:02:29
Average standard deviation of split frequencies: 0.010270
360500 -- (-1039.988) (-1036.190) [-1037.218] (-1041.985) * (-1041.102) (-1041.519) (-1043.058) [-1045.053] -- 0:02:29
361000 -- (-1040.889) (-1041.142) (-1041.687) [-1042.173] * (-1040.218) (-1040.613) (-1035.906) [-1036.154] -- 0:02:28
361500 -- (-1041.306) (-1052.586) (-1038.912) [-1048.224] * (-1038.552) [-1039.126] (-1049.279) (-1045.557) -- 0:02:28
362000 -- (-1046.415) (-1046.086) [-1038.576] (-1037.271) * (-1039.292) (-1036.375) (-1042.347) [-1036.008] -- 0:02:28
362500 -- (-1043.341) (-1037.854) (-1041.213) [-1042.973] * (-1036.797) (-1033.841) (-1040.112) [-1043.191] -- 0:02:27
363000 -- (-1036.118) (-1038.755) [-1040.445] (-1046.461) * (-1042.076) (-1042.612) [-1040.363] (-1043.110) -- 0:02:27
363500 -- (-1035.762) [-1039.355] (-1043.839) (-1035.347) * (-1042.043) [-1038.619] (-1046.699) (-1042.045) -- 0:02:28
364000 -- [-1041.081] (-1038.598) (-1058.080) (-1041.399) * (-1041.207) (-1042.147) (-1046.310) [-1045.822] -- 0:02:28
364500 -- [-1037.828] (-1039.539) (-1053.690) (-1039.702) * (-1043.196) [-1035.665] (-1038.203) (-1038.753) -- 0:02:28
365000 -- [-1037.909] (-1049.929) (-1050.197) (-1037.231) * [-1043.842] (-1036.345) (-1048.966) (-1040.880) -- 0:02:27
Average standard deviation of split frequencies: 0.010304
365500 -- (-1042.237) (-1040.869) (-1039.375) [-1038.472] * [-1048.222] (-1042.674) (-1049.648) (-1050.897) -- 0:02:27
366000 -- (-1038.389) [-1038.196] (-1038.244) (-1046.533) * [-1038.818] (-1049.931) (-1038.828) (-1042.211) -- 0:02:27
366500 -- [-1036.736] (-1047.121) (-1035.118) (-1044.303) * [-1041.888] (-1037.318) (-1035.153) (-1050.670) -- 0:02:26
367000 -- (-1048.630) (-1045.332) [-1036.804] (-1039.521) * (-1039.487) (-1037.090) [-1035.243] (-1044.855) -- 0:02:26
367500 -- (-1037.478) (-1047.198) [-1037.144] (-1044.583) * (-1043.476) (-1033.419) (-1040.855) [-1035.291] -- 0:02:26
368000 -- (-1042.574) (-1040.500) [-1046.962] (-1046.137) * (-1039.261) (-1037.558) (-1048.295) [-1036.460] -- 0:02:27
368500 -- (-1039.556) [-1043.351] (-1042.691) (-1044.115) * [-1038.305] (-1044.765) (-1050.280) (-1040.830) -- 0:02:27
369000 -- (-1034.421) [-1036.950] (-1043.845) (-1040.308) * (-1041.889) [-1034.031] (-1044.246) (-1041.269) -- 0:02:27
369500 -- (-1035.319) [-1040.526] (-1039.568) (-1038.509) * (-1044.488) [-1033.195] (-1036.314) (-1038.081) -- 0:02:26
370000 -- (-1041.688) [-1044.531] (-1035.610) (-1046.134) * [-1040.794] (-1048.017) (-1039.268) (-1037.397) -- 0:02:26
Average standard deviation of split frequencies: 0.009811
370500 -- (-1042.635) (-1044.465) (-1045.126) [-1039.847] * [-1041.931] (-1039.021) (-1044.896) (-1037.601) -- 0:02:26
371000 -- (-1043.254) (-1046.167) (-1041.201) [-1037.199] * (-1038.814) (-1041.148) (-1038.675) [-1035.520] -- 0:02:25
371500 -- (-1042.986) (-1043.282) [-1037.631] (-1036.071) * (-1039.684) (-1035.852) (-1039.462) [-1041.268] -- 0:02:25
372000 -- (-1046.919) (-1038.983) [-1036.789] (-1037.722) * (-1042.615) (-1038.562) (-1045.062) [-1039.070] -- 0:02:25
372500 -- (-1041.824) (-1036.342) (-1036.382) [-1036.311] * (-1040.059) (-1038.976) (-1043.356) [-1039.086] -- 0:02:26
373000 -- [-1040.556] (-1038.606) (-1037.446) (-1037.103) * (-1046.846) (-1036.176) [-1036.567] (-1038.416) -- 0:02:26
373500 -- [-1037.979] (-1042.545) (-1042.201) (-1041.297) * (-1052.170) [-1035.593] (-1044.021) (-1036.935) -- 0:02:25
374000 -- (-1044.294) [-1039.788] (-1041.441) (-1035.771) * (-1045.434) [-1038.294] (-1040.155) (-1052.756) -- 0:02:25
374500 -- [-1035.429] (-1044.125) (-1048.282) (-1039.769) * (-1042.313) [-1039.357] (-1036.768) (-1037.873) -- 0:02:25
375000 -- [-1035.795] (-1038.679) (-1042.417) (-1036.135) * (-1044.799) (-1039.947) (-1043.823) [-1046.134] -- 0:02:25
Average standard deviation of split frequencies: 0.009672
375500 -- (-1037.328) (-1040.342) [-1043.257] (-1045.628) * (-1048.680) (-1041.138) (-1045.286) [-1041.946] -- 0:02:24
376000 -- (-1041.210) (-1042.616) [-1041.442] (-1036.894) * [-1041.107] (-1047.529) (-1040.666) (-1036.924) -- 0:02:24
376500 -- (-1044.284) [-1039.944] (-1040.773) (-1040.225) * (-1037.773) [-1039.700] (-1041.777) (-1041.654) -- 0:02:24
377000 -- [-1038.577] (-1052.933) (-1042.080) (-1037.534) * [-1033.618] (-1037.548) (-1048.602) (-1038.000) -- 0:02:25
377500 -- [-1044.334] (-1043.962) (-1044.962) (-1039.497) * (-1035.472) (-1034.578) (-1047.858) [-1036.436] -- 0:02:25
378000 -- (-1046.339) [-1035.344] (-1038.580) (-1042.206) * (-1039.760) (-1049.136) (-1044.992) [-1035.862] -- 0:02:24
378500 -- [-1037.599] (-1034.892) (-1045.179) (-1042.514) * [-1039.380] (-1044.272) (-1034.969) (-1036.034) -- 0:02:24
379000 -- (-1039.350) [-1039.215] (-1040.836) (-1047.043) * (-1031.067) (-1040.806) [-1041.181] (-1043.691) -- 0:02:24
379500 -- (-1039.252) (-1041.989) [-1035.521] (-1047.195) * (-1038.098) (-1037.478) (-1039.741) [-1040.897] -- 0:02:23
380000 -- (-1041.443) (-1042.102) [-1043.298] (-1044.283) * [-1038.958] (-1039.847) (-1037.192) (-1046.302) -- 0:02:23
Average standard deviation of split frequencies: 0.009553
380500 -- (-1037.474) (-1046.779) (-1042.712) [-1037.122] * (-1041.938) (-1039.765) [-1035.496] (-1040.083) -- 0:02:23
381000 -- [-1036.866] (-1040.762) (-1041.102) (-1042.492) * (-1037.871) (-1040.509) (-1041.933) [-1046.736] -- 0:02:24
381500 -- (-1041.062) (-1040.786) [-1039.430] (-1053.058) * [-1036.687] (-1041.493) (-1041.769) (-1043.553) -- 0:02:24
382000 -- [-1038.625] (-1035.081) (-1046.137) (-1048.046) * (-1042.772) [-1046.356] (-1037.785) (-1041.913) -- 0:02:23
382500 -- (-1037.513) [-1043.294] (-1042.781) (-1042.073) * [-1042.383] (-1041.053) (-1040.587) (-1038.669) -- 0:02:23
383000 -- (-1046.109) (-1041.679) [-1038.635] (-1043.722) * (-1048.082) [-1041.204] (-1040.894) (-1035.859) -- 0:02:23
383500 -- (-1039.463) (-1044.373) [-1055.558] (-1040.482) * [-1042.828] (-1041.981) (-1041.176) (-1047.395) -- 0:02:23
384000 -- (-1044.262) [-1038.774] (-1041.670) (-1039.946) * [-1039.183] (-1037.328) (-1037.131) (-1049.745) -- 0:02:22
384500 -- (-1038.278) (-1045.355) (-1043.698) [-1036.080] * (-1036.586) (-1037.482) [-1036.055] (-1044.428) -- 0:02:22
385000 -- (-1039.401) (-1041.344) [-1041.029] (-1036.537) * (-1052.875) (-1039.733) (-1041.066) [-1035.697] -- 0:02:22
Average standard deviation of split frequencies: 0.009247
385500 -- (-1039.427) (-1046.690) (-1047.130) [-1038.098] * (-1040.778) [-1038.746] (-1039.212) (-1044.429) -- 0:02:23
386000 -- (-1040.355) (-1039.765) (-1053.687) [-1037.165] * (-1056.874) (-1040.611) (-1042.621) [-1036.241] -- 0:02:23
386500 -- (-1040.880) (-1037.480) (-1043.626) [-1044.597] * (-1036.599) (-1041.533) (-1037.075) [-1040.684] -- 0:02:22
387000 -- (-1046.939) (-1037.942) (-1041.699) [-1039.241] * (-1037.842) [-1032.179] (-1043.053) (-1039.529) -- 0:02:22
387500 -- (-1049.918) (-1038.339) (-1045.026) [-1047.044] * (-1050.591) (-1040.715) [-1037.770] (-1040.296) -- 0:02:22
388000 -- (-1046.183) (-1036.591) (-1041.962) [-1038.178] * (-1038.777) (-1040.482) [-1040.027] (-1041.082) -- 0:02:21
388500 -- (-1055.851) (-1043.557) (-1046.355) [-1036.641] * [-1034.877] (-1039.717) (-1052.450) (-1046.531) -- 0:02:21
389000 -- [-1045.593] (-1044.874) (-1046.982) (-1041.723) * (-1048.327) (-1039.197) (-1040.980) [-1036.430] -- 0:02:21
389500 -- (-1037.844) (-1048.652) [-1040.900] (-1043.329) * (-1036.607) [-1043.606] (-1043.734) (-1033.417) -- 0:02:21
390000 -- (-1043.495) (-1039.317) [-1041.461] (-1036.401) * (-1042.664) (-1037.623) [-1039.703] (-1040.488) -- 0:02:22
Average standard deviation of split frequencies: 0.009309
390500 -- (-1038.531) [-1043.557] (-1040.868) (-1047.652) * (-1044.395) (-1044.722) [-1042.531] (-1046.217) -- 0:02:22
391000 -- (-1036.207) [-1037.806] (-1049.219) (-1049.935) * (-1041.836) [-1037.937] (-1038.410) (-1045.718) -- 0:02:21
391500 -- (-1035.874) (-1043.664) [-1042.331] (-1047.194) * (-1039.181) (-1041.802) (-1039.653) [-1036.798] -- 0:02:21
392000 -- (-1035.002) (-1042.005) (-1042.146) [-1042.249] * [-1042.360] (-1038.754) (-1037.874) (-1038.353) -- 0:02:21
392500 -- (-1047.571) [-1038.256] (-1044.648) (-1040.695) * (-1039.199) (-1040.429) [-1043.402] (-1048.146) -- 0:02:20
393000 -- (-1043.541) (-1036.433) [-1042.165] (-1043.536) * (-1039.663) (-1040.634) (-1041.554) [-1041.081] -- 0:02:20
393500 -- (-1040.279) [-1040.360] (-1038.269) (-1044.616) * (-1039.304) (-1037.300) (-1041.013) [-1047.935] -- 0:02:20
394000 -- (-1042.729) (-1037.844) (-1044.520) [-1035.778] * (-1038.555) (-1040.085) [-1039.720] (-1048.149) -- 0:02:19
394500 -- (-1043.891) (-1037.450) (-1046.725) [-1036.012] * [-1038.247] (-1044.656) (-1045.610) (-1049.917) -- 0:02:21
395000 -- (-1054.487) [-1037.827] (-1043.978) (-1041.070) * [-1042.458] (-1048.855) (-1042.427) (-1043.746) -- 0:02:20
Average standard deviation of split frequencies: 0.010912
395500 -- (-1044.883) (-1044.462) [-1033.587] (-1033.690) * (-1042.908) (-1051.907) (-1039.398) [-1043.430] -- 0:02:20
396000 -- (-1048.926) (-1040.429) (-1037.921) [-1045.230] * (-1040.480) (-1040.702) [-1041.627] (-1051.832) -- 0:02:20
396500 -- (-1041.667) (-1045.432) (-1045.489) [-1034.929] * (-1042.436) (-1031.596) (-1043.804) [-1039.667] -- 0:02:20
397000 -- [-1039.685] (-1053.633) (-1046.188) (-1039.151) * (-1043.133) [-1037.587] (-1046.597) (-1039.249) -- 0:02:19
397500 -- [-1044.230] (-1042.857) (-1049.641) (-1046.069) * (-1043.540) [-1035.860] (-1037.374) (-1034.957) -- 0:02:19
398000 -- (-1046.032) (-1042.149) (-1039.842) [-1040.842] * (-1042.179) (-1042.169) [-1039.497] (-1036.309) -- 0:02:19
398500 -- (-1037.231) [-1035.447] (-1044.416) (-1045.538) * [-1036.350] (-1044.387) (-1048.744) (-1055.144) -- 0:02:18
399000 -- (-1038.038) (-1038.929) (-1043.427) [-1043.895] * [-1039.896] (-1039.909) (-1037.029) (-1051.129) -- 0:02:20
399500 -- (-1035.669) (-1041.034) [-1038.263] (-1036.111) * [-1037.851] (-1037.651) (-1048.131) (-1048.729) -- 0:02:19
400000 -- (-1043.377) [-1041.241] (-1042.057) (-1040.012) * (-1039.523) (-1039.968) [-1036.963] (-1050.538) -- 0:02:19
Average standard deviation of split frequencies: 0.009244
400500 -- (-1039.898) (-1043.394) [-1036.046] (-1045.465) * [-1039.696] (-1038.599) (-1045.533) (-1045.044) -- 0:02:19
401000 -- (-1043.921) (-1045.752) [-1036.218] (-1040.699) * [-1038.512] (-1040.511) (-1037.996) (-1037.625) -- 0:02:18
401500 -- [-1038.192] (-1034.331) (-1037.812) (-1037.835) * (-1037.638) (-1041.276) [-1037.457] (-1053.231) -- 0:02:18
402000 -- (-1043.081) (-1042.932) (-1046.805) [-1036.583] * (-1038.204) [-1040.907] (-1040.462) (-1045.371) -- 0:02:18
402500 -- (-1039.690) (-1039.501) [-1038.210] (-1051.266) * (-1046.295) (-1041.919) [-1038.362] (-1039.583) -- 0:02:18
403000 -- (-1036.943) [-1041.549] (-1040.743) (-1049.794) * (-1042.201) [-1035.890] (-1041.965) (-1038.777) -- 0:02:17
403500 -- [-1040.980] (-1039.690) (-1036.843) (-1040.810) * (-1048.071) [-1044.394] (-1037.487) (-1039.554) -- 0:02:18
404000 -- (-1048.932) [-1043.895] (-1040.516) (-1042.590) * [-1038.901] (-1038.796) (-1044.758) (-1042.639) -- 0:02:18
404500 -- (-1038.080) [-1041.547] (-1040.615) (-1048.682) * (-1039.357) (-1039.922) (-1042.016) [-1049.132] -- 0:02:18
405000 -- (-1041.109) (-1037.539) (-1053.669) [-1037.023] * (-1049.618) [-1044.505] (-1035.593) (-1038.443) -- 0:02:18
Average standard deviation of split frequencies: 0.008791
405500 -- (-1046.864) (-1044.974) (-1040.066) [-1035.314] * (-1044.282) [-1041.165] (-1037.810) (-1040.220) -- 0:02:17
406000 -- [-1042.725] (-1044.526) (-1043.027) (-1045.317) * (-1044.053) (-1040.312) (-1044.269) [-1046.047] -- 0:02:17
406500 -- (-1040.902) [-1038.048] (-1040.537) (-1041.780) * (-1036.697) (-1045.160) (-1050.104) [-1039.564] -- 0:02:17
407000 -- (-1038.696) (-1041.943) [-1044.498] (-1041.078) * [-1038.881] (-1044.328) (-1043.064) (-1035.073) -- 0:02:16
407500 -- (-1040.791) (-1050.146) (-1042.437) [-1041.769] * (-1043.568) [-1044.944] (-1034.717) (-1037.962) -- 0:02:16
408000 -- [-1041.742] (-1040.985) (-1038.025) (-1049.347) * (-1038.495) (-1043.208) [-1037.107] (-1038.301) -- 0:02:17
408500 -- [-1042.953] (-1050.722) (-1048.263) (-1043.196) * (-1043.982) (-1050.167) (-1034.695) [-1040.244] -- 0:02:17
409000 -- [-1037.116] (-1035.928) (-1041.785) (-1042.584) * (-1035.625) (-1053.425) (-1041.620) [-1042.940] -- 0:02:17
409500 -- (-1049.495) (-1037.325) (-1043.273) [-1035.499] * [-1043.054] (-1046.076) (-1040.547) (-1043.469) -- 0:02:16
410000 -- (-1042.629) [-1037.646] (-1046.925) (-1041.916) * (-1040.271) (-1049.947) (-1037.403) [-1043.374] -- 0:02:16
Average standard deviation of split frequencies: 0.009675
410500 -- (-1044.991) (-1041.759) (-1042.102) [-1036.548] * (-1043.824) (-1039.286) [-1038.556] (-1046.258) -- 0:02:16
411000 -- (-1041.293) [-1042.602] (-1043.260) (-1043.444) * (-1040.041) [-1044.295] (-1037.852) (-1042.633) -- 0:02:16
411500 -- (-1047.446) (-1040.627) (-1044.188) [-1039.358] * (-1043.554) (-1038.064) (-1037.901) [-1049.737] -- 0:02:15
412000 -- (-1054.789) (-1044.750) (-1038.241) [-1040.931] * [-1043.621] (-1038.154) (-1049.148) (-1044.769) -- 0:02:17
412500 -- (-1035.742) [-1041.606] (-1044.225) (-1037.422) * (-1037.616) (-1038.540) [-1038.707] (-1041.073) -- 0:02:16
413000 -- (-1042.209) (-1043.407) (-1042.428) [-1042.764] * (-1048.241) [-1038.356] (-1045.021) (-1038.514) -- 0:02:16
413500 -- (-1038.309) (-1041.427) (-1037.548) [-1035.963] * (-1042.143) (-1037.468) [-1042.840] (-1038.918) -- 0:02:16
414000 -- (-1034.243) [-1038.054] (-1044.290) (-1039.907) * (-1036.752) (-1040.893) [-1036.197] (-1038.662) -- 0:02:15
414500 -- (-1039.572) (-1037.181) (-1048.773) [-1037.369] * (-1042.578) (-1042.555) [-1040.597] (-1039.334) -- 0:02:15
415000 -- (-1040.375) (-1042.711) [-1041.137] (-1038.083) * (-1046.026) (-1048.484) [-1040.502] (-1045.993) -- 0:02:15
Average standard deviation of split frequencies: 0.009713
415500 -- (-1044.790) [-1041.457] (-1035.060) (-1049.965) * (-1038.990) [-1041.738] (-1037.350) (-1041.183) -- 0:02:15
416000 -- [-1039.928] (-1039.210) (-1038.882) (-1034.968) * (-1044.311) (-1041.000) [-1039.247] (-1035.101) -- 0:02:14
416500 -- (-1047.037) (-1037.006) (-1045.013) [-1042.447] * [-1037.865] (-1040.840) (-1040.184) (-1047.661) -- 0:02:15
417000 -- [-1037.915] (-1039.806) (-1036.756) (-1040.141) * (-1046.627) (-1041.237) [-1040.775] (-1043.200) -- 0:02:15
417500 -- [-1044.066] (-1037.529) (-1041.277) (-1042.914) * (-1048.518) (-1052.363) (-1040.470) [-1040.007] -- 0:02:15
418000 -- (-1044.425) (-1037.065) [-1042.182] (-1036.940) * (-1037.944) (-1040.298) (-1039.726) [-1041.681] -- 0:02:15
418500 -- (-1043.221) [-1037.422] (-1036.603) (-1043.612) * (-1042.646) [-1037.187] (-1037.429) (-1039.546) -- 0:02:14
419000 -- [-1041.295] (-1047.380) (-1042.998) (-1044.907) * (-1043.867) [-1037.710] (-1039.147) (-1041.513) -- 0:02:14
419500 -- (-1038.674) [-1036.591] (-1040.430) (-1044.241) * (-1054.850) [-1038.688] (-1035.482) (-1040.970) -- 0:02:14
420000 -- (-1041.470) (-1043.965) [-1040.655] (-1041.550) * (-1048.430) (-1038.574) [-1040.583] (-1043.022) -- 0:02:13
Average standard deviation of split frequencies: 0.009125
420500 -- [-1041.154] (-1044.393) (-1039.087) (-1039.189) * (-1045.835) [-1032.495] (-1042.595) (-1040.081) -- 0:02:13
421000 -- (-1048.642) (-1039.175) [-1042.537] (-1042.503) * [-1040.260] (-1037.560) (-1054.548) (-1038.668) -- 0:02:14
421500 -- (-1048.878) (-1042.992) [-1040.262] (-1041.021) * (-1037.556) [-1035.044] (-1035.768) (-1040.401) -- 0:02:14
422000 -- (-1047.757) [-1038.246] (-1036.154) (-1040.873) * (-1038.534) (-1041.328) (-1034.525) [-1040.891] -- 0:02:14
422500 -- [-1045.964] (-1048.836) (-1039.122) (-1040.678) * (-1048.988) [-1037.633] (-1038.341) (-1047.380) -- 0:02:13
423000 -- (-1040.449) (-1036.909) [-1041.656] (-1040.423) * (-1036.825) (-1040.331) (-1038.208) [-1041.133] -- 0:02:13
423500 -- (-1042.092) (-1046.870) (-1042.505) [-1034.758] * (-1038.860) (-1039.771) (-1040.903) [-1040.968] -- 0:02:13
424000 -- (-1040.504) (-1037.319) [-1037.081] (-1038.120) * (-1039.811) (-1047.440) (-1032.654) [-1038.335] -- 0:02:13
424500 -- [-1036.356] (-1043.835) (-1044.042) (-1041.544) * [-1040.398] (-1041.910) (-1034.117) (-1038.782) -- 0:02:12
425000 -- (-1043.667) (-1041.212) [-1040.252] (-1042.159) * [-1036.236] (-1050.639) (-1038.597) (-1039.211) -- 0:02:12
Average standard deviation of split frequencies: 0.009643
425500 -- (-1049.647) (-1039.925) (-1039.943) [-1044.958] * (-1044.037) [-1040.783] (-1042.113) (-1037.398) -- 0:02:13
426000 -- (-1038.413) [-1043.722] (-1042.438) (-1044.962) * (-1035.480) (-1043.910) [-1044.136] (-1040.887) -- 0:02:13
426500 -- (-1044.944) [-1041.568] (-1041.090) (-1037.915) * (-1037.963) (-1038.834) [-1044.750] (-1038.351) -- 0:02:13
427000 -- (-1061.062) [-1038.921] (-1041.995) (-1038.390) * (-1041.543) [-1038.409] (-1044.071) (-1035.798) -- 0:02:12
427500 -- [-1043.635] (-1040.771) (-1047.048) (-1037.400) * (-1043.345) (-1046.771) (-1045.364) [-1038.653] -- 0:02:12
428000 -- (-1037.082) (-1043.792) [-1039.488] (-1038.459) * (-1034.662) (-1046.060) (-1041.247) [-1035.667] -- 0:02:12
428500 -- (-1048.799) (-1041.549) (-1044.263) [-1036.157] * (-1046.080) (-1042.219) [-1041.382] (-1041.579) -- 0:02:12
429000 -- (-1042.025) (-1038.492) (-1051.440) [-1036.312] * [-1048.902] (-1035.789) (-1041.392) (-1044.131) -- 0:02:11
429500 -- (-1046.237) [-1040.383] (-1052.012) (-1047.405) * (-1049.724) (-1036.111) [-1041.967] (-1041.138) -- 0:02:12
430000 -- (-1042.764) (-1037.116) [-1044.551] (-1039.566) * (-1042.575) (-1044.934) (-1042.121) [-1043.130] -- 0:02:12
Average standard deviation of split frequencies: 0.009539
430500 -- (-1044.043) (-1043.180) (-1042.202) [-1032.690] * (-1045.846) (-1043.422) (-1042.857) [-1036.950] -- 0:02:12
431000 -- (-1037.944) (-1041.891) [-1033.295] (-1042.808) * (-1050.969) (-1034.833) (-1037.164) [-1041.353] -- 0:02:12
431500 -- (-1046.525) [-1035.197] (-1041.906) (-1040.084) * (-1051.418) (-1035.744) [-1040.635] (-1042.856) -- 0:02:11
432000 -- (-1044.435) (-1042.112) (-1044.514) [-1039.086] * (-1049.383) (-1036.059) [-1033.814] (-1042.399) -- 0:02:11
432500 -- (-1042.538) (-1042.876) (-1040.678) [-1038.702] * (-1051.586) [-1042.793] (-1041.635) (-1037.857) -- 0:02:11
433000 -- (-1041.652) (-1037.002) (-1036.156) [-1043.879] * (-1043.269) [-1039.309] (-1038.623) (-1042.840) -- 0:02:10
433500 -- [-1040.831] (-1038.625) (-1037.814) (-1040.251) * [-1038.884] (-1041.161) (-1045.333) (-1038.943) -- 0:02:10
434000 -- [-1041.365] (-1039.129) (-1034.620) (-1036.960) * (-1042.979) [-1040.041] (-1040.490) (-1040.779) -- 0:02:11
434500 -- (-1038.991) (-1040.023) (-1036.657) [-1040.297] * (-1041.329) (-1043.902) [-1037.854] (-1041.032) -- 0:02:11
435000 -- (-1040.657) (-1037.048) (-1041.021) [-1044.644] * (-1043.476) (-1038.874) [-1041.351] (-1048.556) -- 0:02:11
Average standard deviation of split frequencies: 0.010349
435500 -- (-1047.902) (-1042.841) [-1041.105] (-1041.275) * (-1040.202) [-1033.095] (-1038.845) (-1038.091) -- 0:02:10
436000 -- (-1042.308) (-1035.880) [-1041.425] (-1042.876) * (-1045.952) (-1036.369) [-1040.722] (-1038.631) -- 0:02:10
436500 -- (-1046.058) (-1047.318) [-1038.936] (-1042.538) * (-1039.710) [-1039.846] (-1037.431) (-1035.623) -- 0:02:10
437000 -- (-1046.637) (-1036.338) [-1043.824] (-1040.562) * (-1046.093) (-1038.038) [-1042.076] (-1045.238) -- 0:02:10
437500 -- (-1048.602) (-1041.274) (-1043.237) [-1041.997] * (-1043.449) [-1037.730] (-1040.333) (-1047.272) -- 0:02:09
438000 -- (-1041.893) [-1037.855] (-1040.064) (-1040.805) * (-1038.017) (-1043.537) [-1046.452] (-1040.312) -- 0:02:09
438500 -- [-1043.673] (-1046.488) (-1037.818) (-1040.514) * (-1042.316) (-1035.157) [-1037.728] (-1041.697) -- 0:02:10
439000 -- [-1036.469] (-1042.140) (-1040.652) (-1041.195) * (-1043.411) [-1040.064] (-1044.548) (-1040.814) -- 0:02:10
439500 -- (-1042.865) (-1038.794) [-1037.974] (-1037.115) * (-1045.143) (-1039.570) (-1045.629) [-1037.168] -- 0:02:10
440000 -- (-1045.932) [-1034.744] (-1034.932) (-1038.927) * (-1039.435) (-1042.835) (-1040.514) [-1043.705] -- 0:02:09
Average standard deviation of split frequencies: 0.010545
440500 -- (-1036.040) (-1038.610) (-1040.371) [-1037.175] * [-1037.007] (-1041.374) (-1038.044) (-1035.443) -- 0:02:09
441000 -- (-1037.956) (-1051.540) (-1038.784) [-1034.628] * (-1044.707) [-1035.074] (-1038.615) (-1040.188) -- 0:02:09
441500 -- [-1038.583] (-1044.379) (-1039.486) (-1038.933) * (-1042.385) (-1046.999) (-1047.009) [-1046.064] -- 0:02:09
442000 -- (-1038.426) [-1040.048] (-1037.408) (-1037.839) * (-1037.412) (-1038.941) (-1044.261) [-1046.093] -- 0:02:08
442500 -- (-1037.222) [-1045.681] (-1034.786) (-1044.742) * [-1036.073] (-1038.336) (-1039.323) (-1050.290) -- 0:02:08
443000 -- (-1039.765) (-1038.089) [-1044.698] (-1038.055) * (-1040.207) [-1041.761] (-1041.159) (-1042.340) -- 0:02:09
443500 -- [-1036.932] (-1038.904) (-1043.896) (-1040.187) * [-1039.404] (-1038.776) (-1035.611) (-1042.382) -- 0:02:09
444000 -- [-1043.958] (-1044.983) (-1042.895) (-1035.445) * [-1038.603] (-1035.779) (-1037.228) (-1039.328) -- 0:02:08
444500 -- [-1038.134] (-1040.991) (-1043.955) (-1039.321) * (-1040.346) (-1045.607) (-1039.056) [-1039.149] -- 0:02:08
445000 -- (-1039.543) [-1036.702] (-1035.347) (-1040.291) * [-1043.582] (-1040.537) (-1043.315) (-1042.222) -- 0:02:08
Average standard deviation of split frequencies: 0.009664
445500 -- (-1046.721) (-1044.952) (-1041.581) [-1037.916] * (-1035.848) [-1042.697] (-1046.015) (-1043.125) -- 0:02:08
446000 -- (-1036.218) [-1039.806] (-1043.188) (-1043.502) * (-1037.940) (-1045.966) (-1041.146) [-1038.813] -- 0:02:07
446500 -- (-1040.367) (-1041.045) (-1038.310) [-1042.032] * (-1038.873) (-1044.704) (-1035.556) [-1042.624] -- 0:02:07
447000 -- (-1037.260) (-1038.415) (-1040.846) [-1038.876] * [-1039.740] (-1033.622) (-1041.972) (-1049.051) -- 0:02:07
447500 -- [-1040.668] (-1040.024) (-1036.078) (-1044.919) * (-1040.772) (-1033.106) (-1040.376) [-1037.089] -- 0:02:08
448000 -- (-1037.798) (-1043.787) (-1038.398) [-1042.605] * (-1041.159) (-1043.522) [-1033.996] (-1042.571) -- 0:02:08
448500 -- (-1041.910) (-1048.294) [-1040.107] (-1045.254) * (-1046.364) (-1039.823) (-1038.213) [-1037.414] -- 0:02:07
449000 -- (-1040.507) (-1052.785) [-1048.693] (-1036.411) * (-1037.619) (-1044.537) (-1036.236) [-1041.195] -- 0:02:07
449500 -- (-1036.875) (-1044.770) (-1039.414) [-1035.580] * (-1040.219) (-1039.277) [-1038.566] (-1044.606) -- 0:02:07
450000 -- (-1038.591) (-1043.280) [-1042.952] (-1046.409) * (-1039.761) (-1050.067) (-1040.201) [-1035.939] -- 0:02:07
Average standard deviation of split frequencies: 0.010012
450500 -- (-1045.063) [-1040.914] (-1037.186) (-1041.893) * (-1043.268) (-1044.163) (-1044.655) [-1040.422] -- 0:02:06
451000 -- (-1039.624) (-1039.230) [-1039.730] (-1036.718) * [-1038.839] (-1056.532) (-1041.239) (-1046.931) -- 0:02:06
451500 -- [-1037.299] (-1045.475) (-1042.097) (-1038.642) * [-1040.295] (-1041.770) (-1035.652) (-1047.848) -- 0:02:07
452000 -- [-1041.043] (-1046.146) (-1039.293) (-1047.241) * (-1041.451) (-1037.655) (-1038.949) [-1037.583] -- 0:02:07
452500 -- (-1039.248) [-1039.860] (-1039.308) (-1037.872) * (-1044.031) (-1039.878) (-1048.149) [-1037.108] -- 0:02:07
453000 -- (-1035.980) (-1043.846) [-1035.784] (-1039.759) * (-1042.679) (-1042.606) (-1044.306) [-1036.565] -- 0:02:06
453500 -- [-1034.346] (-1035.808) (-1040.212) (-1044.212) * (-1041.508) (-1040.320) (-1044.834) [-1038.687] -- 0:02:06
454000 -- (-1040.218) (-1040.384) (-1044.222) [-1045.315] * (-1042.236) (-1040.639) [-1036.934] (-1042.629) -- 0:02:06
454500 -- (-1044.290) (-1042.939) [-1036.404] (-1042.708) * (-1043.752) (-1039.495) (-1045.299) [-1041.253] -- 0:02:06
455000 -- (-1042.312) [-1043.261] (-1045.672) (-1040.196) * (-1037.512) [-1036.853] (-1034.504) (-1038.366) -- 0:02:05
Average standard deviation of split frequencies: 0.010042
455500 -- [-1039.171] (-1058.208) (-1040.773) (-1039.431) * (-1044.553) [-1035.506] (-1039.794) (-1042.798) -- 0:02:05
456000 -- (-1052.287) (-1044.937) [-1039.642] (-1044.985) * (-1050.663) (-1036.382) (-1039.481) [-1034.301] -- 0:02:06
456500 -- (-1040.928) (-1042.081) [-1041.930] (-1039.104) * [-1041.689] (-1046.335) (-1040.925) (-1041.274) -- 0:02:06
457000 -- [-1037.443] (-1045.932) (-1043.835) (-1037.553) * (-1043.473) (-1043.406) (-1034.491) [-1032.805] -- 0:02:05
457500 -- (-1041.833) (-1043.408) [-1040.559] (-1046.103) * (-1043.796) (-1041.465) (-1041.214) [-1041.784] -- 0:02:05
458000 -- (-1043.905) (-1048.272) (-1045.207) [-1047.749] * (-1037.666) (-1043.388) (-1034.870) [-1040.492] -- 0:02:05
458500 -- (-1036.725) (-1041.198) [-1036.989] (-1042.038) * (-1037.165) (-1039.093) [-1038.442] (-1044.884) -- 0:02:05
459000 -- (-1042.676) [-1035.132] (-1040.745) (-1039.944) * [-1039.375] (-1042.416) (-1041.117) (-1039.426) -- 0:02:04
459500 -- (-1049.108) [-1045.528] (-1047.187) (-1043.653) * (-1037.586) (-1038.330) [-1041.831] (-1040.162) -- 0:02:04
460000 -- (-1040.893) (-1040.768) [-1039.255] (-1036.576) * (-1035.464) [-1042.416] (-1045.536) (-1041.727) -- 0:02:04
Average standard deviation of split frequencies: 0.009941
460500 -- [-1036.683] (-1044.434) (-1050.191) (-1040.896) * (-1046.487) (-1041.789) [-1041.596] (-1044.784) -- 0:02:05
461000 -- [-1039.779] (-1043.000) (-1044.522) (-1040.167) * (-1039.541) (-1039.130) (-1042.733) [-1039.759] -- 0:02:05
461500 -- (-1037.755) (-1038.825) (-1042.381) [-1043.633] * [-1037.586] (-1044.316) (-1044.343) (-1043.722) -- 0:02:04
462000 -- (-1040.885) (-1043.611) (-1042.852) [-1043.377] * [-1040.748] (-1041.944) (-1046.385) (-1050.237) -- 0:02:04
462500 -- (-1043.030) (-1052.838) (-1048.137) [-1036.183] * (-1037.357) (-1035.716) (-1045.483) [-1041.064] -- 0:02:04
463000 -- (-1043.592) (-1046.615) [-1040.528] (-1043.016) * (-1037.674) (-1045.299) [-1038.909] (-1038.409) -- 0:02:04
463500 -- (-1046.837) (-1046.647) (-1040.585) [-1038.883] * (-1036.522) (-1038.873) (-1050.800) [-1037.547] -- 0:02:03
464000 -- [-1048.403] (-1055.421) (-1037.337) (-1039.905) * (-1049.440) [-1043.557] (-1038.517) (-1040.301) -- 0:02:03
464500 -- (-1037.424) [-1043.961] (-1042.784) (-1037.408) * (-1041.515) (-1037.256) (-1041.489) [-1039.715] -- 0:02:03
465000 -- (-1039.800) (-1039.024) (-1039.379) [-1036.956] * (-1046.184) (-1039.319) [-1042.194] (-1040.607) -- 0:02:04
Average standard deviation of split frequencies: 0.009104
465500 -- (-1039.654) (-1042.402) (-1039.841) [-1038.202] * (-1038.496) (-1036.545) (-1037.219) [-1035.409] -- 0:02:04
466000 -- (-1040.359) (-1038.963) (-1039.722) [-1039.916] * (-1054.772) (-1038.490) [-1045.107] (-1043.442) -- 0:02:03
466500 -- (-1049.024) (-1038.446) [-1040.336] (-1042.214) * [-1035.577] (-1048.343) (-1041.293) (-1045.973) -- 0:02:03
467000 -- (-1037.687) (-1036.465) (-1036.066) [-1035.545] * (-1036.158) (-1039.109) [-1038.221] (-1039.545) -- 0:02:03
467500 -- [-1039.443] (-1038.738) (-1047.487) (-1037.420) * (-1036.706) [-1034.859] (-1046.529) (-1049.738) -- 0:02:03
468000 -- (-1033.392) [-1039.755] (-1039.169) (-1046.266) * (-1040.791) (-1035.559) [-1036.437] (-1041.989) -- 0:02:02
468500 -- (-1042.301) (-1046.317) [-1036.294] (-1037.161) * (-1050.661) [-1045.680] (-1040.130) (-1038.025) -- 0:02:02
469000 -- (-1035.074) [-1035.177] (-1039.845) (-1045.984) * (-1041.021) (-1045.955) [-1042.433] (-1041.732) -- 0:02:02
469500 -- (-1042.030) (-1036.169) (-1042.606) [-1041.782] * [-1035.388] (-1048.147) (-1041.992) (-1043.271) -- 0:02:03
470000 -- (-1036.553) (-1040.787) [-1041.681] (-1043.196) * [-1039.669] (-1042.781) (-1044.184) (-1040.406) -- 0:02:02
Average standard deviation of split frequencies: 0.009586
470500 -- (-1040.480) (-1044.735) (-1041.680) [-1047.885] * (-1043.849) (-1037.685) (-1050.621) [-1037.545] -- 0:02:02
471000 -- [-1036.149] (-1041.005) (-1036.542) (-1042.376) * (-1049.204) [-1045.146] (-1046.659) (-1037.072) -- 0:02:02
471500 -- (-1037.756) (-1040.777) (-1041.266) [-1036.661] * (-1050.124) (-1036.299) [-1039.939] (-1039.365) -- 0:02:02
472000 -- (-1036.883) [-1039.387] (-1044.499) (-1048.431) * (-1054.185) [-1035.453] (-1048.024) (-1043.047) -- 0:02:01
472500 -- (-1041.281) [-1037.731] (-1042.194) (-1042.044) * (-1052.161) [-1040.302] (-1035.126) (-1039.461) -- 0:02:01
473000 -- [-1041.503] (-1039.328) (-1037.766) (-1043.658) * (-1041.138) (-1046.127) [-1037.856] (-1040.722) -- 0:02:01
473500 -- (-1044.811) (-1035.784) (-1040.422) [-1037.656] * [-1040.739] (-1042.346) (-1039.781) (-1046.490) -- 0:02:02
474000 -- [-1035.854] (-1037.241) (-1047.921) (-1041.216) * [-1040.694] (-1039.425) (-1037.662) (-1037.062) -- 0:02:02
474500 -- (-1039.442) [-1043.070] (-1044.559) (-1039.060) * (-1037.985) (-1040.101) [-1035.219] (-1039.031) -- 0:02:01
475000 -- (-1040.255) (-1049.325) [-1050.463] (-1042.009) * (-1041.679) (-1043.006) [-1042.759] (-1042.541) -- 0:02:01
Average standard deviation of split frequencies: 0.009762
475500 -- (-1043.389) (-1039.071) (-1049.092) [-1045.430] * (-1043.515) (-1042.814) [-1040.757] (-1046.291) -- 0:02:01
476000 -- (-1035.664) (-1039.831) [-1046.173] (-1046.182) * (-1043.936) (-1044.674) [-1041.849] (-1046.414) -- 0:02:01
476500 -- (-1035.857) (-1036.857) (-1047.762) [-1045.826] * (-1043.090) (-1043.425) [-1038.498] (-1041.407) -- 0:02:00
477000 -- (-1045.881) [-1039.654] (-1039.458) (-1038.708) * (-1042.195) [-1042.000] (-1040.829) (-1049.263) -- 0:02:00
477500 -- (-1037.383) [-1038.119] (-1039.233) (-1045.029) * (-1041.969) (-1041.034) [-1034.509] (-1043.701) -- 0:02:00
478000 -- (-1045.304) [-1038.986] (-1050.751) (-1041.052) * (-1038.293) (-1045.621) [-1037.061] (-1045.452) -- 0:02:01
478500 -- (-1044.548) (-1040.581) (-1051.567) [-1040.936] * (-1036.855) (-1041.540) (-1039.572) [-1038.575] -- 0:02:00
479000 -- (-1041.083) (-1037.052) (-1043.866) [-1041.219] * (-1039.619) [-1043.750] (-1039.643) (-1037.363) -- 0:02:00
479500 -- [-1037.783] (-1041.201) (-1050.903) (-1041.103) * (-1039.402) [-1038.275] (-1047.502) (-1040.338) -- 0:02:00
480000 -- [-1037.623] (-1040.210) (-1037.849) (-1037.625) * (-1045.464) (-1042.608) (-1040.336) [-1045.413] -- 0:02:00
Average standard deviation of split frequencies: 0.009387
480500 -- (-1039.604) [-1039.502] (-1041.298) (-1047.183) * (-1040.605) (-1041.319) (-1041.338) [-1035.708] -- 0:02:00
481000 -- (-1041.125) (-1037.565) [-1037.225] (-1040.757) * (-1044.971) (-1038.357) (-1041.983) [-1044.456] -- 0:01:59
481500 -- [-1034.513] (-1039.212) (-1039.777) (-1042.136) * (-1040.342) [-1041.560] (-1042.926) (-1038.304) -- 0:01:59
482000 -- [-1035.980] (-1043.861) (-1042.699) (-1038.984) * (-1043.151) (-1036.857) [-1039.173] (-1048.608) -- 0:01:59
482500 -- [-1037.670] (-1042.556) (-1041.586) (-1035.762) * [-1041.059] (-1035.411) (-1038.595) (-1035.885) -- 0:02:00
483000 -- (-1043.800) (-1040.283) (-1043.881) [-1041.265] * (-1042.235) [-1043.208] (-1044.683) (-1040.725) -- 0:01:59
483500 -- (-1044.142) (-1045.114) (-1043.608) [-1041.811] * (-1034.830) (-1049.240) [-1038.136] (-1045.609) -- 0:01:59
484000 -- (-1043.712) (-1042.669) [-1037.041] (-1042.231) * [-1041.873] (-1041.071) (-1038.190) (-1049.082) -- 0:01:59
484500 -- [-1042.991] (-1038.088) (-1041.381) (-1035.147) * (-1049.910) (-1045.125) [-1040.525] (-1042.492) -- 0:01:59
485000 -- (-1037.392) (-1038.786) (-1037.954) [-1037.226] * (-1043.999) (-1041.189) (-1045.316) [-1036.082] -- 0:01:58
Average standard deviation of split frequencies: 0.009561
485500 -- (-1038.183) [-1040.339] (-1035.985) (-1036.935) * (-1037.950) (-1037.762) [-1043.307] (-1041.553) -- 0:01:58
486000 -- (-1035.184) [-1035.911] (-1042.546) (-1041.088) * (-1047.213) (-1041.168) (-1041.013) [-1043.929] -- 0:01:58
486500 -- (-1044.139) [-1043.338] (-1039.399) (-1040.199) * (-1047.457) [-1038.581] (-1038.164) (-1043.321) -- 0:01:58
487000 -- (-1036.345) [-1038.373] (-1037.613) (-1043.044) * (-1045.311) (-1043.023) [-1034.551] (-1041.742) -- 0:01:59
487500 -- (-1044.049) [-1038.705] (-1038.082) (-1036.715) * (-1039.918) [-1042.223] (-1035.866) (-1041.770) -- 0:01:58
488000 -- (-1038.978) (-1044.427) (-1038.017) [-1037.686] * (-1035.039) (-1039.841) (-1039.487) [-1039.429] -- 0:01:58
488500 -- [-1040.867] (-1041.460) (-1042.520) (-1041.880) * (-1041.839) [-1037.732] (-1038.124) (-1038.307) -- 0:01:58
489000 -- (-1042.012) [-1039.796] (-1038.874) (-1039.373) * [-1039.056] (-1047.467) (-1038.925) (-1043.384) -- 0:01:58
489500 -- (-1040.396) (-1040.642) (-1038.873) [-1038.732] * (-1040.622) [-1040.464] (-1046.215) (-1050.121) -- 0:01:57
490000 -- [-1039.080] (-1040.390) (-1041.012) (-1040.501) * (-1033.124) (-1055.222) (-1046.915) [-1042.735] -- 0:01:57
Average standard deviation of split frequencies: 0.009745
490500 -- (-1041.734) (-1044.228) (-1042.007) [-1036.195] * [-1033.134] (-1035.638) (-1046.113) (-1043.139) -- 0:01:57
491000 -- (-1049.201) [-1037.913] (-1039.694) (-1038.413) * [-1037.431] (-1041.994) (-1042.174) (-1041.450) -- 0:01:57
491500 -- [-1047.078] (-1040.934) (-1050.825) (-1045.149) * (-1039.034) [-1036.958] (-1040.893) (-1043.558) -- 0:01:57
492000 -- (-1042.303) [-1045.136] (-1043.287) (-1035.284) * (-1036.635) (-1037.240) [-1037.162] (-1040.457) -- 0:01:57
492500 -- (-1044.286) (-1056.487) [-1033.898] (-1038.777) * (-1039.656) [-1045.243] (-1046.824) (-1036.865) -- 0:01:57
493000 -- (-1047.491) (-1045.222) [-1038.666] (-1036.120) * (-1040.880) (-1041.866) [-1036.777] (-1041.223) -- 0:01:57
493500 -- [-1052.567] (-1036.709) (-1033.655) (-1049.519) * (-1044.540) (-1047.096) (-1044.794) [-1039.486] -- 0:01:57
494000 -- (-1045.342) [-1038.793] (-1040.013) (-1043.378) * (-1042.809) (-1045.108) [-1038.259] (-1035.310) -- 0:01:56
494500 -- (-1041.195) (-1040.543) (-1044.778) [-1039.931] * [-1043.248] (-1036.600) (-1043.984) (-1042.059) -- 0:01:56
495000 -- [-1041.558] (-1037.811) (-1047.050) (-1047.758) * (-1036.607) (-1039.955) (-1034.474) [-1038.848] -- 0:01:56
Average standard deviation of split frequencies: 0.010726
495500 -- (-1041.543) [-1040.174] (-1043.035) (-1056.080) * (-1041.198) (-1053.391) (-1041.187) [-1038.359] -- 0:01:56
496000 -- [-1038.315] (-1040.970) (-1043.875) (-1041.622) * [-1044.897] (-1038.807) (-1037.778) (-1040.394) -- 0:01:56
496500 -- (-1043.971) (-1045.971) [-1041.388] (-1047.297) * (-1042.850) (-1045.105) [-1051.148] (-1047.730) -- 0:01:56
497000 -- (-1046.797) (-1044.695) [-1044.375] (-1047.860) * (-1039.284) (-1041.271) [-1038.069] (-1048.631) -- 0:01:56
497500 -- [-1048.510] (-1045.640) (-1039.570) (-1042.213) * [-1038.960] (-1050.524) (-1041.538) (-1040.466) -- 0:01:56
498000 -- (-1044.377) [-1038.080] (-1040.992) (-1042.600) * (-1042.884) (-1056.288) (-1040.924) [-1041.636] -- 0:01:55
498500 -- (-1040.752) (-1046.048) (-1040.040) [-1042.004] * (-1044.047) [-1044.448] (-1047.363) (-1041.508) -- 0:01:55
499000 -- (-1044.973) (-1037.065) [-1042.304] (-1048.202) * (-1043.385) (-1041.225) [-1046.849] (-1048.973) -- 0:01:55
499500 -- [-1039.220] (-1045.264) (-1039.776) (-1036.921) * [-1035.762] (-1049.571) (-1043.601) (-1041.974) -- 0:01:55
500000 -- (-1037.348) (-1043.618) (-1037.373) [-1040.882] * (-1038.210) (-1041.194) [-1037.426] (-1040.509) -- 0:01:55
Average standard deviation of split frequencies: 0.010357
500500 -- [-1033.714] (-1043.443) (-1049.045) (-1042.467) * (-1042.223) (-1047.579) (-1039.143) [-1040.737] -- 0:01:55
501000 -- (-1038.632) [-1038.081] (-1053.079) (-1039.937) * (-1047.479) (-1044.248) [-1040.689] (-1044.914) -- 0:01:55
501500 -- [-1042.453] (-1040.494) (-1048.578) (-1039.916) * (-1039.337) (-1043.123) (-1051.283) [-1037.838] -- 0:01:55
502000 -- [-1038.237] (-1049.854) (-1049.787) (-1042.210) * [-1040.890] (-1042.251) (-1044.998) (-1041.161) -- 0:01:55
502500 -- (-1039.485) (-1041.088) (-1045.406) [-1038.114] * (-1042.041) (-1047.113) [-1049.393] (-1048.257) -- 0:01:54
503000 -- (-1045.283) (-1052.688) [-1042.831] (-1039.134) * (-1047.449) (-1041.137) (-1049.206) [-1038.233] -- 0:01:54
503500 -- (-1038.670) (-1055.808) [-1047.619] (-1041.306) * (-1047.199) (-1046.349) (-1034.465) [-1037.243] -- 0:01:54
504000 -- (-1037.174) (-1041.416) [-1042.705] (-1042.067) * (-1038.289) (-1041.776) [-1036.480] (-1041.894) -- 0:01:54
504500 -- (-1043.694) (-1037.598) [-1043.567] (-1038.455) * (-1037.948) [-1042.161] (-1043.129) (-1040.023) -- 0:01:54
505000 -- (-1042.049) (-1040.588) [-1032.882] (-1037.353) * (-1043.502) [-1041.397] (-1043.960) (-1041.854) -- 0:01:54
Average standard deviation of split frequencies: 0.009716
505500 -- (-1037.619) (-1052.152) [-1040.763] (-1034.862) * (-1040.632) (-1038.654) [-1037.326] (-1045.502) -- 0:01:54
506000 -- (-1040.873) (-1038.951) [-1037.281] (-1045.398) * (-1044.399) [-1047.894] (-1038.430) (-1040.458) -- 0:01:54
506500 -- (-1037.973) [-1035.784] (-1047.969) (-1041.422) * (-1036.781) (-1045.685) (-1039.755) [-1039.061] -- 0:01:53
507000 -- (-1051.204) [-1034.882] (-1039.988) (-1042.414) * (-1037.826) (-1042.597) [-1034.997] (-1035.748) -- 0:01:53
507500 -- [-1038.569] (-1044.394) (-1041.108) (-1042.570) * (-1050.589) (-1044.755) [-1038.268] (-1041.591) -- 0:01:53
508000 -- (-1047.250) [-1039.670] (-1037.797) (-1037.789) * (-1043.337) [-1037.922] (-1046.769) (-1043.268) -- 0:01:53
508500 -- [-1036.038] (-1051.611) (-1043.192) (-1039.835) * (-1043.786) [-1039.914] (-1037.673) (-1042.595) -- 0:01:53
509000 -- (-1043.658) (-1040.867) (-1045.929) [-1047.616] * (-1043.166) (-1043.715) [-1035.994] (-1045.747) -- 0:01:53
509500 -- (-1040.356) (-1035.287) (-1043.670) [-1036.387] * (-1035.027) (-1041.162) [-1041.438] (-1046.362) -- 0:01:53
510000 -- (-1038.884) (-1048.268) [-1037.656] (-1045.551) * (-1043.179) (-1039.622) (-1047.562) [-1037.061] -- 0:01:53
Average standard deviation of split frequencies: 0.009495
510500 -- (-1038.556) (-1042.903) (-1039.726) [-1042.612] * [-1044.563] (-1047.014) (-1034.628) (-1034.162) -- 0:01:53
511000 -- (-1044.739) (-1046.335) (-1038.647) [-1040.062] * (-1039.840) (-1041.240) [-1041.454] (-1041.070) -- 0:01:52
511500 -- (-1038.898) (-1052.471) [-1045.397] (-1039.766) * (-1042.110) (-1040.341) (-1039.046) [-1036.590] -- 0:01:52
512000 -- (-1039.109) (-1038.953) [-1038.994] (-1038.224) * (-1037.746) [-1042.134] (-1042.995) (-1037.506) -- 0:01:52
512500 -- (-1041.457) [-1038.071] (-1043.989) (-1050.777) * (-1036.557) (-1043.716) [-1038.747] (-1044.514) -- 0:01:52
513000 -- (-1042.201) (-1040.346) (-1044.779) [-1043.891] * [-1037.481] (-1037.703) (-1040.231) (-1035.491) -- 0:01:52
513500 -- [-1036.567] (-1039.432) (-1046.322) (-1049.174) * (-1041.453) (-1041.534) (-1045.230) [-1040.061] -- 0:01:52
514000 -- (-1034.677) (-1040.251) [-1037.434] (-1045.716) * [-1041.938] (-1047.871) (-1037.515) (-1037.346) -- 0:01:52
514500 -- (-1041.562) [-1036.073] (-1036.000) (-1043.880) * (-1039.302) [-1040.495] (-1048.573) (-1037.084) -- 0:01:52
515000 -- [-1037.607] (-1037.258) (-1042.339) (-1038.292) * (-1046.131) (-1043.790) (-1041.929) [-1035.463] -- 0:01:52
Average standard deviation of split frequencies: 0.009136
515500 -- [-1039.917] (-1043.691) (-1042.045) (-1033.587) * (-1042.578) [-1043.362] (-1035.160) (-1043.882) -- 0:01:51
516000 -- (-1039.736) (-1041.829) (-1041.469) [-1044.076] * (-1049.170) [-1042.448] (-1044.067) (-1041.892) -- 0:01:51
516500 -- [-1037.989] (-1037.467) (-1048.611) (-1037.080) * [-1035.270] (-1047.519) (-1040.738) (-1039.960) -- 0:01:51
517000 -- [-1046.866] (-1039.206) (-1052.795) (-1043.946) * [-1038.138] (-1050.641) (-1042.775) (-1039.410) -- 0:01:51
517500 -- (-1038.660) [-1037.684] (-1052.251) (-1040.966) * (-1042.525) [-1042.248] (-1039.046) (-1046.563) -- 0:01:50
518000 -- (-1042.127) (-1042.492) [-1037.776] (-1042.081) * (-1045.823) (-1044.484) (-1041.120) [-1043.947] -- 0:01:51
518500 -- (-1041.385) [-1036.829] (-1041.071) (-1037.660) * [-1042.598] (-1042.757) (-1036.205) (-1035.190) -- 0:01:51
519000 -- (-1037.172) (-1036.563) (-1041.770) [-1036.333] * (-1036.516) [-1035.828] (-1038.423) (-1043.986) -- 0:01:51
519500 -- (-1038.744) [-1035.884] (-1039.620) (-1052.628) * [-1035.747] (-1047.209) (-1042.408) (-1036.958) -- 0:01:50
520000 -- (-1048.283) (-1041.739) (-1041.356) [-1033.059] * (-1042.462) (-1038.372) [-1038.223] (-1039.415) -- 0:01:50
Average standard deviation of split frequencies: 0.009313
520500 -- (-1048.788) [-1042.689] (-1042.188) (-1038.015) * (-1040.889) (-1040.774) (-1037.874) [-1039.827] -- 0:01:50
521000 -- (-1043.087) (-1035.574) [-1042.144] (-1039.686) * (-1039.444) [-1044.741] (-1043.124) (-1038.678) -- 0:01:50
521500 -- [-1035.764] (-1037.951) (-1043.206) (-1040.543) * (-1044.549) (-1040.216) (-1044.711) [-1034.019] -- 0:01:50
522000 -- [-1036.789] (-1040.502) (-1045.050) (-1037.843) * (-1037.457) (-1042.153) (-1043.256) [-1036.782] -- 0:01:50
522500 -- (-1042.706) (-1046.697) [-1041.867] (-1045.083) * (-1039.192) (-1036.761) [-1037.166] (-1046.873) -- 0:01:50
523000 -- (-1037.901) (-1044.888) (-1047.384) [-1042.021] * [-1037.113] (-1044.219) (-1040.835) (-1046.664) -- 0:01:50
523500 -- [-1044.066] (-1038.412) (-1044.539) (-1037.195) * (-1044.667) (-1038.287) (-1038.644) [-1042.148] -- 0:01:50
524000 -- [-1035.190] (-1045.270) (-1041.911) (-1038.102) * (-1033.760) (-1040.118) [-1038.516] (-1040.267) -- 0:01:49
524500 -- (-1043.465) (-1051.075) (-1040.534) [-1039.555] * (-1037.460) [-1037.361] (-1040.828) (-1042.295) -- 0:01:49
525000 -- [-1036.828] (-1042.605) (-1040.369) (-1037.716) * (-1048.797) [-1038.066] (-1045.453) (-1046.967) -- 0:01:49
Average standard deviation of split frequencies: 0.008962
525500 -- (-1040.436) (-1037.989) [-1042.852] (-1050.272) * [-1039.667] (-1036.686) (-1042.620) (-1039.922) -- 0:01:49
526000 -- (-1036.014) (-1045.046) (-1044.888) [-1037.183] * (-1039.516) [-1037.667] (-1041.017) (-1048.812) -- 0:01:49
526500 -- (-1044.648) (-1039.052) (-1040.431) [-1046.073] * (-1036.142) (-1040.965) [-1037.273] (-1047.389) -- 0:01:49
527000 -- (-1040.542) [-1037.116] (-1042.397) (-1037.905) * [-1045.275] (-1037.397) (-1041.211) (-1037.077) -- 0:01:49
527500 -- (-1042.706) [-1041.298] (-1042.781) (-1044.978) * (-1042.063) [-1041.339] (-1036.049) (-1039.011) -- 0:01:49
528000 -- (-1044.677) [-1045.788] (-1047.912) (-1042.794) * (-1036.893) [-1043.535] (-1042.366) (-1042.363) -- 0:01:49
528500 -- (-1048.050) [-1045.686] (-1037.151) (-1042.544) * (-1046.589) (-1038.839) (-1035.654) [-1039.663] -- 0:01:48
529000 -- (-1038.267) [-1037.357] (-1038.052) (-1035.204) * (-1049.064) (-1034.398) [-1044.995] (-1040.639) -- 0:01:48
529500 -- [-1035.586] (-1043.520) (-1042.896) (-1043.909) * (-1047.339) (-1043.324) (-1046.927) [-1043.423] -- 0:01:48
530000 -- (-1048.253) (-1040.468) (-1043.990) [-1039.337] * (-1038.360) [-1038.817] (-1038.539) (-1041.844) -- 0:01:48
Average standard deviation of split frequencies: 0.008883
530500 -- (-1038.637) [-1037.803] (-1040.287) (-1045.055) * [-1036.570] (-1044.148) (-1051.649) (-1053.652) -- 0:01:48
531000 -- (-1035.057) [-1037.251] (-1037.872) (-1046.713) * (-1042.937) [-1040.798] (-1042.410) (-1046.285) -- 0:01:48
531500 -- (-1041.264) [-1036.767] (-1042.486) (-1040.200) * [-1040.003] (-1041.246) (-1041.555) (-1041.695) -- 0:01:48
532000 -- (-1037.219) [-1031.829] (-1043.847) (-1041.739) * (-1033.369) (-1045.910) [-1043.223] (-1041.766) -- 0:01:48
532500 -- (-1041.202) (-1037.577) (-1036.511) [-1040.025] * [-1041.322] (-1041.372) (-1036.445) (-1040.271) -- 0:01:47
533000 -- (-1045.364) [-1040.480] (-1042.495) (-1039.298) * (-1036.961) (-1043.279) (-1043.132) [-1045.915] -- 0:01:47
533500 -- [-1036.142] (-1040.262) (-1044.043) (-1037.540) * (-1043.077) (-1039.570) (-1039.176) [-1038.668] -- 0:01:47
534000 -- (-1046.906) (-1038.165) [-1042.041] (-1038.229) * [-1043.984] (-1039.718) (-1042.125) (-1045.532) -- 0:01:47
534500 -- (-1045.524) (-1047.633) (-1038.991) [-1034.415] * [-1038.845] (-1045.240) (-1045.710) (-1038.093) -- 0:01:47
535000 -- (-1042.251) [-1040.224] (-1038.338) (-1042.430) * (-1039.072) (-1045.119) (-1037.227) [-1034.511] -- 0:01:47
Average standard deviation of split frequencies: 0.008544
535500 -- (-1040.969) (-1037.268) [-1037.054] (-1039.716) * (-1053.076) (-1043.713) (-1044.431) [-1040.079] -- 0:01:47
536000 -- (-1038.129) [-1043.976] (-1049.513) (-1036.355) * [-1038.376] (-1044.704) (-1035.189) (-1044.343) -- 0:01:47
536500 -- [-1035.468] (-1052.163) (-1040.567) (-1037.788) * [-1038.646] (-1042.654) (-1049.097) (-1043.450) -- 0:01:47
537000 -- (-1042.439) (-1043.772) (-1044.720) [-1038.267] * [-1036.786] (-1037.777) (-1040.979) (-1039.769) -- 0:01:46
537500 -- (-1044.635) [-1046.485] (-1037.029) (-1038.045) * (-1043.821) [-1040.550] (-1047.015) (-1043.416) -- 0:01:46
538000 -- (-1040.601) (-1044.425) [-1035.231] (-1040.876) * (-1038.281) [-1041.205] (-1038.928) (-1040.625) -- 0:01:46
538500 -- (-1037.516) (-1041.244) (-1036.706) [-1034.492] * (-1043.702) (-1035.391) (-1034.606) [-1038.196] -- 0:01:46
539000 -- (-1044.805) (-1040.238) [-1032.993] (-1043.239) * (-1039.290) [-1037.386] (-1036.055) (-1047.446) -- 0:01:46
539500 -- (-1039.198) (-1039.841) [-1040.539] (-1033.881) * (-1044.111) (-1041.580) [-1039.783] (-1043.408) -- 0:01:46
540000 -- [-1036.012] (-1035.421) (-1039.989) (-1039.987) * (-1048.789) [-1035.923] (-1050.588) (-1037.877) -- 0:01:46
Average standard deviation of split frequencies: 0.008345
540500 -- (-1035.008) [-1036.147] (-1045.213) (-1034.541) * (-1038.310) [-1038.492] (-1038.811) (-1044.930) -- 0:01:46
541000 -- (-1035.111) [-1045.538] (-1041.186) (-1044.664) * (-1042.686) [-1041.159] (-1036.050) (-1046.406) -- 0:01:46
541500 -- (-1037.535) (-1045.515) [-1035.181] (-1046.144) * (-1037.179) (-1040.812) [-1035.967] (-1044.543) -- 0:01:45
542000 -- (-1050.651) (-1052.938) [-1037.684] (-1045.088) * (-1046.606) (-1052.055) [-1040.064] (-1046.839) -- 0:01:45
542500 -- (-1039.806) (-1040.896) (-1034.922) [-1040.828] * [-1036.542] (-1046.320) (-1046.537) (-1040.848) -- 0:01:45
543000 -- (-1040.400) (-1042.204) [-1043.090] (-1040.924) * (-1044.814) (-1044.691) (-1043.373) [-1044.097] -- 0:01:45
543500 -- [-1039.678] (-1036.814) (-1040.328) (-1041.960) * (-1038.261) (-1052.988) [-1047.557] (-1036.231) -- 0:01:44
544000 -- (-1049.179) (-1043.848) [-1037.974] (-1041.733) * (-1052.620) [-1041.925] (-1040.727) (-1043.286) -- 0:01:45
544500 -- (-1036.179) (-1040.793) (-1039.765) [-1042.243] * [-1041.596] (-1034.170) (-1034.669) (-1044.541) -- 0:01:45
545000 -- (-1039.335) (-1039.917) [-1041.841] (-1044.876) * (-1038.750) (-1043.281) (-1037.461) [-1041.368] -- 0:01:45
Average standard deviation of split frequencies: 0.007894
545500 -- (-1038.535) [-1042.397] (-1048.383) (-1041.897) * (-1036.278) (-1040.668) [-1036.161] (-1048.146) -- 0:01:44
546000 -- [-1039.958] (-1037.791) (-1038.441) (-1042.460) * [-1033.413] (-1031.227) (-1038.376) (-1046.692) -- 0:01:44
546500 -- (-1038.400) (-1036.497) [-1040.821] (-1037.785) * (-1037.741) [-1037.240] (-1042.498) (-1039.083) -- 0:01:44
547000 -- [-1045.887] (-1043.085) (-1043.666) (-1041.719) * [-1037.719] (-1043.820) (-1043.445) (-1036.652) -- 0:01:44
547500 -- (-1041.103) [-1043.960] (-1043.784) (-1046.432) * (-1039.517) (-1053.132) (-1048.036) [-1035.044] -- 0:01:44
548000 -- (-1038.570) (-1045.377) (-1037.588) [-1042.101] * (-1047.754) [-1037.620] (-1048.710) (-1044.541) -- 0:01:43
548500 -- (-1041.923) (-1035.588) [-1049.952] (-1038.080) * [-1041.930] (-1041.815) (-1042.630) (-1043.355) -- 0:01:44
549000 -- (-1040.644) (-1034.356) [-1042.969] (-1044.362) * (-1055.271) (-1035.914) (-1047.571) [-1041.800] -- 0:01:44
549500 -- [-1043.517] (-1038.513) (-1041.250) (-1038.429) * (-1046.616) (-1039.759) [-1042.702] (-1048.309) -- 0:01:44
550000 -- [-1035.192] (-1041.612) (-1048.623) (-1040.298) * (-1041.320) (-1043.776) [-1038.967] (-1036.502) -- 0:01:43
Average standard deviation of split frequencies: 0.007705
550500 -- (-1040.710) [-1040.279] (-1042.582) (-1040.827) * (-1040.494) [-1039.376] (-1047.720) (-1039.550) -- 0:01:43
551000 -- (-1041.401) (-1050.872) (-1040.881) [-1038.655] * (-1035.499) (-1042.046) [-1039.816] (-1043.988) -- 0:01:43
551500 -- (-1043.680) (-1040.077) (-1048.747) [-1037.675] * [-1040.895] (-1040.640) (-1040.543) (-1037.551) -- 0:01:43
552000 -- [-1044.523] (-1035.784) (-1037.657) (-1040.906) * (-1040.053) (-1038.820) [-1047.020] (-1042.993) -- 0:01:43
552500 -- (-1037.964) (-1038.968) [-1046.993] (-1047.177) * (-1043.551) [-1035.484] (-1040.189) (-1048.949) -- 0:01:42
553000 -- (-1042.168) (-1047.323) [-1040.909] (-1043.386) * [-1037.362] (-1038.172) (-1047.525) (-1042.784) -- 0:01:43
553500 -- (-1045.091) (-1048.445) [-1039.312] (-1042.869) * (-1035.574) [-1033.282] (-1048.832) (-1040.642) -- 0:01:43
554000 -- (-1034.657) [-1045.588] (-1043.779) (-1046.734) * [-1038.133] (-1033.731) (-1045.519) (-1036.766) -- 0:01:43
554500 -- (-1047.465) [-1044.852] (-1041.477) (-1043.527) * (-1045.257) (-1038.167) (-1045.528) [-1038.626] -- 0:01:42
555000 -- (-1038.221) (-1042.318) [-1050.718] (-1039.504) * (-1036.578) [-1044.946] (-1044.465) (-1035.963) -- 0:01:42
Average standard deviation of split frequencies: 0.007631
555500 -- (-1047.206) [-1037.308] (-1045.290) (-1048.884) * [-1039.709] (-1041.659) (-1042.921) (-1041.718) -- 0:01:42
556000 -- (-1038.777) [-1044.854] (-1044.742) (-1046.152) * (-1045.722) [-1051.947] (-1047.681) (-1046.590) -- 0:01:42
556500 -- (-1038.421) (-1040.956) (-1045.960) [-1036.439] * (-1038.286) (-1045.920) (-1045.737) [-1036.106] -- 0:01:42
557000 -- (-1040.181) (-1039.271) [-1040.270] (-1034.589) * [-1042.789] (-1040.936) (-1051.672) (-1038.615) -- 0:01:41
557500 -- (-1039.033) [-1038.331] (-1058.428) (-1034.821) * (-1043.702) [-1039.945] (-1038.547) (-1044.330) -- 0:01:42
558000 -- [-1040.409] (-1042.713) (-1034.522) (-1038.678) * (-1040.869) [-1037.727] (-1045.174) (-1041.131) -- 0:01:42
558500 -- (-1038.625) (-1036.048) (-1038.671) [-1039.580] * (-1040.569) [-1036.272] (-1046.310) (-1045.985) -- 0:01:41
559000 -- [-1043.400] (-1042.922) (-1039.095) (-1034.389) * (-1040.165) (-1035.899) [-1042.552] (-1043.960) -- 0:01:41
559500 -- [-1040.109] (-1047.379) (-1045.497) (-1035.237) * (-1044.991) [-1039.154] (-1043.091) (-1046.573) -- 0:01:41
560000 -- (-1039.257) (-1040.098) (-1040.799) [-1043.426] * [-1041.239] (-1043.475) (-1039.983) (-1047.989) -- 0:01:41
Average standard deviation of split frequencies: 0.007447
560500 -- (-1040.960) [-1038.769] (-1045.890) (-1041.305) * [-1039.120] (-1040.994) (-1042.749) (-1044.105) -- 0:01:41
561000 -- (-1045.852) (-1045.324) (-1038.762) [-1039.425] * (-1046.578) (-1038.405) (-1042.979) [-1041.668] -- 0:01:40
561500 -- (-1054.157) (-1046.076) (-1038.423) [-1036.690] * [-1037.836] (-1047.035) (-1035.116) (-1034.733) -- 0:01:41
562000 -- [-1034.656] (-1045.409) (-1044.188) (-1039.017) * (-1038.739) (-1043.897) [-1035.108] (-1053.611) -- 0:01:41
562500 -- [-1036.736] (-1042.914) (-1047.571) (-1037.364) * (-1040.158) (-1038.223) (-1042.443) [-1038.635] -- 0:01:41
563000 -- (-1042.513) (-1048.462) (-1039.214) [-1038.092] * (-1049.691) (-1040.035) [-1037.762] (-1045.351) -- 0:01:40
563500 -- (-1038.167) (-1041.125) (-1042.815) [-1037.953] * (-1037.483) (-1036.604) [-1040.037] (-1050.749) -- 0:01:40
564000 -- [-1035.063] (-1036.256) (-1040.619) (-1037.647) * (-1045.635) (-1033.717) (-1045.172) [-1046.882] -- 0:01:40
564500 -- (-1042.872) [-1045.455] (-1034.639) (-1035.138) * (-1045.146) (-1038.279) (-1041.860) [-1040.343] -- 0:01:40
565000 -- (-1037.039) (-1039.979) (-1041.783) [-1038.910] * (-1043.103) (-1044.440) [-1035.852] (-1043.842) -- 0:01:40
Average standard deviation of split frequencies: 0.008567
565500 -- (-1043.662) [-1039.933] (-1037.913) (-1040.410) * (-1039.803) [-1038.745] (-1035.849) (-1043.606) -- 0:01:39
566000 -- (-1041.600) [-1037.979] (-1041.997) (-1038.626) * (-1045.927) [-1035.867] (-1038.711) (-1039.108) -- 0:01:40
566500 -- (-1039.642) [-1037.231] (-1043.652) (-1033.285) * (-1045.895) [-1040.472] (-1041.813) (-1042.394) -- 0:01:40
567000 -- [-1048.041] (-1035.571) (-1038.511) (-1046.297) * (-1037.005) [-1037.072] (-1039.038) (-1044.868) -- 0:01:40
567500 -- (-1034.435) (-1041.718) [-1039.940] (-1037.028) * [-1036.136] (-1038.692) (-1041.195) (-1039.850) -- 0:01:39
568000 -- (-1035.568) [-1037.345] (-1049.021) (-1036.836) * [-1032.244] (-1041.616) (-1045.435) (-1036.447) -- 0:01:39
568500 -- (-1052.441) (-1041.963) (-1038.391) [-1040.450] * (-1040.785) (-1050.569) (-1044.255) [-1046.338] -- 0:01:39
569000 -- (-1038.129) (-1044.380) (-1045.713) [-1034.683] * (-1038.095) (-1041.155) [-1039.200] (-1042.181) -- 0:01:39
569500 -- (-1038.630) (-1045.409) [-1044.696] (-1039.929) * (-1041.069) (-1047.471) [-1040.258] (-1039.669) -- 0:01:39
570000 -- (-1041.297) (-1044.111) (-1048.700) [-1040.248] * (-1041.839) [-1043.569] (-1044.936) (-1041.786) -- 0:01:38
Average standard deviation of split frequencies: 0.008851
570500 -- (-1043.684) (-1044.104) [-1044.001] (-1038.712) * [-1043.911] (-1042.639) (-1041.902) (-1047.509) -- 0:01:39
571000 -- [-1041.368] (-1045.016) (-1041.528) (-1036.601) * (-1037.459) (-1043.304) [-1037.788] (-1047.238) -- 0:01:39
571500 -- [-1040.424] (-1051.071) (-1041.988) (-1049.675) * (-1038.110) (-1038.909) (-1052.874) [-1042.403] -- 0:01:38
572000 -- (-1042.381) (-1043.632) (-1037.480) [-1037.970] * [-1045.920] (-1046.198) (-1041.754) (-1039.134) -- 0:01:38
572500 -- [-1046.492] (-1048.478) (-1042.115) (-1041.621) * (-1039.113) (-1047.565) (-1040.569) [-1034.215] -- 0:01:38
573000 -- [-1044.481] (-1040.938) (-1041.053) (-1037.462) * (-1041.223) (-1036.905) (-1042.488) [-1043.072] -- 0:01:38
573500 -- (-1044.640) (-1035.092) (-1041.082) [-1041.161] * [-1042.700] (-1041.959) (-1042.424) (-1043.548) -- 0:01:38
574000 -- (-1043.526) [-1036.691] (-1033.935) (-1048.536) * [-1034.426] (-1042.045) (-1038.021) (-1043.807) -- 0:01:37
574500 -- (-1038.169) (-1036.234) [-1038.059] (-1047.411) * [-1037.775] (-1046.362) (-1038.223) (-1044.911) -- 0:01:37
575000 -- (-1042.873) (-1038.191) (-1041.264) [-1034.433] * (-1040.059) (-1046.842) (-1049.265) [-1043.473] -- 0:01:38
Average standard deviation of split frequencies: 0.008418
575500 -- [-1039.221] (-1040.242) (-1040.601) (-1041.182) * (-1039.903) [-1041.855] (-1039.185) (-1043.442) -- 0:01:38
576000 -- [-1044.008] (-1039.222) (-1041.088) (-1042.599) * (-1040.399) (-1035.881) [-1035.189] (-1041.783) -- 0:01:37
576500 -- (-1041.010) [-1040.885] (-1039.263) (-1042.292) * (-1035.853) (-1047.617) (-1041.358) [-1037.062] -- 0:01:37
577000 -- (-1050.186) (-1041.337) [-1040.657] (-1043.263) * [-1038.017] (-1039.447) (-1042.988) (-1049.003) -- 0:01:37
577500 -- (-1038.718) (-1040.363) (-1036.977) [-1038.156] * [-1039.773] (-1039.885) (-1047.615) (-1041.807) -- 0:01:37
578000 -- (-1046.308) [-1036.558] (-1042.905) (-1039.312) * (-1036.388) (-1044.555) [-1038.755] (-1046.718) -- 0:01:37
578500 -- [-1044.038] (-1044.512) (-1047.928) (-1041.349) * (-1040.244) (-1039.670) [-1036.035] (-1042.423) -- 0:01:36
579000 -- [-1048.190] (-1035.224) (-1047.248) (-1037.171) * [-1038.052] (-1040.924) (-1038.224) (-1045.025) -- 0:01:37
579500 -- [-1038.278] (-1040.246) (-1043.560) (-1038.562) * (-1036.881) (-1037.016) [-1034.965] (-1044.724) -- 0:01:37
580000 -- (-1037.801) (-1036.742) (-1036.120) [-1042.104] * (-1039.901) (-1041.406) [-1034.711] (-1042.704) -- 0:01:37
Average standard deviation of split frequencies: 0.008350
580500 -- (-1038.192) (-1035.473) (-1038.840) [-1037.416] * (-1038.148) [-1039.773] (-1039.883) (-1044.794) -- 0:01:36
581000 -- [-1035.871] (-1037.507) (-1040.666) (-1038.723) * [-1041.474] (-1041.308) (-1050.145) (-1043.802) -- 0:01:36
581500 -- (-1039.765) (-1040.168) (-1035.878) [-1046.056] * (-1043.240) (-1040.001) [-1038.339] (-1047.608) -- 0:01:36
582000 -- (-1041.174) [-1043.341] (-1038.802) (-1037.731) * (-1040.936) (-1038.825) (-1042.003) [-1040.086] -- 0:01:36
582500 -- (-1039.785) (-1038.637) (-1042.455) [-1035.815] * (-1039.759) (-1043.336) [-1038.664] (-1042.876) -- 0:01:36
583000 -- [-1035.438] (-1042.952) (-1045.202) (-1038.328) * (-1049.781) [-1040.693] (-1054.937) (-1040.405) -- 0:01:35
583500 -- (-1039.697) (-1040.106) (-1037.756) [-1037.700] * (-1042.815) (-1037.373) (-1042.663) [-1040.144] -- 0:01:36
584000 -- (-1044.005) [-1042.126] (-1041.427) (-1048.937) * (-1038.052) [-1040.361] (-1044.559) (-1043.425) -- 0:01:36
584500 -- (-1038.755) [-1036.176] (-1040.201) (-1041.415) * (-1044.177) (-1039.851) [-1038.366] (-1036.754) -- 0:01:35
585000 -- (-1035.602) (-1049.921) (-1039.095) [-1042.763] * [-1036.346] (-1046.143) (-1050.970) (-1049.041) -- 0:01:35
Average standard deviation of split frequencies: 0.007815
585500 -- (-1034.575) (-1047.130) [-1039.934] (-1040.200) * [-1041.545] (-1039.203) (-1040.473) (-1048.771) -- 0:01:35
586000 -- (-1043.717) (-1042.108) [-1039.220] (-1046.235) * (-1044.901) [-1039.389] (-1041.133) (-1042.057) -- 0:01:35
586500 -- (-1037.758) (-1054.000) [-1036.783] (-1040.588) * (-1051.316) (-1050.849) [-1050.413] (-1045.175) -- 0:01:35
587000 -- (-1036.169) (-1041.558) [-1039.305] (-1041.378) * (-1040.037) [-1040.111] (-1049.372) (-1046.259) -- 0:01:34
587500 -- (-1040.098) (-1041.074) [-1037.903] (-1041.356) * (-1042.111) (-1038.383) [-1038.089] (-1044.227) -- 0:01:34
588000 -- (-1044.781) [-1038.913] (-1041.151) (-1044.372) * [-1039.559] (-1037.869) (-1044.603) (-1041.389) -- 0:01:35
588500 -- (-1045.591) [-1036.946] (-1040.249) (-1040.214) * (-1044.190) [-1038.215] (-1046.952) (-1046.485) -- 0:01:35
589000 -- (-1041.926) (-1043.869) (-1038.559) [-1033.632] * (-1042.807) [-1040.635] (-1044.609) (-1045.449) -- 0:01:34
589500 -- [-1041.950] (-1037.772) (-1042.857) (-1043.514) * [-1045.988] (-1043.250) (-1045.763) (-1049.287) -- 0:01:34
590000 -- (-1041.797) (-1035.066) [-1034.523] (-1044.487) * [-1036.267] (-1044.060) (-1045.429) (-1038.933) -- 0:01:34
Average standard deviation of split frequencies: 0.008323
590500 -- (-1044.302) [-1037.582] (-1037.925) (-1044.552) * (-1038.243) (-1041.206) (-1042.607) [-1036.713] -- 0:01:34
591000 -- (-1047.179) (-1041.080) [-1037.543] (-1039.595) * (-1049.671) (-1045.458) [-1037.769] (-1045.740) -- 0:01:34
591500 -- (-1039.769) (-1041.112) [-1040.789] (-1039.848) * (-1038.176) (-1051.113) (-1040.724) [-1041.208] -- 0:01:33
592000 -- (-1046.093) (-1038.824) [-1033.771] (-1040.227) * (-1046.113) (-1047.104) [-1038.306] (-1040.797) -- 0:01:33
592500 -- (-1043.604) [-1037.664] (-1040.259) (-1050.588) * (-1037.201) (-1050.961) [-1042.788] (-1047.969) -- 0:01:34
593000 -- [-1039.516] (-1046.420) (-1043.257) (-1042.881) * (-1049.493) (-1039.716) [-1041.138] (-1042.947) -- 0:01:34
593500 -- (-1043.093) [-1039.262] (-1043.035) (-1042.085) * (-1041.379) [-1040.318] (-1034.817) (-1043.165) -- 0:01:33
594000 -- (-1047.905) (-1040.022) [-1038.399] (-1044.499) * (-1036.030) (-1037.247) [-1042.828] (-1050.454) -- 0:01:33
594500 -- [-1047.176] (-1042.331) (-1039.365) (-1039.250) * (-1041.145) [-1039.903] (-1039.766) (-1043.283) -- 0:01:33
595000 -- (-1048.503) (-1043.660) (-1048.924) [-1037.023] * [-1038.693] (-1041.377) (-1041.853) (-1050.005) -- 0:01:33
Average standard deviation of split frequencies: 0.008700
595500 -- [-1039.914] (-1041.681) (-1046.554) (-1039.635) * [-1042.681] (-1038.157) (-1042.784) (-1040.328) -- 0:01:33
596000 -- (-1037.129) (-1047.544) (-1034.531) [-1040.817] * (-1043.303) (-1037.336) (-1035.767) [-1042.048] -- 0:01:32
596500 -- (-1039.126) (-1042.251) (-1034.748) [-1037.208] * (-1036.749) (-1039.920) (-1040.259) [-1037.338] -- 0:01:32
597000 -- [-1038.243] (-1046.467) (-1045.646) (-1034.766) * (-1039.313) (-1044.417) (-1034.698) [-1039.963] -- 0:01:33
597500 -- (-1042.351) (-1041.948) [-1043.260] (-1042.149) * [-1037.785] (-1044.523) (-1044.334) (-1044.241) -- 0:01:32
598000 -- (-1038.264) (-1043.897) (-1043.542) [-1037.131] * [-1036.966] (-1041.058) (-1041.044) (-1036.595) -- 0:01:32
598500 -- (-1038.260) [-1043.221] (-1039.989) (-1030.641) * [-1037.900] (-1042.298) (-1042.227) (-1041.535) -- 0:01:32
599000 -- [-1039.302] (-1048.114) (-1040.673) (-1036.922) * (-1047.003) (-1046.021) [-1038.485] (-1038.977) -- 0:01:32
599500 -- (-1041.290) (-1044.694) [-1043.903] (-1031.955) * (-1042.329) (-1034.730) [-1034.904] (-1041.574) -- 0:01:32
600000 -- [-1042.140] (-1044.185) (-1052.677) (-1034.520) * [-1043.884] (-1044.168) (-1044.548) (-1037.848) -- 0:01:32
Average standard deviation of split frequencies: 0.009306
600500 -- (-1044.416) (-1040.177) [-1043.532] (-1038.896) * (-1038.239) (-1042.553) [-1038.198] (-1042.653) -- 0:01:31
601000 -- [-1037.988] (-1038.680) (-1040.792) (-1044.303) * [-1036.141] (-1035.451) (-1038.877) (-1042.504) -- 0:01:31
601500 -- (-1045.968) [-1041.576] (-1045.329) (-1043.086) * (-1041.607) [-1034.784] (-1036.163) (-1046.195) -- 0:01:32
602000 -- [-1039.844] (-1039.374) (-1043.675) (-1041.930) * (-1042.721) (-1040.085) (-1038.605) [-1040.168] -- 0:01:31
602500 -- (-1042.854) [-1044.167] (-1056.147) (-1043.320) * (-1039.012) [-1036.353] (-1041.996) (-1039.442) -- 0:01:31
603000 -- (-1033.619) [-1041.110] (-1043.615) (-1049.361) * (-1035.759) (-1044.630) [-1042.747] (-1042.043) -- 0:01:31
603500 -- (-1039.490) [-1043.353] (-1038.601) (-1045.108) * (-1040.724) [-1042.697] (-1039.765) (-1043.914) -- 0:01:31
604000 -- (-1039.594) (-1046.234) (-1044.766) [-1036.035] * [-1047.244] (-1037.548) (-1038.352) (-1039.676) -- 0:01:31
604500 -- (-1044.126) (-1042.814) [-1038.264] (-1035.205) * (-1040.735) (-1045.624) (-1045.792) [-1043.421] -- 0:01:30
605000 -- (-1043.921) [-1036.510] (-1035.917) (-1039.110) * [-1040.260] (-1049.957) (-1040.584) (-1053.628) -- 0:01:30
Average standard deviation of split frequencies: 0.009446
605500 -- (-1039.301) (-1033.003) (-1038.235) [-1042.221] * (-1043.119) (-1045.514) (-1048.246) [-1038.758] -- 0:01:31
606000 -- (-1041.770) (-1038.429) (-1035.974) [-1038.668] * [-1039.832] (-1048.604) (-1041.690) (-1046.219) -- 0:01:31
606500 -- (-1039.929) (-1038.319) [-1037.205] (-1040.780) * [-1038.296] (-1041.936) (-1038.650) (-1039.941) -- 0:01:30
607000 -- (-1047.381) (-1046.133) [-1036.668] (-1040.337) * [-1042.732] (-1038.010) (-1038.515) (-1042.839) -- 0:01:30
607500 -- (-1036.923) [-1040.066] (-1046.372) (-1038.617) * [-1042.229] (-1042.350) (-1037.029) (-1048.740) -- 0:01:30
608000 -- (-1047.436) (-1044.624) [-1039.612] (-1042.911) * (-1042.774) (-1036.437) (-1040.728) [-1041.255] -- 0:01:30
608500 -- (-1041.587) (-1048.782) (-1041.656) [-1042.845] * (-1034.346) [-1034.809] (-1045.201) (-1044.387) -- 0:01:30
609000 -- (-1049.881) (-1049.261) [-1040.005] (-1036.682) * (-1038.038) [-1037.723] (-1044.010) (-1042.413) -- 0:01:29
609500 -- (-1042.191) (-1037.214) [-1033.295] (-1041.303) * (-1047.419) [-1036.243] (-1042.439) (-1040.460) -- 0:01:29
610000 -- (-1043.965) (-1046.089) [-1044.810] (-1036.083) * (-1043.965) (-1040.166) (-1041.465) [-1038.883] -- 0:01:30
Average standard deviation of split frequencies: 0.009815
610500 -- (-1042.995) (-1039.585) (-1046.584) [-1039.383] * [-1045.103] (-1038.016) (-1039.724) (-1038.685) -- 0:01:29
611000 -- (-1042.399) [-1039.339] (-1038.360) (-1037.064) * (-1042.493) [-1046.074] (-1044.583) (-1045.321) -- 0:01:29
611500 -- (-1044.288) (-1039.754) (-1048.288) [-1041.617] * (-1041.111) (-1043.285) (-1033.870) [-1034.100] -- 0:01:29
612000 -- (-1046.127) (-1038.900) [-1037.087] (-1040.165) * (-1041.832) (-1041.865) [-1038.680] (-1038.283) -- 0:01:29
612500 -- (-1048.806) (-1034.507) (-1044.956) [-1036.324] * (-1047.258) [-1037.767] (-1033.822) (-1037.050) -- 0:01:29
613000 -- (-1048.903) (-1039.932) (-1042.883) [-1039.428] * [-1038.792] (-1037.534) (-1042.157) (-1033.726) -- 0:01:29
613500 -- (-1043.542) [-1037.011] (-1041.210) (-1044.469) * [-1044.525] (-1035.034) (-1041.048) (-1045.628) -- 0:01:28
614000 -- (-1044.718) (-1035.348) (-1040.781) [-1043.016] * [-1039.024] (-1040.820) (-1045.793) (-1045.571) -- 0:01:28
614500 -- (-1037.809) [-1040.164] (-1042.504) (-1039.015) * (-1041.765) [-1041.326] (-1036.134) (-1053.868) -- 0:01:29
615000 -- [-1033.817] (-1039.851) (-1042.913) (-1042.983) * (-1040.856) (-1041.754) [-1037.407] (-1045.323) -- 0:01:28
Average standard deviation of split frequencies: 0.009402
615500 -- (-1037.639) [-1037.252] (-1045.306) (-1040.725) * (-1040.097) [-1037.541] (-1043.975) (-1046.221) -- 0:01:28
616000 -- (-1039.207) (-1036.631) (-1044.224) [-1037.341] * (-1043.674) (-1047.464) (-1040.202) [-1037.631] -- 0:01:28
616500 -- [-1038.107] (-1042.758) (-1044.740) (-1043.470) * (-1039.041) (-1042.650) [-1035.140] (-1043.182) -- 0:01:28
617000 -- [-1040.066] (-1036.268) (-1043.346) (-1044.986) * (-1050.559) (-1039.825) [-1036.073] (-1039.106) -- 0:01:28
617500 -- (-1044.949) [-1036.497] (-1036.282) (-1043.292) * (-1037.499) (-1034.788) [-1040.369] (-1051.064) -- 0:01:27
618000 -- (-1040.931) [-1037.674] (-1047.686) (-1040.466) * (-1038.035) [-1034.836] (-1050.427) (-1039.615) -- 0:01:27
618500 -- (-1044.863) (-1045.090) (-1054.033) [-1042.315] * [-1040.321] (-1041.759) (-1040.125) (-1041.206) -- 0:01:28
619000 -- (-1042.950) [-1036.480] (-1040.268) (-1042.115) * (-1042.419) [-1036.697] (-1042.302) (-1049.738) -- 0:01:28
619500 -- (-1046.735) [-1044.508] (-1037.631) (-1037.724) * (-1040.293) [-1035.171] (-1043.063) (-1042.065) -- 0:01:27
620000 -- (-1045.398) (-1043.086) (-1040.528) [-1034.279] * (-1036.686) (-1034.420) (-1045.221) [-1035.203] -- 0:01:27
Average standard deviation of split frequencies: 0.009006
620500 -- (-1044.460) (-1043.479) [-1043.726] (-1034.963) * [-1040.913] (-1035.766) (-1045.396) (-1045.030) -- 0:01:27
621000 -- [-1042.414] (-1039.617) (-1039.660) (-1041.498) * (-1043.546) (-1041.886) (-1036.639) [-1037.094] -- 0:01:27
621500 -- (-1038.977) (-1037.243) [-1036.789] (-1042.646) * (-1039.376) [-1045.017] (-1053.692) (-1042.144) -- 0:01:27
622000 -- (-1038.384) (-1041.757) (-1044.721) [-1043.100] * (-1036.242) [-1041.379] (-1040.056) (-1042.365) -- 0:01:26
622500 -- (-1039.572) (-1039.617) (-1040.328) [-1038.181] * (-1045.674) [-1043.404] (-1039.618) (-1037.773) -- 0:01:26
623000 -- [-1043.932] (-1049.349) (-1041.813) (-1046.023) * (-1042.404) (-1043.695) [-1044.981] (-1038.678) -- 0:01:27
623500 -- (-1038.579) (-1042.651) [-1037.155] (-1036.807) * (-1042.541) (-1035.945) [-1043.713] (-1036.678) -- 0:01:26
624000 -- (-1044.888) (-1041.999) (-1033.959) [-1041.206] * (-1037.363) (-1038.695) (-1043.537) [-1039.354] -- 0:01:26
624500 -- (-1037.857) (-1044.254) [-1038.072] (-1039.030) * (-1036.779) (-1040.534) (-1041.618) [-1037.782] -- 0:01:26
625000 -- [-1037.982] (-1043.152) (-1038.962) (-1038.891) * [-1037.027] (-1037.742) (-1036.808) (-1051.560) -- 0:01:26
Average standard deviation of split frequencies: 0.009037
625500 -- [-1038.416] (-1047.218) (-1042.859) (-1040.818) * (-1046.546) (-1042.443) [-1046.352] (-1039.817) -- 0:01:26
626000 -- (-1045.346) (-1040.374) [-1041.381] (-1041.474) * [-1043.153] (-1040.634) (-1036.253) (-1042.254) -- 0:01:26
626500 -- (-1038.644) [-1038.395] (-1042.405) (-1041.232) * (-1043.140) (-1048.392) (-1052.319) [-1038.120] -- 0:01:25
627000 -- (-1037.648) (-1042.237) (-1040.767) [-1040.078] * (-1042.302) [-1041.969] (-1044.657) (-1044.212) -- 0:01:25
627500 -- (-1036.464) [-1038.948] (-1041.702) (-1046.414) * (-1042.824) (-1041.746) (-1045.048) [-1038.376] -- 0:01:26
628000 -- (-1038.094) (-1042.767) (-1039.249) [-1041.090] * [-1034.718] (-1045.746) (-1045.928) (-1045.506) -- 0:01:25
628500 -- (-1041.431) (-1043.285) [-1035.239] (-1047.231) * (-1041.142) (-1035.180) (-1046.768) [-1039.852] -- 0:01:25
629000 -- [-1035.910] (-1047.093) (-1040.013) (-1035.951) * (-1039.573) (-1036.616) [-1042.024] (-1036.275) -- 0:01:25
629500 -- (-1037.332) (-1050.426) (-1047.550) [-1039.271] * (-1041.159) (-1048.439) (-1046.929) [-1038.924] -- 0:01:25
630000 -- (-1041.929) (-1043.400) [-1040.624] (-1037.428) * (-1040.808) [-1039.219] (-1042.697) (-1036.530) -- 0:01:25
Average standard deviation of split frequencies: 0.009397
630500 -- (-1040.142) (-1048.793) (-1044.200) [-1034.642] * (-1052.040) (-1046.572) (-1041.551) [-1035.058] -- 0:01:24
631000 -- (-1045.176) [-1037.822] (-1037.777) (-1047.288) * (-1044.463) (-1045.065) [-1040.465] (-1037.619) -- 0:01:24
631500 -- (-1048.920) (-1042.320) [-1038.425] (-1037.647) * (-1053.508) (-1037.054) (-1042.258) [-1040.868] -- 0:01:24
632000 -- (-1047.035) (-1035.790) (-1038.626) [-1039.107] * (-1043.842) (-1039.245) [-1044.779] (-1045.376) -- 0:01:25
632500 -- (-1045.378) [-1039.467] (-1039.611) (-1044.857) * [-1046.135] (-1046.837) (-1041.725) (-1042.553) -- 0:01:24
633000 -- (-1044.811) [-1037.939] (-1039.885) (-1039.451) * (-1051.191) [-1038.145] (-1046.018) (-1046.270) -- 0:01:24
633500 -- (-1040.687) [-1036.551] (-1053.127) (-1044.896) * (-1044.203) (-1046.318) (-1042.558) [-1041.036] -- 0:01:24
634000 -- (-1041.777) [-1040.647] (-1036.738) (-1048.227) * (-1045.162) (-1042.301) (-1036.063) [-1036.520] -- 0:01:24
634500 -- (-1040.509) [-1041.688] (-1041.560) (-1040.897) * (-1047.255) [-1035.892] (-1039.569) (-1043.920) -- 0:01:24
635000 -- (-1042.124) (-1056.000) (-1040.837) [-1043.516] * (-1037.177) (-1051.257) (-1037.940) [-1039.693] -- 0:01:23
Average standard deviation of split frequencies: 0.009212
635500 -- (-1037.405) [-1047.204] (-1041.430) (-1051.225) * (-1047.744) (-1039.726) [-1041.026] (-1041.721) -- 0:01:23
636000 -- [-1038.967] (-1039.086) (-1041.940) (-1051.259) * (-1043.428) [-1041.302] (-1036.049) (-1035.760) -- 0:01:23
636500 -- (-1039.996) (-1036.991) (-1038.287) [-1042.923] * (-1045.219) [-1036.552] (-1040.165) (-1043.186) -- 0:01:23
637000 -- [-1036.128] (-1039.200) (-1048.887) (-1042.279) * (-1046.013) (-1047.076) [-1046.826] (-1045.057) -- 0:01:23
637500 -- [-1042.309] (-1039.031) (-1040.547) (-1041.216) * (-1039.535) (-1032.592) [-1037.745] (-1044.995) -- 0:01:23
638000 -- (-1036.296) (-1040.330) [-1041.653] (-1044.184) * (-1044.827) (-1038.618) (-1043.768) [-1041.074] -- 0:01:23
638500 -- [-1037.448] (-1040.294) (-1039.645) (-1037.612) * (-1039.527) [-1042.177] (-1042.048) (-1052.865) -- 0:01:23
639000 -- (-1040.426) [-1040.508] (-1038.846) (-1039.725) * [-1038.379] (-1042.703) (-1038.473) (-1040.939) -- 0:01:23
639500 -- (-1052.668) (-1054.126) [-1042.484] (-1037.627) * [-1037.527] (-1051.300) (-1042.119) (-1042.080) -- 0:01:22
640000 -- (-1040.560) (-1039.147) (-1040.975) [-1037.892] * [-1042.443] (-1040.785) (-1038.402) (-1038.755) -- 0:01:22
Average standard deviation of split frequencies: 0.008619
640500 -- (-1043.354) [-1042.311] (-1042.485) (-1040.456) * (-1044.994) (-1035.031) [-1038.366] (-1039.712) -- 0:01:22
641000 -- (-1039.363) [-1050.048] (-1040.328) (-1035.166) * (-1041.414) (-1039.821) (-1040.196) [-1043.341] -- 0:01:22
641500 -- (-1040.653) [-1042.031] (-1039.236) (-1040.564) * (-1044.508) (-1036.430) [-1034.724] (-1043.271) -- 0:01:22
642000 -- [-1035.088] (-1042.636) (-1041.307) (-1050.567) * (-1041.628) (-1044.499) [-1036.850] (-1043.619) -- 0:01:22
642500 -- (-1046.972) (-1037.276) [-1046.544] (-1038.676) * (-1053.029) (-1040.624) [-1042.159] (-1038.737) -- 0:01:22
643000 -- (-1040.277) [-1042.338] (-1047.653) (-1041.376) * (-1043.894) [-1040.695] (-1040.316) (-1040.237) -- 0:01:22
643500 -- [-1035.478] (-1042.109) (-1044.146) (-1043.303) * [-1040.785] (-1040.682) (-1044.985) (-1038.523) -- 0:01:21
644000 -- (-1041.416) (-1043.914) [-1044.265] (-1041.517) * (-1040.525) [-1037.818] (-1047.156) (-1043.723) -- 0:01:21
644500 -- (-1047.127) [-1045.090] (-1048.875) (-1048.165) * (-1052.478) (-1044.977) (-1036.517) [-1037.171] -- 0:01:21
645000 -- (-1039.301) [-1043.712] (-1042.723) (-1039.460) * (-1047.088) (-1049.957) (-1040.999) [-1033.555] -- 0:01:22
Average standard deviation of split frequencies: 0.008548
645500 -- (-1043.924) [-1040.289] (-1044.385) (-1044.473) * (-1040.188) (-1039.039) [-1041.888] (-1039.997) -- 0:01:21
646000 -- [-1037.992] (-1046.354) (-1045.571) (-1041.417) * (-1042.462) [-1045.063] (-1043.077) (-1047.524) -- 0:01:21
646500 -- (-1047.863) (-1037.873) (-1042.845) [-1041.869] * (-1047.038) [-1035.990] (-1038.608) (-1043.582) -- 0:01:21
647000 -- (-1042.059) (-1040.095) [-1045.442] (-1044.204) * [-1044.356] (-1040.212) (-1039.138) (-1043.002) -- 0:01:21
647500 -- (-1036.995) (-1044.188) [-1041.979] (-1040.766) * (-1038.828) (-1040.389) (-1039.831) [-1036.506] -- 0:01:21
648000 -- [-1041.930] (-1045.743) (-1042.294) (-1042.280) * (-1042.856) (-1048.194) (-1045.572) [-1047.142] -- 0:01:20
648500 -- (-1045.633) [-1041.472] (-1045.332) (-1038.275) * [-1040.177] (-1045.941) (-1038.237) (-1048.215) -- 0:01:20
649000 -- (-1040.067) (-1042.970) [-1041.012] (-1042.991) * (-1040.835) (-1034.963) [-1042.292] (-1040.791) -- 0:01:20
649500 -- [-1037.224] (-1039.713) (-1039.019) (-1039.146) * (-1048.755) [-1040.808] (-1048.989) (-1036.465) -- 0:01:20
650000 -- (-1045.622) [-1047.172] (-1037.419) (-1038.743) * [-1039.714] (-1036.668) (-1036.463) (-1043.275) -- 0:01:20
Average standard deviation of split frequencies: 0.008590
650500 -- (-1045.160) (-1047.917) (-1036.198) [-1039.069] * (-1041.095) (-1041.336) (-1044.306) [-1054.606] -- 0:01:20
651000 -- [-1032.514] (-1042.652) (-1041.401) (-1050.715) * (-1040.691) [-1033.981] (-1044.328) (-1047.292) -- 0:01:20
651500 -- [-1037.847] (-1038.079) (-1048.439) (-1042.432) * [-1043.151] (-1037.806) (-1036.667) (-1046.859) -- 0:01:20
652000 -- [-1039.200] (-1044.903) (-1038.093) (-1038.436) * (-1048.302) [-1036.453] (-1041.362) (-1038.839) -- 0:01:20
652500 -- (-1042.355) (-1040.616) (-1038.971) [-1034.923] * (-1041.231) (-1039.667) [-1036.755] (-1042.008) -- 0:01:19
653000 -- (-1047.226) [-1042.925] (-1041.794) (-1040.235) * [-1042.612] (-1039.432) (-1038.550) (-1049.905) -- 0:01:19
653500 -- (-1053.951) (-1040.727) (-1037.532) [-1037.717] * (-1044.992) (-1047.141) (-1047.713) [-1040.738] -- 0:01:19
654000 -- (-1040.395) (-1047.475) (-1043.782) [-1034.452] * [-1046.626] (-1041.393) (-1044.727) (-1046.842) -- 0:01:19
654500 -- [-1039.523] (-1041.190) (-1045.569) (-1041.919) * (-1041.266) [-1039.261] (-1039.585) (-1034.873) -- 0:01:19
655000 -- (-1042.504) [-1035.186] (-1043.151) (-1035.088) * (-1041.476) (-1040.982) (-1038.188) [-1044.628] -- 0:01:19
Average standard deviation of split frequencies: 0.009034
655500 -- [-1041.006] (-1040.639) (-1039.508) (-1047.654) * (-1038.192) (-1043.272) [-1038.951] (-1044.012) -- 0:01:19
656000 -- (-1041.038) (-1041.365) (-1052.053) [-1039.067] * (-1043.783) (-1037.428) [-1041.756] (-1043.267) -- 0:01:19
656500 -- [-1046.696] (-1045.543) (-1051.196) (-1042.356) * (-1039.056) [-1034.384] (-1038.841) (-1043.583) -- 0:01:19
657000 -- (-1044.144) (-1044.964) [-1039.783] (-1041.389) * (-1041.328) (-1033.621) (-1038.023) [-1042.073] -- 0:01:18
657500 -- [-1038.770] (-1046.775) (-1042.213) (-1043.226) * (-1037.882) (-1049.656) (-1047.451) [-1046.521] -- 0:01:18
658000 -- (-1045.320) [-1042.318] (-1040.227) (-1043.068) * (-1037.341) [-1039.420] (-1039.583) (-1042.445) -- 0:01:18
658500 -- (-1042.815) (-1038.786) (-1044.734) [-1042.006] * (-1042.959) (-1039.045) [-1046.805] (-1043.831) -- 0:01:18
659000 -- (-1038.334) (-1041.276) [-1038.902] (-1043.539) * (-1037.313) [-1046.231] (-1046.649) (-1040.430) -- 0:01:18
659500 -- (-1041.363) (-1044.933) (-1039.856) [-1035.427] * [-1042.912] (-1041.621) (-1046.320) (-1044.981) -- 0:01:18
660000 -- (-1040.275) (-1044.400) [-1038.285] (-1035.560) * [-1035.480] (-1036.355) (-1038.980) (-1036.536) -- 0:01:18
Average standard deviation of split frequencies: 0.008868
660500 -- (-1042.396) [-1043.697] (-1039.916) (-1040.171) * (-1034.176) (-1040.144) (-1038.821) [-1039.479] -- 0:01:18
661000 -- (-1043.877) (-1042.040) (-1037.903) [-1040.063] * [-1038.925] (-1040.527) (-1047.442) (-1039.480) -- 0:01:17
661500 -- (-1048.214) [-1041.632] (-1045.071) (-1046.256) * (-1046.873) (-1040.352) [-1037.126] (-1043.177) -- 0:01:17
662000 -- (-1048.014) (-1047.851) (-1044.665) [-1044.479] * (-1048.697) [-1038.066] (-1040.286) (-1040.237) -- 0:01:17
662500 -- [-1043.513] (-1041.254) (-1040.170) (-1039.524) * (-1040.165) (-1043.775) (-1048.762) [-1040.430] -- 0:01:17
663000 -- (-1041.638) (-1039.468) [-1036.854] (-1036.216) * [-1037.407] (-1041.419) (-1046.264) (-1039.616) -- 0:01:17
663500 -- (-1040.328) [-1038.426] (-1039.401) (-1046.905) * [-1038.061] (-1044.165) (-1046.377) (-1040.284) -- 0:01:17
664000 -- (-1034.465) [-1039.609] (-1042.961) (-1045.859) * (-1038.036) [-1040.885] (-1037.913) (-1048.743) -- 0:01:17
664500 -- (-1043.192) (-1057.809) [-1039.551] (-1049.239) * (-1042.074) (-1036.361) (-1045.458) [-1035.694] -- 0:01:17
665000 -- (-1041.533) (-1046.050) (-1042.265) [-1038.419] * (-1046.839) (-1041.342) [-1038.074] (-1044.555) -- 0:01:17
Average standard deviation of split frequencies: 0.008999
665500 -- (-1054.562) (-1047.089) [-1037.185] (-1039.198) * (-1039.196) [-1041.809] (-1039.014) (-1043.448) -- 0:01:16
666000 -- (-1045.379) (-1053.473) [-1040.144] (-1049.124) * [-1042.810] (-1041.362) (-1037.964) (-1049.283) -- 0:01:16
666500 -- (-1038.886) (-1044.493) [-1038.306] (-1042.478) * (-1051.698) (-1037.883) (-1038.537) [-1045.529] -- 0:01:16
667000 -- (-1042.468) (-1047.775) [-1043.845] (-1040.360) * (-1045.478) (-1044.214) [-1043.119] (-1042.986) -- 0:01:16
667500 -- (-1044.131) (-1043.287) (-1040.969) [-1042.186] * (-1046.290) (-1040.596) (-1047.372) [-1047.078] -- 0:01:16
668000 -- (-1043.522) (-1039.415) [-1041.579] (-1035.428) * (-1039.105) [-1044.111] (-1039.903) (-1038.582) -- 0:01:16
668500 -- (-1048.303) [-1040.400] (-1044.242) (-1042.262) * (-1039.830) (-1040.480) (-1039.107) [-1038.758] -- 0:01:16
669000 -- (-1044.804) (-1039.206) (-1040.276) [-1037.517] * (-1043.879) [-1036.173] (-1043.401) (-1040.455) -- 0:01:16
669500 -- (-1042.893) (-1046.886) (-1038.291) [-1034.579] * (-1035.948) (-1035.016) (-1042.073) [-1034.948] -- 0:01:16
670000 -- (-1045.240) [-1039.041] (-1038.284) (-1038.771) * (-1037.024) (-1042.564) (-1046.766) [-1044.613] -- 0:01:15
Average standard deviation of split frequencies: 0.008736
670500 -- (-1045.448) (-1045.980) [-1037.827] (-1040.429) * (-1040.102) (-1035.168) (-1045.147) [-1038.466] -- 0:01:15
671000 -- [-1048.037] (-1042.937) (-1039.689) (-1036.570) * (-1038.457) (-1039.692) [-1036.263] (-1042.192) -- 0:01:15
671500 -- [-1039.041] (-1040.502) (-1039.685) (-1045.372) * (-1035.268) (-1040.214) [-1037.727] (-1046.324) -- 0:01:15
672000 -- (-1039.553) [-1038.000] (-1042.186) (-1037.499) * (-1052.244) (-1043.231) [-1036.841] (-1041.716) -- 0:01:15
672500 -- [-1041.189] (-1050.682) (-1046.966) (-1039.564) * (-1040.636) (-1047.071) (-1040.043) [-1038.459] -- 0:01:15
673000 -- (-1052.183) (-1047.019) (-1046.258) [-1038.049] * (-1040.223) (-1043.739) [-1038.499] (-1039.443) -- 0:01:15
673500 -- (-1039.260) [-1046.291] (-1039.015) (-1042.893) * [-1042.777] (-1042.796) (-1036.345) (-1038.595) -- 0:01:15
674000 -- (-1037.479) (-1044.624) (-1036.202) [-1043.549] * (-1037.941) (-1049.729) [-1032.408] (-1043.347) -- 0:01:14
674500 -- (-1037.057) (-1046.757) [-1035.056] (-1042.133) * [-1040.972] (-1055.217) (-1041.456) (-1050.209) -- 0:01:14
675000 -- [-1041.511] (-1037.550) (-1041.714) (-1042.373) * (-1046.472) (-1046.793) [-1037.943] (-1041.995) -- 0:01:14
Average standard deviation of split frequencies: 0.008368
675500 -- (-1040.589) (-1039.136) (-1046.569) [-1037.784] * [-1041.798] (-1039.034) (-1035.552) (-1034.530) -- 0:01:14
676000 -- (-1042.491) (-1045.044) [-1035.410] (-1043.085) * (-1036.810) (-1041.341) [-1038.421] (-1037.399) -- 0:01:14
676500 -- (-1043.201) (-1038.804) [-1039.995] (-1046.260) * (-1043.364) (-1044.864) [-1041.222] (-1038.189) -- 0:01:14
677000 -- [-1038.139] (-1043.295) (-1047.070) (-1043.926) * [-1038.026] (-1039.240) (-1041.638) (-1039.730) -- 0:01:14
677500 -- (-1045.161) (-1038.720) (-1042.874) [-1044.215] * (-1035.090) (-1041.801) (-1040.624) [-1039.622] -- 0:01:14
678000 -- (-1039.817) (-1038.119) (-1040.088) [-1042.290] * (-1046.176) (-1038.537) [-1040.119] (-1041.212) -- 0:01:14
678500 -- (-1044.985) (-1047.158) [-1041.354] (-1034.194) * [-1039.816] (-1042.785) (-1041.005) (-1036.305) -- 0:01:13
679000 -- (-1038.709) (-1034.570) (-1037.225) [-1042.121] * (-1048.776) (-1041.210) [-1038.859] (-1044.637) -- 0:01:13
679500 -- (-1041.628) (-1037.236) (-1037.044) [-1038.151] * (-1039.954) (-1043.497) [-1036.149] (-1048.153) -- 0:01:13
680000 -- [-1040.317] (-1037.345) (-1045.645) (-1035.933) * [-1036.952] (-1042.174) (-1040.195) (-1044.701) -- 0:01:13
Average standard deviation of split frequencies: 0.008212
680500 -- (-1047.343) (-1045.766) (-1048.382) [-1037.583] * (-1040.939) (-1046.279) [-1036.835] (-1040.899) -- 0:01:13
681000 -- (-1037.911) (-1053.602) (-1040.358) [-1046.150] * (-1043.384) [-1036.443] (-1041.075) (-1039.654) -- 0:01:13
681500 -- [-1035.296] (-1040.298) (-1039.239) (-1041.498) * (-1041.725) [-1042.747] (-1043.920) (-1051.271) -- 0:01:13
682000 -- [-1035.613] (-1038.467) (-1040.764) (-1040.618) * (-1044.939) (-1040.951) [-1042.827] (-1046.859) -- 0:01:13
682500 -- [-1040.337] (-1046.660) (-1044.890) (-1043.776) * [-1035.788] (-1049.681) (-1040.581) (-1037.508) -- 0:01:13
683000 -- [-1043.179] (-1044.771) (-1041.999) (-1035.874) * [-1036.740] (-1053.286) (-1039.975) (-1038.254) -- 0:01:12
683500 -- [-1040.452] (-1041.900) (-1040.681) (-1037.856) * (-1044.607) (-1041.027) (-1033.791) [-1042.368] -- 0:01:12
684000 -- [-1038.776] (-1046.565) (-1040.160) (-1041.250) * (-1039.173) (-1043.694) [-1036.911] (-1036.605) -- 0:01:12
684500 -- [-1044.411] (-1047.745) (-1042.738) (-1040.046) * [-1044.112] (-1045.813) (-1041.880) (-1039.141) -- 0:01:12
685000 -- (-1042.942) [-1041.025] (-1038.002) (-1033.977) * (-1040.861) (-1054.987) [-1046.823] (-1045.365) -- 0:01:12
Average standard deviation of split frequencies: 0.008639
685500 -- (-1047.747) (-1046.418) [-1044.738] (-1036.475) * [-1041.883] (-1041.478) (-1037.508) (-1037.241) -- 0:01:12
686000 -- (-1039.129) (-1038.269) (-1049.299) [-1040.292] * [-1046.740] (-1040.125) (-1038.188) (-1042.534) -- 0:01:12
686500 -- [-1041.997] (-1035.017) (-1043.771) (-1041.897) * [-1037.062] (-1038.350) (-1041.275) (-1041.828) -- 0:01:12
687000 -- (-1040.029) [-1036.684] (-1041.073) (-1038.116) * [-1041.408] (-1041.171) (-1044.388) (-1037.909) -- 0:01:11
687500 -- (-1044.623) [-1038.596] (-1041.670) (-1038.965) * (-1039.309) [-1040.639] (-1036.042) (-1048.314) -- 0:01:11
688000 -- (-1047.641) (-1047.735) (-1045.429) [-1042.901] * (-1038.480) (-1034.485) (-1035.680) [-1046.015] -- 0:01:11
688500 -- (-1042.266) (-1045.732) [-1035.918] (-1047.244) * (-1041.759) [-1035.705] (-1042.121) (-1041.044) -- 0:01:11
689000 -- [-1039.544] (-1043.425) (-1038.091) (-1039.322) * [-1039.068] (-1044.111) (-1037.939) (-1046.255) -- 0:01:11
689500 -- [-1038.468] (-1038.990) (-1042.364) (-1041.837) * (-1039.446) (-1040.596) [-1040.922] (-1039.851) -- 0:01:11
690000 -- [-1038.905] (-1045.391) (-1044.935) (-1044.342) * (-1044.163) (-1038.728) (-1043.343) [-1039.421] -- 0:01:11
Average standard deviation of split frequencies: 0.008093
690500 -- (-1043.331) (-1041.966) [-1039.727] (-1043.078) * (-1039.524) (-1034.779) (-1041.784) [-1039.071] -- 0:01:11
691000 -- (-1038.865) (-1042.706) (-1037.147) [-1039.983] * (-1043.230) (-1037.876) (-1039.921) [-1040.754] -- 0:01:11
691500 -- (-1047.867) (-1041.228) [-1044.716] (-1037.815) * (-1046.152) (-1043.036) [-1037.028] (-1044.274) -- 0:01:10
692000 -- (-1041.554) (-1039.232) [-1040.342] (-1039.607) * (-1039.318) (-1039.579) (-1044.868) [-1041.807] -- 0:01:10
692500 -- (-1040.758) (-1038.547) [-1036.641] (-1045.913) * (-1044.813) (-1034.949) (-1036.167) [-1040.323] -- 0:01:10
693000 -- [-1037.317] (-1052.047) (-1043.289) (-1044.210) * (-1041.413) (-1047.705) (-1041.483) [-1037.335] -- 0:01:10
693500 -- (-1042.079) [-1031.571] (-1044.451) (-1040.546) * (-1039.078) (-1040.093) (-1045.174) [-1035.239] -- 0:01:10
694000 -- (-1046.683) (-1040.883) (-1046.320) [-1044.755] * (-1047.913) (-1035.551) (-1038.123) [-1036.475] -- 0:01:10
694500 -- (-1045.172) [-1041.644] (-1038.120) (-1042.215) * [-1036.668] (-1040.688) (-1038.438) (-1036.220) -- 0:01:10
695000 -- (-1040.888) (-1043.232) (-1037.794) [-1045.883] * (-1035.284) [-1037.233] (-1053.106) (-1042.548) -- 0:01:10
Average standard deviation of split frequencies: 0.008805
695500 -- (-1041.902) [-1039.843] (-1038.700) (-1036.517) * [-1037.936] (-1036.534) (-1039.726) (-1035.696) -- 0:01:10
696000 -- (-1040.713) (-1041.496) [-1035.290] (-1044.009) * (-1041.777) (-1039.237) [-1037.774] (-1040.868) -- 0:01:09
696500 -- (-1037.504) (-1036.782) [-1035.458] (-1044.051) * [-1041.870] (-1045.024) (-1041.388) (-1041.563) -- 0:01:09
697000 -- (-1044.816) (-1042.110) [-1031.302] (-1041.380) * (-1042.069) (-1043.242) (-1043.700) [-1041.976] -- 0:01:09
697500 -- (-1044.384) (-1040.532) (-1034.708) [-1037.965] * (-1047.338) [-1038.738] (-1038.750) (-1038.266) -- 0:01:09
698000 -- (-1040.137) (-1040.204) [-1036.273] (-1042.439) * (-1039.671) [-1039.330] (-1044.242) (-1035.765) -- 0:01:09
698500 -- (-1036.615) [-1040.271] (-1043.897) (-1037.875) * [-1044.280] (-1037.224) (-1045.158) (-1032.967) -- 0:01:09
699000 -- (-1041.967) (-1041.438) (-1046.246) [-1039.366] * [-1044.005] (-1044.932) (-1048.156) (-1037.323) -- 0:01:09
699500 -- (-1038.856) [-1042.935] (-1038.711) (-1039.120) * (-1038.808) [-1044.927] (-1037.791) (-1039.257) -- 0:01:09
700000 -- [-1041.917] (-1042.495) (-1040.900) (-1037.598) * (-1043.594) (-1046.429) (-1035.814) [-1039.278] -- 0:01:09
Average standard deviation of split frequencies: 0.008458
700500 -- (-1041.820) [-1036.880] (-1042.495) (-1039.572) * (-1041.062) (-1047.627) (-1040.962) [-1047.140] -- 0:01:08
701000 -- (-1040.405) [-1039.409] (-1045.970) (-1042.319) * [-1041.115] (-1048.157) (-1038.047) (-1041.376) -- 0:01:08
701500 -- (-1040.779) (-1041.918) [-1040.533] (-1037.700) * [-1035.477] (-1056.435) (-1042.744) (-1042.341) -- 0:01:08
702000 -- [-1040.434] (-1039.273) (-1040.522) (-1046.541) * [-1035.298] (-1039.355) (-1041.753) (-1045.378) -- 0:01:08
702500 -- [-1041.991] (-1040.585) (-1033.498) (-1046.127) * [-1032.213] (-1037.289) (-1044.163) (-1049.441) -- 0:01:08
703000 -- (-1039.932) (-1047.034) (-1037.748) [-1033.581] * (-1042.237) [-1041.783] (-1039.385) (-1043.196) -- 0:01:08
703500 -- (-1035.623) (-1044.156) (-1042.337) [-1042.197] * (-1044.727) (-1040.767) [-1042.115] (-1048.557) -- 0:01:08
704000 -- [-1040.001] (-1042.819) (-1037.692) (-1039.581) * (-1045.741) (-1042.984) [-1044.918] (-1042.158) -- 0:01:08
704500 -- (-1044.508) (-1043.662) (-1044.433) [-1043.326] * (-1044.696) (-1042.865) [-1035.574] (-1052.230) -- 0:01:07
705000 -- (-1042.526) [-1038.167] (-1041.514) (-1037.849) * (-1044.909) [-1038.150] (-1043.722) (-1051.389) -- 0:01:07
Average standard deviation of split frequencies: 0.008013
705500 -- (-1039.513) (-1038.640) (-1035.454) [-1041.652] * [-1041.302] (-1040.089) (-1042.837) (-1056.443) -- 0:01:07
706000 -- (-1042.624) (-1037.578) [-1038.813] (-1043.280) * [-1035.843] (-1043.201) (-1036.848) (-1044.957) -- 0:01:07
706500 -- (-1041.726) (-1046.171) [-1040.436] (-1035.292) * (-1042.224) [-1037.602] (-1040.082) (-1040.566) -- 0:01:07
707000 -- (-1041.164) (-1041.399) (-1037.557) [-1033.919] * (-1042.257) [-1034.819] (-1038.282) (-1046.333) -- 0:01:07
707500 -- [-1048.808] (-1038.748) (-1036.373) (-1036.460) * (-1040.828) (-1044.470) [-1036.837] (-1045.148) -- 0:01:07
708000 -- (-1043.916) (-1036.118) (-1041.736) [-1037.914] * (-1040.426) (-1049.192) (-1041.012) [-1038.784] -- 0:01:07
708500 -- (-1047.406) (-1041.502) [-1038.236] (-1044.911) * (-1040.229) [-1042.104] (-1034.770) (-1041.500) -- 0:01:07
709000 -- (-1042.712) (-1040.365) [-1040.944] (-1038.521) * (-1047.146) (-1043.235) [-1045.048] (-1046.950) -- 0:01:06
709500 -- [-1038.642] (-1037.118) (-1044.255) (-1036.820) * (-1051.594) (-1047.155) (-1035.261) [-1044.176] -- 0:01:06
710000 -- (-1039.118) (-1045.147) [-1035.554] (-1041.236) * (-1038.610) (-1047.966) (-1036.856) [-1036.077] -- 0:01:06
Average standard deviation of split frequencies: 0.008244
710500 -- (-1042.911) (-1046.192) [-1041.375] (-1039.874) * (-1039.211) (-1052.601) (-1043.052) [-1040.069] -- 0:01:06
711000 -- (-1041.754) [-1035.946] (-1044.895) (-1046.686) * [-1042.391] (-1053.450) (-1036.891) (-1040.111) -- 0:01:06
711500 -- (-1038.461) [-1037.207] (-1044.019) (-1037.482) * [-1036.544] (-1047.681) (-1036.450) (-1042.548) -- 0:01:06
712000 -- (-1042.732) [-1036.128] (-1045.354) (-1045.742) * (-1038.013) [-1042.087] (-1047.263) (-1035.224) -- 0:01:06
712500 -- (-1050.590) [-1041.170] (-1040.561) (-1042.771) * (-1039.399) [-1038.489] (-1045.519) (-1038.908) -- 0:01:06
713000 -- (-1036.588) [-1042.506] (-1038.907) (-1049.017) * [-1041.264] (-1037.237) (-1046.030) (-1038.070) -- 0:01:06
713500 -- (-1042.504) [-1038.655] (-1045.708) (-1057.215) * (-1042.700) [-1041.013] (-1039.008) (-1038.252) -- 0:01:05
714000 -- (-1039.373) (-1045.781) (-1043.677) [-1043.389] * (-1045.656) (-1044.937) [-1044.851] (-1036.946) -- 0:01:05
714500 -- [-1035.498] (-1040.161) (-1041.495) (-1050.371) * (-1046.258) (-1036.312) (-1036.389) [-1037.957] -- 0:01:05
715000 -- [-1038.506] (-1039.257) (-1041.823) (-1045.045) * (-1044.520) (-1037.219) (-1038.323) [-1043.787] -- 0:01:05
Average standard deviation of split frequencies: 0.008465
715500 -- (-1041.798) [-1038.234] (-1048.279) (-1044.837) * (-1039.765) [-1038.953] (-1041.705) (-1039.748) -- 0:01:05
716000 -- [-1038.691] (-1038.073) (-1047.948) (-1052.292) * (-1043.162) (-1043.041) (-1057.009) [-1043.744] -- 0:01:05
716500 -- (-1040.625) [-1040.035] (-1042.405) (-1044.448) * [-1039.234] (-1038.393) (-1047.606) (-1042.391) -- 0:01:05
717000 -- (-1045.034) [-1036.170] (-1043.049) (-1035.517) * [-1040.923] (-1046.640) (-1051.427) (-1041.799) -- 0:01:05
717500 -- [-1033.759] (-1037.403) (-1037.748) (-1037.951) * [-1037.435] (-1038.716) (-1056.308) (-1048.296) -- 0:01:04
718000 -- (-1034.748) (-1039.854) (-1044.470) [-1043.406] * (-1035.627) (-1041.312) (-1043.662) [-1041.293] -- 0:01:04
718500 -- [-1037.304] (-1037.438) (-1045.799) (-1045.561) * (-1040.559) [-1041.636] (-1046.312) (-1048.103) -- 0:01:04
719000 -- (-1043.188) [-1041.949] (-1047.658) (-1048.150) * [-1039.761] (-1037.726) (-1045.566) (-1039.585) -- 0:01:04
719500 -- (-1045.239) [-1042.841] (-1049.058) (-1038.770) * (-1036.820) [-1047.503] (-1045.593) (-1040.156) -- 0:01:04
720000 -- (-1044.410) (-1041.708) [-1042.531] (-1041.611) * [-1039.016] (-1044.809) (-1038.089) (-1039.316) -- 0:01:04
Average standard deviation of split frequencies: 0.007849
720500 -- [-1043.938] (-1042.596) (-1044.521) (-1040.395) * (-1047.487) (-1046.541) (-1042.607) [-1035.806] -- 0:01:04
721000 -- (-1038.071) (-1042.547) (-1047.882) [-1044.489] * (-1042.324) (-1049.317) [-1036.641] (-1041.253) -- 0:01:04
721500 -- [-1043.752] (-1040.495) (-1042.076) (-1039.756) * [-1041.760] (-1039.680) (-1040.012) (-1042.757) -- 0:01:04
722000 -- (-1036.825) (-1045.331) (-1039.554) [-1041.580] * (-1037.753) (-1040.920) (-1039.359) [-1037.481] -- 0:01:03
722500 -- (-1039.126) (-1057.052) [-1038.646] (-1038.169) * (-1041.182) [-1043.179] (-1043.054) (-1038.766) -- 0:01:03
723000 -- [-1036.579] (-1044.803) (-1041.113) (-1047.978) * [-1042.306] (-1042.687) (-1040.438) (-1041.739) -- 0:01:03
723500 -- (-1038.601) (-1037.363) (-1039.808) [-1036.256] * (-1044.200) (-1040.161) (-1037.740) [-1042.100] -- 0:01:03
724000 -- (-1039.442) [-1037.168] (-1042.180) (-1039.883) * (-1038.491) (-1037.996) (-1036.858) [-1037.722] -- 0:01:03
724500 -- [-1037.172] (-1039.383) (-1038.798) (-1036.756) * [-1043.622] (-1040.474) (-1040.806) (-1044.398) -- 0:01:03
725000 -- [-1039.912] (-1040.928) (-1049.164) (-1040.317) * [-1037.144] (-1043.791) (-1041.947) (-1035.800) -- 0:01:03
Average standard deviation of split frequencies: 0.008070
725500 -- (-1042.774) (-1047.731) [-1042.598] (-1038.458) * [-1037.798] (-1042.317) (-1036.699) (-1044.952) -- 0:01:03
726000 -- [-1042.144] (-1044.108) (-1040.418) (-1042.018) * (-1037.413) (-1040.362) [-1040.352] (-1044.205) -- 0:01:03
726500 -- (-1045.495) [-1038.003] (-1039.326) (-1042.739) * (-1046.675) [-1040.642] (-1036.965) (-1042.340) -- 0:01:02
727000 -- [-1040.416] (-1038.737) (-1047.232) (-1036.840) * (-1042.143) (-1036.831) [-1038.923] (-1044.390) -- 0:01:02
727500 -- (-1044.088) [-1045.503] (-1036.116) (-1039.263) * [-1045.511] (-1045.186) (-1043.379) (-1045.165) -- 0:01:02
728000 -- (-1041.722) [-1037.000] (-1041.493) (-1039.031) * [-1036.176] (-1038.249) (-1042.903) (-1043.241) -- 0:01:02
728500 -- (-1044.198) (-1044.984) [-1042.772] (-1040.133) * (-1039.760) (-1040.558) (-1049.126) [-1043.465] -- 0:01:02
729000 -- (-1038.053) (-1038.391) [-1037.939] (-1052.560) * (-1041.075) (-1037.350) [-1040.128] (-1038.316) -- 0:01:02
729500 -- (-1040.441) (-1035.594) [-1040.984] (-1041.362) * (-1038.605) (-1047.686) [-1041.203] (-1042.552) -- 0:01:02
730000 -- [-1040.944] (-1043.607) (-1038.283) (-1043.723) * (-1036.991) (-1044.405) (-1036.333) [-1039.661] -- 0:01:02
Average standard deviation of split frequencies: 0.008203
730500 -- (-1035.331) [-1046.744] (-1041.946) (-1042.555) * (-1044.484) (-1037.208) (-1043.566) [-1042.183] -- 0:01:01
731000 -- (-1044.561) (-1037.351) (-1042.611) [-1044.791] * (-1036.665) (-1040.202) (-1037.729) [-1049.693] -- 0:01:01
731500 -- (-1046.670) (-1046.498) (-1042.998) [-1045.113] * (-1038.020) [-1037.760] (-1041.050) (-1045.885) -- 0:01:01
732000 -- (-1052.941) (-1039.832) [-1049.385] (-1051.652) * (-1039.642) [-1038.464] (-1054.061) (-1040.738) -- 0:01:01
732500 -- (-1046.424) (-1046.846) (-1045.193) [-1043.475] * (-1045.621) [-1040.255] (-1045.229) (-1048.559) -- 0:01:01
733000 -- [-1042.857] (-1044.231) (-1047.121) (-1039.791) * [-1033.981] (-1038.894) (-1038.670) (-1038.944) -- 0:01:01
733500 -- (-1036.708) (-1038.979) (-1043.975) [-1039.296] * (-1045.941) (-1038.762) (-1046.305) [-1047.390] -- 0:01:01
734000 -- (-1041.407) [-1034.161] (-1038.189) (-1039.582) * (-1041.868) [-1034.635] (-1044.166) (-1054.767) -- 0:01:01
734500 -- (-1043.838) (-1036.590) [-1041.002] (-1040.963) * (-1039.195) [-1038.911] (-1042.381) (-1039.576) -- 0:01:01
735000 -- (-1040.658) (-1033.546) (-1046.279) [-1041.662] * (-1040.846) (-1036.904) [-1039.113] (-1048.460) -- 0:01:00
Average standard deviation of split frequencies: 0.008326
735500 -- (-1042.757) (-1039.245) (-1043.581) [-1037.247] * [-1034.703] (-1042.833) (-1044.886) (-1045.569) -- 0:01:00
736000 -- (-1035.982) (-1038.411) [-1037.042] (-1046.168) * (-1049.273) [-1039.919] (-1034.782) (-1040.516) -- 0:01:00
736500 -- [-1042.734] (-1044.898) (-1047.082) (-1042.409) * (-1040.021) (-1037.514) [-1042.373] (-1049.762) -- 0:01:00
737000 -- (-1040.831) [-1039.532] (-1045.752) (-1046.142) * (-1045.027) (-1043.171) [-1041.210] (-1045.085) -- 0:01:00
737500 -- (-1044.280) (-1040.793) [-1041.327] (-1043.281) * [-1039.130] (-1039.328) (-1040.918) (-1039.746) -- 0:01:00
738000 -- (-1035.847) [-1043.360] (-1037.645) (-1045.376) * (-1041.796) (-1037.058) (-1041.864) [-1042.742] -- 0:01:00
738500 -- (-1045.674) (-1046.498) [-1032.371] (-1037.105) * [-1044.988] (-1040.400) (-1042.792) (-1040.116) -- 0:01:00
739000 -- (-1037.484) (-1041.050) (-1039.930) [-1039.688] * (-1046.742) (-1039.719) (-1039.655) [-1033.022] -- 0:01:00
739500 -- [-1033.382] (-1041.677) (-1039.352) (-1043.158) * (-1044.470) [-1039.981] (-1045.230) (-1041.783) -- 0:00:59
740000 -- [-1045.854] (-1048.061) (-1038.481) (-1042.415) * (-1044.493) [-1038.870] (-1040.761) (-1040.582) -- 0:00:59
Average standard deviation of split frequencies: 0.008456
740500 -- (-1042.520) [-1040.996] (-1036.835) (-1049.722) * [-1042.019] (-1046.984) (-1045.038) (-1037.491) -- 0:00:59
741000 -- (-1038.675) [-1040.924] (-1039.545) (-1038.119) * [-1044.460] (-1041.316) (-1041.653) (-1041.425) -- 0:00:59
741500 -- (-1038.484) (-1038.078) [-1038.394] (-1042.888) * (-1041.716) (-1042.032) [-1039.016] (-1034.465) -- 0:00:59
742000 -- (-1038.753) (-1039.466) [-1042.345] (-1038.123) * [-1039.550] (-1049.191) (-1047.311) (-1035.773) -- 0:00:59
742500 -- (-1047.423) (-1039.000) [-1039.083] (-1039.777) * (-1039.089) [-1036.826] (-1050.900) (-1039.113) -- 0:00:59
743000 -- [-1039.309] (-1045.942) (-1037.111) (-1041.571) * (-1052.394) [-1040.893] (-1051.200) (-1037.841) -- 0:00:59
743500 -- (-1034.162) [-1038.392] (-1046.142) (-1044.906) * [-1045.049] (-1036.393) (-1042.490) (-1040.050) -- 0:00:58
744000 -- (-1037.185) [-1042.118] (-1044.638) (-1042.703) * [-1041.725] (-1046.459) (-1042.654) (-1041.436) -- 0:00:58
744500 -- (-1040.338) (-1049.941) [-1040.294] (-1041.868) * (-1043.095) (-1036.319) (-1040.903) [-1038.047] -- 0:00:58
745000 -- [-1040.235] (-1043.496) (-1039.392) (-1045.901) * (-1044.472) (-1042.829) (-1041.503) [-1040.292] -- 0:00:58
Average standard deviation of split frequencies: 0.007944
745500 -- (-1045.220) (-1037.157) [-1038.649] (-1043.651) * (-1036.849) (-1041.936) [-1044.367] (-1039.221) -- 0:00:58
746000 -- (-1039.401) (-1044.869) [-1039.438] (-1047.363) * (-1038.461) [-1038.375] (-1046.058) (-1048.343) -- 0:00:58
746500 -- (-1034.344) (-1044.510) [-1041.033] (-1050.193) * (-1042.830) [-1043.637] (-1040.624) (-1043.224) -- 0:00:58
747000 -- (-1037.282) (-1048.349) [-1043.595] (-1047.861) * [-1040.306] (-1045.919) (-1048.347) (-1050.919) -- 0:00:58
747500 -- (-1043.070) [-1041.846] (-1052.451) (-1048.105) * (-1043.298) [-1037.675] (-1045.511) (-1042.981) -- 0:00:58
748000 -- (-1040.424) (-1037.615) [-1040.743] (-1036.350) * (-1043.422) (-1045.833) (-1035.957) [-1041.336] -- 0:00:57
748500 -- (-1042.055) (-1044.950) [-1043.634] (-1041.917) * (-1039.265) (-1038.814) (-1037.788) [-1043.329] -- 0:00:57
749000 -- [-1041.663] (-1046.197) (-1046.433) (-1036.430) * (-1039.780) (-1039.528) [-1036.381] (-1041.230) -- 0:00:57
749500 -- [-1041.079] (-1045.008) (-1043.059) (-1040.737) * [-1042.244] (-1045.523) (-1036.669) (-1048.407) -- 0:00:57
750000 -- [-1035.048] (-1043.034) (-1053.267) (-1036.744) * [-1043.008] (-1045.906) (-1036.156) (-1043.818) -- 0:00:57
Average standard deviation of split frequencies: 0.008074
750500 -- (-1034.203) [-1036.547] (-1051.469) (-1037.457) * [-1044.645] (-1042.994) (-1042.332) (-1047.827) -- 0:00:57
751000 -- [-1033.595] (-1040.213) (-1043.138) (-1041.638) * (-1043.764) (-1049.084) (-1040.288) [-1036.385] -- 0:00:57
751500 -- (-1042.394) (-1048.166) [-1042.602] (-1040.634) * (-1041.432) (-1043.912) [-1038.320] (-1034.886) -- 0:00:57
752000 -- (-1040.657) (-1040.050) (-1039.005) [-1040.833] * (-1047.169) (-1042.109) (-1038.170) [-1039.043] -- 0:00:57
752500 -- (-1042.711) [-1038.411] (-1040.095) (-1041.049) * (-1037.348) (-1037.422) (-1039.366) [-1038.918] -- 0:00:56
753000 -- (-1035.861) [-1034.709] (-1041.958) (-1045.333) * [-1043.108] (-1040.338) (-1042.153) (-1041.544) -- 0:00:56
753500 -- (-1045.448) (-1041.405) (-1044.092) [-1040.005] * (-1037.856) (-1044.337) (-1038.244) [-1035.023] -- 0:00:56
754000 -- [-1038.182] (-1047.540) (-1040.773) (-1037.105) * (-1035.874) [-1046.119] (-1038.936) (-1042.717) -- 0:00:56
754500 -- (-1045.035) (-1042.848) (-1039.890) [-1035.604] * (-1039.474) (-1046.974) [-1042.265] (-1045.620) -- 0:00:56
755000 -- (-1045.373) (-1041.432) (-1036.878) [-1040.987] * [-1043.696] (-1040.406) (-1050.616) (-1038.609) -- 0:00:56
Average standard deviation of split frequencies: 0.007572
755500 -- [-1039.613] (-1045.332) (-1038.747) (-1033.171) * [-1037.417] (-1040.455) (-1047.361) (-1040.221) -- 0:00:56
756000 -- (-1043.285) (-1044.036) [-1044.338] (-1045.385) * (-1035.251) (-1047.225) [-1040.673] (-1038.507) -- 0:00:56
756500 -- (-1043.207) (-1037.652) [-1044.544] (-1043.798) * (-1036.967) (-1039.955) (-1040.004) [-1039.246] -- 0:00:56
757000 -- (-1044.669) [-1036.344] (-1039.002) (-1043.273) * (-1037.067) (-1045.315) [-1043.984] (-1048.464) -- 0:00:55
757500 -- (-1050.839) (-1038.291) [-1041.798] (-1043.502) * (-1042.394) (-1039.431) [-1041.895] (-1036.835) -- 0:00:55
758000 -- (-1051.624) (-1039.415) [-1037.792] (-1045.244) * (-1044.929) [-1039.382] (-1042.155) (-1044.732) -- 0:00:55
758500 -- [-1037.685] (-1034.518) (-1037.583) (-1045.600) * (-1039.244) (-1044.774) [-1042.373] (-1045.290) -- 0:00:55
759000 -- (-1041.016) [-1042.260] (-1046.969) (-1040.723) * [-1044.498] (-1040.802) (-1044.256) (-1047.220) -- 0:00:55
759500 -- (-1039.584) [-1042.942] (-1042.755) (-1038.780) * (-1041.273) (-1039.874) [-1036.816] (-1045.034) -- 0:00:55
760000 -- (-1040.441) (-1038.397) (-1042.477) [-1044.056] * (-1043.919) [-1041.549] (-1041.369) (-1045.618) -- 0:00:55
Average standard deviation of split frequencies: 0.007525
760500 -- [-1044.497] (-1038.431) (-1042.667) (-1047.026) * (-1038.183) (-1052.084) [-1037.997] (-1049.955) -- 0:00:55
761000 -- [-1040.130] (-1048.619) (-1049.385) (-1039.999) * [-1041.262] (-1042.578) (-1049.562) (-1045.078) -- 0:00:54
761500 -- (-1040.939) (-1038.755) (-1041.304) [-1042.125] * [-1039.515] (-1040.049) (-1047.031) (-1042.733) -- 0:00:54
762000 -- (-1038.869) (-1037.960) [-1038.255] (-1035.796) * (-1038.378) (-1035.639) [-1041.713] (-1037.361) -- 0:00:54
762500 -- (-1041.031) [-1036.337] (-1041.670) (-1043.916) * (-1044.572) [-1039.385] (-1047.528) (-1042.720) -- 0:00:54
763000 -- (-1047.722) [-1034.490] (-1045.099) (-1038.062) * (-1036.167) (-1040.564) [-1035.749] (-1041.442) -- 0:00:54
763500 -- (-1041.205) [-1041.164] (-1039.834) (-1050.259) * [-1035.779] (-1046.430) (-1039.635) (-1049.350) -- 0:00:54
764000 -- (-1037.654) [-1041.940] (-1045.697) (-1036.361) * (-1041.185) (-1038.228) (-1035.528) [-1041.615] -- 0:00:54
764500 -- (-1040.058) (-1040.507) [-1040.158] (-1038.580) * (-1036.077) (-1037.335) [-1038.797] (-1045.866) -- 0:00:54
765000 -- [-1034.240] (-1041.633) (-1045.337) (-1048.209) * (-1045.729) (-1042.882) (-1034.023) [-1041.032] -- 0:00:54
Average standard deviation of split frequencies: 0.007209
765500 -- (-1044.353) [-1041.702] (-1051.677) (-1035.263) * (-1043.983) (-1048.018) [-1034.687] (-1050.305) -- 0:00:53
766000 -- (-1044.383) (-1043.825) (-1043.711) [-1041.182] * [-1036.326] (-1045.769) (-1041.248) (-1038.674) -- 0:00:53
766500 -- (-1037.852) (-1046.345) (-1051.288) [-1041.514] * (-1045.110) (-1045.190) [-1044.548] (-1041.453) -- 0:00:53
767000 -- (-1048.089) (-1043.633) [-1038.647] (-1045.236) * (-1040.844) (-1040.710) (-1045.619) [-1040.551] -- 0:00:53
767500 -- (-1043.942) (-1045.318) [-1042.181] (-1047.346) * (-1036.659) (-1052.623) [-1039.076] (-1044.563) -- 0:00:53
768000 -- (-1036.121) (-1039.715) (-1044.564) [-1038.313] * (-1041.037) (-1040.399) [-1040.033] (-1045.427) -- 0:00:53
768500 -- (-1036.037) (-1042.403) [-1048.510] (-1038.489) * (-1045.949) (-1049.130) [-1037.407] (-1040.593) -- 0:00:53
769000 -- (-1041.228) (-1040.246) (-1035.491) [-1036.763] * (-1046.872) (-1043.442) [-1039.608] (-1033.897) -- 0:00:53
769500 -- (-1038.491) (-1044.337) [-1042.873] (-1047.750) * (-1044.342) (-1042.404) [-1041.507] (-1039.649) -- 0:00:53
770000 -- [-1034.856] (-1038.305) (-1045.271) (-1040.584) * (-1045.138) (-1047.486) (-1040.184) [-1037.153] -- 0:00:52
Average standard deviation of split frequencies: 0.006903
770500 -- (-1036.545) [-1036.062] (-1044.130) (-1042.934) * (-1036.194) [-1034.164] (-1041.678) (-1044.308) -- 0:00:52
771000 -- (-1032.001) [-1044.234] (-1045.270) (-1040.789) * [-1031.109] (-1041.188) (-1043.897) (-1037.097) -- 0:00:52
771500 -- (-1043.852) (-1048.082) [-1039.345] (-1039.436) * (-1039.312) (-1042.722) (-1041.821) [-1039.159] -- 0:00:52
772000 -- (-1037.907) (-1049.044) [-1044.896] (-1040.812) * (-1048.689) [-1034.976] (-1036.603) (-1038.104) -- 0:00:52
772500 -- [-1038.512] (-1046.446) (-1043.942) (-1037.540) * (-1042.573) [-1039.881] (-1037.735) (-1038.908) -- 0:00:52
773000 -- [-1039.090] (-1043.414) (-1046.404) (-1044.372) * (-1041.571) [-1036.937] (-1046.338) (-1042.218) -- 0:00:52
773500 -- (-1049.609) (-1038.672) (-1053.657) [-1038.400] * (-1039.936) [-1033.731] (-1036.856) (-1042.011) -- 0:00:52
774000 -- [-1039.768] (-1043.323) (-1041.048) (-1037.806) * (-1042.460) (-1036.481) [-1036.097] (-1039.917) -- 0:00:51
774500 -- (-1040.733) [-1043.290] (-1037.136) (-1039.375) * [-1045.078] (-1039.911) (-1039.904) (-1034.486) -- 0:00:51
775000 -- (-1038.310) (-1038.998) [-1034.275] (-1037.539) * [-1040.899] (-1044.959) (-1039.140) (-1044.683) -- 0:00:51
Average standard deviation of split frequencies: 0.006422
775500 -- (-1045.068) [-1043.068] (-1036.113) (-1039.069) * [-1041.083] (-1038.932) (-1039.910) (-1042.687) -- 0:00:51
776000 -- (-1044.166) (-1037.966) (-1043.567) [-1043.267] * (-1039.917) (-1038.885) (-1041.074) [-1039.161] -- 0:00:51
776500 -- [-1038.959] (-1042.785) (-1039.008) (-1038.736) * [-1032.327] (-1039.112) (-1045.989) (-1038.835) -- 0:00:51
777000 -- (-1038.375) (-1044.065) (-1046.651) [-1045.330] * (-1038.513) (-1038.578) [-1046.539] (-1034.945) -- 0:00:51
777500 -- (-1046.131) (-1045.822) [-1045.591] (-1043.052) * (-1042.402) (-1037.758) [-1036.003] (-1042.960) -- 0:00:51
778000 -- [-1043.989] (-1041.038) (-1043.067) (-1037.188) * [-1042.246] (-1036.438) (-1043.763) (-1041.750) -- 0:00:51
778500 -- (-1041.294) (-1048.390) (-1036.156) [-1036.465] * (-1038.523) (-1041.310) [-1038.159] (-1036.476) -- 0:00:50
779000 -- [-1037.014] (-1035.930) (-1047.405) (-1048.189) * (-1043.478) [-1036.906] (-1047.146) (-1039.591) -- 0:00:50
779500 -- (-1045.854) (-1042.093) (-1038.463) [-1041.304] * (-1041.240) (-1040.614) (-1042.979) [-1038.459] -- 0:00:50
780000 -- (-1042.017) [-1036.388] (-1041.057) (-1045.791) * (-1043.394) [-1044.629] (-1045.485) (-1053.642) -- 0:00:50
Average standard deviation of split frequencies: 0.007160
780500 -- (-1037.956) [-1037.710] (-1045.136) (-1036.701) * (-1042.081) [-1038.359] (-1044.833) (-1045.186) -- 0:00:50
781000 -- [-1035.344] (-1051.991) (-1041.665) (-1040.893) * (-1037.605) (-1049.164) (-1041.407) [-1039.911] -- 0:00:50
781500 -- (-1040.345) [-1040.809] (-1038.594) (-1035.323) * [-1035.846] (-1038.649) (-1036.554) (-1040.651) -- 0:00:50
782000 -- (-1039.827) [-1035.181] (-1038.992) (-1048.492) * (-1041.549) [-1047.533] (-1040.493) (-1036.347) -- 0:00:50
782500 -- (-1044.619) (-1050.532) [-1040.213] (-1047.191) * (-1040.120) (-1052.010) [-1037.354] (-1054.010) -- 0:00:50
783000 -- (-1043.478) (-1047.557) [-1046.224] (-1039.905) * (-1040.712) [-1038.630] (-1048.144) (-1041.941) -- 0:00:49
783500 -- [-1041.169] (-1047.612) (-1048.090) (-1045.735) * [-1050.936] (-1046.816) (-1051.123) (-1041.148) -- 0:00:50
784000 -- (-1040.396) [-1043.410] (-1044.539) (-1035.712) * (-1041.267) [-1039.403] (-1048.622) (-1040.468) -- 0:00:49
784500 -- (-1046.212) (-1036.574) (-1049.330) [-1033.911] * [-1037.474] (-1053.272) (-1052.309) (-1036.802) -- 0:00:49
785000 -- (-1039.504) [-1046.514] (-1041.270) (-1043.381) * (-1039.182) (-1042.081) (-1043.917) [-1036.693] -- 0:00:49
Average standard deviation of split frequencies: 0.007283
785500 -- (-1048.544) (-1039.378) [-1039.349] (-1044.270) * (-1040.719) (-1046.780) [-1043.115] (-1049.362) -- 0:00:49
786000 -- (-1041.096) (-1038.933) (-1041.530) [-1048.696] * (-1038.157) [-1041.892] (-1041.696) (-1046.818) -- 0:00:49
786500 -- (-1041.446) (-1037.509) (-1040.498) [-1034.545] * [-1041.637] (-1043.396) (-1043.043) (-1041.904) -- 0:00:49
787000 -- (-1040.512) (-1039.065) (-1038.419) [-1039.454] * (-1039.779) (-1042.204) (-1047.823) [-1033.138] -- 0:00:48
787500 -- [-1042.859] (-1040.762) (-1051.638) (-1044.077) * (-1040.525) (-1049.994) (-1047.962) [-1041.018] -- 0:00:49
788000 -- [-1039.010] (-1048.058) (-1042.625) (-1042.165) * [-1043.911] (-1046.388) (-1038.780) (-1036.455) -- 0:00:48
788500 -- [-1042.012] (-1041.389) (-1042.641) (-1045.757) * (-1041.283) [-1049.936] (-1040.061) (-1041.137) -- 0:00:48
789000 -- (-1041.602) (-1043.756) [-1042.387] (-1041.336) * (-1036.743) (-1044.010) (-1039.290) [-1037.977] -- 0:00:48
789500 -- (-1043.415) (-1047.251) (-1040.972) [-1039.825] * (-1037.671) [-1042.566] (-1037.643) (-1036.630) -- 0:00:48
790000 -- (-1039.320) (-1039.071) (-1035.578) [-1039.826] * (-1041.890) (-1040.161) (-1039.131) [-1043.071] -- 0:00:48
Average standard deviation of split frequencies: 0.006984
790500 -- [-1042.327] (-1040.014) (-1040.911) (-1034.840) * (-1037.522) (-1041.314) [-1041.772] (-1043.470) -- 0:00:48
791000 -- (-1044.981) (-1036.268) (-1041.242) [-1032.460] * (-1040.896) (-1042.174) (-1034.205) [-1039.332] -- 0:00:48
791500 -- (-1039.893) (-1041.537) [-1039.867] (-1042.820) * (-1043.950) (-1042.741) [-1035.012] (-1042.040) -- 0:00:47
792000 -- (-1037.896) (-1044.980) [-1040.941] (-1042.257) * [-1043.723] (-1044.795) (-1042.582) (-1044.302) -- 0:00:48
792500 -- [-1042.965] (-1035.724) (-1046.936) (-1041.762) * (-1042.679) (-1042.750) [-1041.310] (-1037.310) -- 0:00:47
793000 -- (-1042.488) [-1044.106] (-1038.836) (-1041.846) * (-1049.122) (-1045.431) [-1040.195] (-1042.943) -- 0:00:47
793500 -- (-1045.429) (-1041.989) (-1042.098) [-1038.714] * (-1040.909) (-1043.270) (-1043.829) [-1037.770] -- 0:00:47
794000 -- (-1044.268) (-1038.140) [-1042.019] (-1049.215) * (-1043.844) (-1041.076) [-1044.993] (-1043.622) -- 0:00:47
794500 -- (-1048.036) (-1041.457) [-1037.886] (-1042.366) * (-1046.576) (-1041.309) (-1043.550) [-1042.732] -- 0:00:47
795000 -- (-1045.492) (-1033.250) (-1039.279) [-1037.774] * [-1041.275] (-1041.157) (-1042.689) (-1041.286) -- 0:00:47
Average standard deviation of split frequencies: 0.006768
795500 -- (-1049.814) (-1040.573) (-1039.899) [-1039.095] * (-1044.426) (-1047.264) [-1043.437] (-1044.204) -- 0:00:47
796000 -- [-1046.206] (-1040.866) (-1045.418) (-1045.494) * (-1049.237) (-1036.567) [-1040.566] (-1036.048) -- 0:00:47
796500 -- (-1053.239) [-1035.369] (-1044.810) (-1043.037) * (-1040.637) (-1036.763) [-1041.493] (-1044.716) -- 0:00:47
797000 -- (-1045.170) (-1045.851) [-1039.767] (-1046.648) * (-1042.219) [-1049.973] (-1046.564) (-1042.292) -- 0:00:46
797500 -- [-1043.520] (-1040.482) (-1040.517) (-1047.571) * (-1049.998) (-1044.276) (-1039.679) [-1044.259] -- 0:00:46
798000 -- (-1042.990) (-1044.600) (-1042.866) [-1039.114] * (-1043.018) (-1039.281) [-1037.944] (-1034.567) -- 0:00:46
798500 -- (-1043.700) [-1039.106] (-1036.586) (-1040.142) * (-1039.826) [-1034.891] (-1034.301) (-1045.958) -- 0:00:46
799000 -- (-1052.696) (-1042.934) (-1043.102) [-1041.655] * (-1039.684) (-1034.296) (-1038.687) [-1037.699] -- 0:00:46
799500 -- [-1036.172] (-1042.173) (-1046.987) (-1040.005) * (-1036.366) [-1037.723] (-1037.295) (-1037.274) -- 0:00:46
800000 -- [-1036.544] (-1038.402) (-1041.066) (-1048.742) * (-1041.801) (-1039.387) [-1031.984] (-1039.266) -- 0:00:46
Average standard deviation of split frequencies: 0.006561
800500 -- [-1036.458] (-1050.591) (-1040.975) (-1039.442) * (-1041.393) (-1043.573) [-1040.411] (-1045.634) -- 0:00:46
801000 -- (-1037.182) (-1037.204) (-1042.849) [-1046.463] * (-1043.486) [-1042.676] (-1043.239) (-1043.063) -- 0:00:45
801500 -- (-1037.806) [-1036.178] (-1051.828) (-1041.989) * (-1043.051) [-1037.437] (-1045.201) (-1043.590) -- 0:00:45
802000 -- (-1037.539) (-1040.631) (-1045.342) [-1039.022] * (-1043.950) (-1042.594) [-1037.635] (-1045.049) -- 0:00:45
802500 -- [-1040.068] (-1041.426) (-1041.828) (-1052.676) * [-1043.272] (-1048.530) (-1045.790) (-1042.640) -- 0:00:45
803000 -- (-1046.872) [-1036.696] (-1039.060) (-1038.296) * (-1042.737) [-1036.914] (-1043.940) (-1046.342) -- 0:00:45
803500 -- [-1041.471] (-1041.367) (-1044.158) (-1046.328) * (-1045.795) [-1041.605] (-1043.908) (-1036.050) -- 0:00:45
804000 -- (-1039.420) (-1042.232) [-1038.795] (-1036.245) * (-1044.695) (-1037.462) [-1037.382] (-1038.623) -- 0:00:45
804500 -- [-1037.728] (-1043.487) (-1037.967) (-1039.492) * (-1038.944) (-1037.682) (-1050.330) [-1047.648] -- 0:00:44
805000 -- (-1041.271) [-1037.230] (-1045.935) (-1049.845) * [-1037.386] (-1038.912) (-1042.056) (-1038.483) -- 0:00:45
Average standard deviation of split frequencies: 0.006684
805500 -- (-1041.014) (-1036.220) (-1042.569) [-1042.913] * (-1038.850) (-1036.459) [-1046.613] (-1044.853) -- 0:00:44
806000 -- (-1038.486) (-1037.208) (-1041.343) [-1037.801] * (-1040.172) (-1044.377) (-1041.718) [-1039.990] -- 0:00:44
806500 -- (-1039.423) (-1039.030) (-1033.545) [-1036.744] * [-1034.863] (-1050.560) (-1043.307) (-1043.983) -- 0:00:44
807000 -- (-1039.057) (-1040.701) (-1040.181) [-1041.530] * (-1044.023) (-1035.609) (-1040.007) [-1036.605] -- 0:00:44
807500 -- [-1038.000] (-1041.546) (-1044.388) (-1043.901) * (-1036.398) (-1037.059) [-1039.398] (-1039.236) -- 0:00:44
808000 -- (-1043.835) [-1036.705] (-1034.173) (-1046.126) * (-1041.538) (-1046.507) (-1045.203) [-1042.026] -- 0:00:44
808500 -- (-1038.936) [-1033.549] (-1041.314) (-1040.847) * (-1035.240) (-1038.313) [-1037.499] (-1039.423) -- 0:00:44
809000 -- (-1053.146) (-1037.634) (-1038.763) [-1044.971] * (-1042.570) (-1036.194) (-1040.550) [-1039.869] -- 0:00:44
809500 -- (-1038.995) [-1039.572] (-1039.988) (-1047.326) * (-1036.963) [-1035.163] (-1044.858) (-1038.416) -- 0:00:44
810000 -- (-1041.000) [-1035.365] (-1037.749) (-1048.130) * [-1039.466] (-1044.234) (-1047.928) (-1034.913) -- 0:00:43
Average standard deviation of split frequencies: 0.006064
810500 -- (-1036.124) (-1041.712) [-1040.469] (-1038.104) * (-1036.721) (-1045.745) [-1045.612] (-1041.125) -- 0:00:43
811000 -- (-1039.869) [-1043.098] (-1049.010) (-1044.487) * (-1038.129) [-1037.423] (-1054.490) (-1038.608) -- 0:00:43
811500 -- (-1051.056) (-1047.366) (-1041.879) [-1038.621] * [-1038.134] (-1043.027) (-1052.135) (-1043.861) -- 0:00:43
812000 -- (-1036.898) (-1041.903) [-1046.000] (-1039.346) * (-1041.053) (-1037.680) (-1044.347) [-1036.818] -- 0:00:43
812500 -- (-1047.362) (-1035.927) (-1046.367) [-1039.279] * [-1039.218] (-1041.546) (-1041.521) (-1036.305) -- 0:00:43
813000 -- [-1039.136] (-1043.285) (-1043.542) (-1049.833) * (-1048.177) (-1046.896) [-1040.992] (-1044.169) -- 0:00:43
813500 -- (-1039.745) (-1040.017) (-1044.228) [-1038.008] * (-1035.296) [-1048.090] (-1039.274) (-1040.119) -- 0:00:43
814000 -- (-1040.522) [-1036.470] (-1044.485) (-1046.441) * (-1046.571) [-1041.084] (-1037.690) (-1041.148) -- 0:00:42
814500 -- [-1034.961] (-1044.393) (-1038.340) (-1046.106) * (-1042.583) [-1033.788] (-1038.400) (-1044.883) -- 0:00:42
815000 -- (-1049.133) [-1039.370] (-1048.595) (-1046.031) * (-1037.704) (-1045.026) [-1042.163] (-1046.792) -- 0:00:42
Average standard deviation of split frequencies: 0.006025
815500 -- (-1042.904) (-1046.555) [-1040.175] (-1040.834) * (-1038.364) (-1038.636) (-1051.192) [-1033.812] -- 0:00:42
816000 -- (-1042.117) (-1044.515) [-1036.360] (-1041.936) * (-1041.266) [-1048.864] (-1041.508) (-1036.016) -- 0:00:42
816500 -- [-1039.315] (-1040.460) (-1036.214) (-1042.819) * (-1039.221) (-1043.434) (-1036.531) [-1035.717] -- 0:00:42
817000 -- [-1038.802] (-1044.877) (-1038.568) (-1036.303) * (-1049.625) [-1037.156] (-1038.085) (-1036.402) -- 0:00:42
817500 -- (-1046.478) (-1041.658) [-1040.876] (-1053.417) * (-1041.628) [-1036.042] (-1045.062) (-1038.732) -- 0:00:42
818000 -- (-1040.411) [-1045.421] (-1039.844) (-1040.243) * (-1038.893) (-1036.988) [-1043.141] (-1043.454) -- 0:00:42
818500 -- (-1045.402) (-1040.632) (-1042.460) [-1043.016] * (-1047.523) [-1036.926] (-1044.554) (-1037.269) -- 0:00:41
819000 -- (-1043.225) (-1043.861) (-1046.824) [-1038.554] * (-1043.291) (-1050.686) (-1046.793) [-1042.391] -- 0:00:41
819500 -- (-1041.487) (-1051.223) [-1037.318] (-1046.705) * (-1040.162) (-1043.787) [-1047.531] (-1043.619) -- 0:00:41
820000 -- [-1037.438] (-1048.498) (-1037.279) (-1048.485) * [-1040.447] (-1043.610) (-1052.745) (-1035.144) -- 0:00:41
Average standard deviation of split frequencies: 0.005744
820500 -- (-1041.622) (-1046.706) (-1036.275) [-1038.548] * (-1040.558) (-1054.411) (-1049.741) [-1038.286] -- 0:00:41
821000 -- (-1042.531) [-1039.142] (-1039.367) (-1042.537) * [-1037.785] (-1044.285) (-1043.379) (-1041.152) -- 0:00:41
821500 -- (-1046.639) (-1038.813) [-1046.139] (-1039.062) * (-1034.326) [-1040.462] (-1041.100) (-1036.787) -- 0:00:41
822000 -- [-1035.728] (-1046.781) (-1041.707) (-1038.884) * (-1045.103) [-1035.256] (-1040.514) (-1042.358) -- 0:00:41
822500 -- [-1042.499] (-1042.617) (-1044.888) (-1042.748) * [-1042.671] (-1040.189) (-1037.771) (-1042.325) -- 0:00:41
823000 -- (-1036.280) [-1045.628] (-1039.561) (-1045.128) * (-1038.716) [-1040.817] (-1048.767) (-1037.418) -- 0:00:40
823500 -- (-1041.281) [-1035.790] (-1043.633) (-1043.471) * [-1037.553] (-1050.398) (-1042.054) (-1051.730) -- 0:00:40
824000 -- (-1038.242) [-1038.580] (-1049.299) (-1040.937) * [-1040.798] (-1050.933) (-1037.103) (-1037.029) -- 0:00:40
824500 -- (-1046.480) [-1037.481] (-1047.596) (-1048.985) * [-1040.144] (-1038.819) (-1039.379) (-1043.114) -- 0:00:40
825000 -- (-1040.986) (-1040.709) (-1048.496) [-1035.717] * [-1037.042] (-1041.392) (-1041.526) (-1046.412) -- 0:00:40
Average standard deviation of split frequencies: 0.006196
825500 -- (-1040.857) [-1041.642] (-1044.803) (-1041.674) * [-1040.961] (-1045.686) (-1042.058) (-1038.413) -- 0:00:40
826000 -- (-1037.701) (-1040.202) (-1046.778) [-1044.145] * (-1043.444) (-1039.372) (-1046.072) [-1038.514] -- 0:00:40
826500 -- [-1038.347] (-1039.680) (-1037.407) (-1044.326) * (-1043.298) [-1035.962] (-1042.610) (-1037.981) -- 0:00:40
827000 -- (-1046.603) [-1035.650] (-1041.182) (-1046.291) * (-1039.669) (-1037.064) (-1041.917) [-1042.450] -- 0:00:39
827500 -- (-1037.567) (-1037.888) [-1052.735] (-1043.429) * [-1040.414] (-1037.291) (-1042.834) (-1045.568) -- 0:00:39
828000 -- (-1046.558) (-1037.850) (-1042.890) [-1040.357] * (-1043.744) [-1040.596] (-1037.906) (-1042.165) -- 0:00:39
828500 -- (-1043.243) [-1036.302] (-1040.526) (-1037.818) * (-1037.986) (-1034.422) (-1046.065) [-1043.055] -- 0:00:39
829000 -- (-1042.498) (-1041.621) [-1041.963] (-1045.613) * [-1037.858] (-1045.503) (-1041.721) (-1037.954) -- 0:00:39
829500 -- (-1040.554) (-1043.709) [-1037.721] (-1047.703) * [-1036.807] (-1039.570) (-1042.595) (-1039.061) -- 0:00:39
830000 -- [-1038.207] (-1042.742) (-1039.518) (-1045.061) * [-1034.217] (-1037.740) (-1045.217) (-1041.462) -- 0:00:39
Average standard deviation of split frequencies: 0.005837
830500 -- [-1044.362] (-1042.503) (-1044.525) (-1044.212) * (-1041.187) (-1043.369) [-1041.609] (-1037.882) -- 0:00:39
831000 -- [-1041.719] (-1038.616) (-1044.387) (-1042.379) * (-1040.979) [-1036.991] (-1037.154) (-1040.599) -- 0:00:39
831500 -- [-1042.084] (-1048.491) (-1038.172) (-1042.588) * (-1051.688) (-1040.250) (-1039.071) [-1036.058] -- 0:00:38
832000 -- (-1041.622) (-1042.879) [-1040.756] (-1038.642) * (-1040.173) (-1046.783) (-1037.525) [-1042.901] -- 0:00:38
832500 -- (-1042.491) (-1043.973) (-1039.806) [-1039.935] * (-1041.147) [-1041.721] (-1044.375) (-1045.100) -- 0:00:38
833000 -- (-1042.992) (-1037.551) (-1048.498) [-1043.053] * [-1039.007] (-1040.859) (-1042.449) (-1052.451) -- 0:00:38
833500 -- (-1036.810) [-1037.441] (-1045.104) (-1043.298) * (-1045.843) [-1036.961] (-1038.012) (-1056.544) -- 0:00:38
834000 -- (-1048.114) (-1036.972) (-1044.086) [-1039.579] * (-1040.019) (-1040.419) (-1039.823) [-1038.398] -- 0:00:38
834500 -- (-1047.203) (-1047.182) (-1039.880) [-1036.288] * [-1036.980] (-1041.141) (-1041.023) (-1046.847) -- 0:00:38
835000 -- (-1046.666) (-1037.463) (-1040.616) [-1038.533] * (-1041.605) (-1043.911) [-1039.183] (-1038.257) -- 0:00:38
Average standard deviation of split frequencies: 0.005961
835500 -- (-1044.502) (-1038.943) (-1040.363) [-1040.418] * (-1038.617) (-1040.303) (-1042.076) [-1038.364] -- 0:00:37
836000 -- [-1039.912] (-1038.972) (-1044.389) (-1045.036) * (-1042.551) (-1046.254) (-1039.773) [-1040.631] -- 0:00:37
836500 -- [-1040.600] (-1036.058) (-1043.267) (-1042.797) * (-1041.673) (-1040.378) (-1041.748) [-1038.836] -- 0:00:37
837000 -- (-1036.328) (-1053.997) (-1043.070) [-1037.522] * [-1041.566] (-1036.668) (-1039.959) (-1047.909) -- 0:00:37
837500 -- (-1037.295) (-1042.475) (-1041.130) [-1043.069] * (-1038.261) (-1039.857) [-1041.914] (-1041.629) -- 0:00:37
838000 -- (-1044.615) (-1041.994) [-1039.087] (-1044.137) * (-1044.788) (-1039.655) [-1039.307] (-1041.353) -- 0:00:37
838500 -- [-1043.259] (-1043.687) (-1040.073) (-1040.109) * (-1041.250) [-1038.995] (-1040.275) (-1041.101) -- 0:00:37
839000 -- (-1045.727) (-1038.754) (-1038.022) [-1041.105] * (-1043.654) (-1038.729) (-1041.062) [-1037.713] -- 0:00:37
839500 -- (-1046.473) (-1035.642) (-1042.909) [-1037.057] * (-1040.339) (-1045.746) (-1039.575) [-1037.258] -- 0:00:37
840000 -- (-1042.483) [-1041.713] (-1038.953) (-1042.615) * (-1040.816) (-1040.245) [-1034.875] (-1037.607) -- 0:00:36
Average standard deviation of split frequencies: 0.006168
840500 -- [-1043.126] (-1037.049) (-1045.322) (-1041.474) * (-1038.677) (-1044.775) (-1040.769) [-1044.240] -- 0:00:36
841000 -- (-1048.791) (-1038.073) [-1039.122] (-1051.681) * [-1043.348] (-1048.119) (-1033.713) (-1041.665) -- 0:00:36
841500 -- (-1044.179) [-1039.712] (-1053.052) (-1041.135) * (-1042.024) [-1039.585] (-1049.631) (-1042.549) -- 0:00:36
842000 -- (-1044.918) [-1043.240] (-1048.640) (-1040.964) * (-1047.025) (-1035.771) (-1039.028) [-1041.807] -- 0:00:36
842500 -- [-1049.019] (-1040.839) (-1044.422) (-1041.673) * [-1040.291] (-1037.222) (-1053.172) (-1039.642) -- 0:00:36
843000 -- (-1041.608) (-1043.227) (-1039.584) [-1043.492] * (-1041.302) (-1050.643) (-1039.472) [-1036.709] -- 0:00:36
843500 -- (-1036.513) (-1038.309) (-1038.452) [-1040.496] * [-1036.716] (-1038.160) (-1040.327) (-1043.647) -- 0:00:36
844000 -- (-1038.737) (-1038.320) (-1041.478) [-1039.895] * [-1033.447] (-1039.900) (-1037.275) (-1041.560) -- 0:00:36
844500 -- [-1035.819] (-1040.972) (-1041.376) (-1040.256) * [-1035.005] (-1039.176) (-1044.383) (-1046.555) -- 0:00:35
845000 -- [-1039.035] (-1038.898) (-1046.719) (-1044.510) * (-1043.264) (-1044.833) [-1038.375] (-1051.939) -- 0:00:35
Average standard deviation of split frequencies: 0.006209
845500 -- (-1037.802) [-1040.982] (-1046.607) (-1039.306) * [-1039.540] (-1043.096) (-1046.413) (-1043.673) -- 0:00:35
846000 -- [-1039.919] (-1041.365) (-1053.823) (-1039.539) * (-1043.148) (-1040.496) [-1038.049] (-1042.296) -- 0:00:35
846500 -- (-1038.075) (-1044.552) (-1040.752) [-1042.476] * (-1041.227) (-1041.982) [-1039.189] (-1046.238) -- 0:00:35
847000 -- (-1037.467) (-1046.925) (-1037.464) [-1038.526] * (-1039.602) (-1045.404) [-1037.842] (-1040.830) -- 0:00:35
847500 -- (-1042.957) (-1042.092) [-1034.988] (-1045.184) * [-1038.964] (-1038.355) (-1044.737) (-1041.490) -- 0:00:35
848000 -- (-1035.003) (-1041.504) (-1045.526) [-1034.087] * (-1034.902) (-1040.389) [-1052.744] (-1041.254) -- 0:00:35
848500 -- (-1047.413) (-1039.819) [-1038.696] (-1043.119) * (-1040.919) (-1042.627) (-1047.146) [-1037.480] -- 0:00:34
849000 -- [-1035.350] (-1040.127) (-1037.824) (-1040.226) * (-1042.788) (-1039.133) (-1055.196) [-1042.232] -- 0:00:34
849500 -- (-1039.805) (-1043.626) [-1044.788] (-1039.467) * (-1043.126) [-1042.641] (-1039.957) (-1048.314) -- 0:00:34
850000 -- (-1041.681) [-1045.189] (-1039.836) (-1039.272) * (-1040.880) (-1041.233) (-1039.501) [-1041.001] -- 0:00:34
Average standard deviation of split frequencies: 0.005700
850500 -- (-1038.670) [-1034.855] (-1046.567) (-1034.697) * [-1035.830] (-1047.356) (-1044.229) (-1038.950) -- 0:00:34
851000 -- (-1038.981) (-1039.242) (-1050.749) [-1035.162] * (-1040.091) (-1041.521) (-1041.215) [-1039.935] -- 0:00:34
851500 -- [-1036.416] (-1038.618) (-1046.780) (-1039.561) * (-1038.172) [-1036.566] (-1043.038) (-1037.313) -- 0:00:34
852000 -- (-1039.209) (-1043.835) [-1040.585] (-1039.485) * [-1034.602] (-1045.105) (-1044.607) (-1036.762) -- 0:00:34
852500 -- [-1038.807] (-1041.580) (-1038.131) (-1043.260) * [-1037.560] (-1040.802) (-1035.655) (-1043.425) -- 0:00:34
853000 -- (-1043.781) [-1036.468] (-1042.593) (-1042.075) * (-1044.453) (-1045.901) [-1042.712] (-1034.075) -- 0:00:33
853500 -- (-1042.388) (-1037.939) [-1039.980] (-1043.054) * [-1032.204] (-1041.448) (-1038.551) (-1037.758) -- 0:00:33
854000 -- [-1036.357] (-1038.088) (-1039.572) (-1046.169) * [-1036.584] (-1044.348) (-1043.211) (-1034.631) -- 0:00:33
854500 -- (-1038.848) (-1036.088) (-1043.117) [-1043.210] * (-1043.638) (-1052.734) (-1041.853) [-1034.042] -- 0:00:33
855000 -- (-1044.759) [-1031.062] (-1040.073) (-1044.004) * (-1038.142) [-1038.006] (-1035.831) (-1042.901) -- 0:00:33
Average standard deviation of split frequencies: 0.005822
855500 -- [-1035.733] (-1032.155) (-1037.196) (-1041.713) * [-1038.127] (-1041.311) (-1051.506) (-1032.258) -- 0:00:33
856000 -- (-1046.426) (-1045.920) [-1034.845] (-1038.958) * (-1046.273) [-1042.096] (-1034.328) (-1036.391) -- 0:00:33
856500 -- (-1044.600) (-1038.776) (-1037.764) [-1045.051] * (-1041.573) (-1045.037) [-1039.398] (-1039.831) -- 0:00:33
857000 -- (-1042.355) [-1035.046] (-1040.062) (-1042.237) * (-1039.605) (-1043.812) [-1038.739] (-1040.297) -- 0:00:33
857500 -- (-1042.885) [-1040.407] (-1038.760) (-1041.055) * (-1046.149) (-1044.590) [-1036.342] (-1045.982) -- 0:00:32
858000 -- (-1046.196) (-1040.293) (-1041.368) [-1040.233] * [-1038.128] (-1037.052) (-1040.391) (-1051.289) -- 0:00:32
858500 -- (-1045.449) (-1049.562) (-1036.186) [-1041.511] * (-1039.704) (-1040.806) [-1037.642] (-1037.605) -- 0:00:32
859000 -- (-1043.243) (-1046.737) [-1041.560] (-1040.484) * (-1044.138) (-1037.588) (-1036.713) [-1042.549] -- 0:00:32
859500 -- (-1046.683) (-1040.942) [-1041.950] (-1038.068) * [-1042.077] (-1046.907) (-1044.106) (-1045.844) -- 0:00:32
860000 -- (-1044.970) (-1038.078) (-1046.358) [-1035.637] * (-1035.631) [-1038.399] (-1039.974) (-1036.714) -- 0:00:32
Average standard deviation of split frequencies: 0.005712
860500 -- (-1046.047) (-1039.640) (-1044.935) [-1037.979] * (-1048.459) (-1035.675) (-1046.084) [-1037.564] -- 0:00:32
861000 -- [-1045.488] (-1037.861) (-1043.283) (-1037.381) * [-1035.676] (-1044.600) (-1046.537) (-1039.543) -- 0:00:32
861500 -- (-1044.973) [-1035.697] (-1042.789) (-1036.772) * [-1041.671] (-1039.003) (-1039.894) (-1040.604) -- 0:00:31
862000 -- (-1035.566) [-1037.311] (-1039.346) (-1038.707) * [-1041.286] (-1037.934) (-1042.940) (-1038.009) -- 0:00:31
862500 -- (-1045.300) (-1042.349) (-1040.069) [-1042.864] * [-1041.093] (-1044.848) (-1040.456) (-1043.258) -- 0:00:31
863000 -- (-1043.241) (-1037.594) [-1049.724] (-1040.790) * (-1036.613) (-1036.172) [-1044.173] (-1039.169) -- 0:00:31
863500 -- (-1042.997) (-1034.615) [-1040.732] (-1040.656) * [-1042.179] (-1045.458) (-1042.861) (-1037.609) -- 0:00:31
864000 -- (-1033.289) (-1043.166) [-1046.631] (-1045.925) * (-1044.951) [-1036.538] (-1044.846) (-1055.774) -- 0:00:31
864500 -- (-1042.935) (-1043.352) [-1037.345] (-1044.851) * (-1043.097) [-1036.200] (-1038.367) (-1040.922) -- 0:00:31
865000 -- (-1043.537) [-1042.899] (-1041.329) (-1040.359) * (-1039.494) (-1036.351) [-1041.944] (-1043.066) -- 0:00:31
Average standard deviation of split frequencies: 0.006221
865500 -- (-1038.682) [-1038.801] (-1042.977) (-1052.061) * [-1037.001] (-1035.334) (-1047.857) (-1043.287) -- 0:00:31
866000 -- (-1045.172) [-1043.244] (-1041.354) (-1044.622) * [-1038.351] (-1039.915) (-1045.340) (-1047.565) -- 0:00:30
866500 -- (-1044.227) [-1037.426] (-1049.042) (-1043.790) * [-1036.374] (-1042.988) (-1040.085) (-1043.340) -- 0:00:30
867000 -- (-1042.481) (-1040.801) [-1040.278] (-1039.962) * (-1038.317) [-1041.766] (-1038.997) (-1039.746) -- 0:00:30
867500 -- (-1041.723) (-1041.411) [-1043.240] (-1043.217) * [-1038.230] (-1038.449) (-1039.389) (-1047.134) -- 0:00:30
868000 -- [-1043.411] (-1044.790) (-1043.544) (-1039.286) * [-1037.254] (-1045.901) (-1040.202) (-1044.373) -- 0:00:30
868500 -- (-1036.673) (-1039.013) [-1034.388] (-1042.386) * [-1037.057] (-1044.171) (-1038.565) (-1042.388) -- 0:00:30
869000 -- [-1036.971] (-1042.240) (-1041.576) (-1047.104) * (-1042.362) [-1045.368] (-1043.803) (-1040.446) -- 0:00:30
869500 -- (-1036.962) (-1043.030) [-1037.686] (-1049.497) * (-1047.569) (-1046.854) [-1043.591] (-1040.767) -- 0:00:30
870000 -- (-1039.081) (-1040.876) (-1040.987) [-1050.817] * (-1045.101) [-1035.303] (-1036.059) (-1037.911) -- 0:00:30
Average standard deviation of split frequencies: 0.005878
870500 -- (-1038.289) [-1042.885] (-1042.792) (-1037.338) * (-1041.812) (-1037.575) (-1038.959) [-1042.004] -- 0:00:29
871000 -- [-1035.963] (-1042.846) (-1040.596) (-1038.468) * [-1039.843] (-1038.671) (-1040.542) (-1039.527) -- 0:00:29
871500 -- [-1038.655] (-1043.758) (-1047.103) (-1040.047) * [-1041.702] (-1037.961) (-1039.099) (-1044.679) -- 0:00:29
872000 -- [-1040.626] (-1046.199) (-1044.697) (-1052.564) * (-1035.972) (-1036.744) [-1038.920] (-1033.783) -- 0:00:29
872500 -- (-1038.937) (-1053.614) [-1041.290] (-1049.741) * (-1040.355) (-1039.518) (-1041.904) [-1040.245] -- 0:00:29
873000 -- (-1047.427) (-1047.609) (-1046.315) [-1050.352] * [-1043.968] (-1040.430) (-1040.417) (-1051.383) -- 0:00:29
873500 -- [-1038.300] (-1048.797) (-1038.307) (-1042.574) * (-1047.475) [-1038.439] (-1042.832) (-1041.783) -- 0:00:29
874000 -- (-1040.375) (-1049.881) [-1035.242] (-1039.186) * [-1040.999] (-1038.311) (-1039.257) (-1063.180) -- 0:00:29
874500 -- (-1038.043) (-1041.942) (-1042.568) [-1041.025] * [-1046.901] (-1036.951) (-1042.060) (-1050.505) -- 0:00:28
875000 -- (-1051.047) [-1038.973] (-1033.589) (-1041.160) * (-1037.790) [-1042.091] (-1039.733) (-1040.063) -- 0:00:28
Average standard deviation of split frequencies: 0.005766
875500 -- (-1043.856) (-1050.352) [-1038.858] (-1044.243) * (-1045.903) (-1037.952) [-1041.558] (-1040.831) -- 0:00:28
876000 -- [-1043.219] (-1047.843) (-1041.688) (-1045.745) * [-1039.265] (-1037.177) (-1047.335) (-1040.081) -- 0:00:28
876500 -- [-1040.351] (-1040.670) (-1036.556) (-1044.563) * (-1038.515) (-1053.584) (-1042.155) [-1045.619] -- 0:00:28
877000 -- (-1041.741) (-1040.411) [-1043.636] (-1042.964) * [-1041.197] (-1036.128) (-1045.378) (-1041.887) -- 0:00:28
877500 -- (-1043.033) (-1036.929) [-1043.260] (-1045.854) * (-1039.777) (-1040.685) (-1051.380) [-1036.341] -- 0:00:28
878000 -- [-1050.467] (-1043.758) (-1037.337) (-1041.171) * [-1038.016] (-1035.655) (-1035.971) (-1038.321) -- 0:00:28
878500 -- (-1042.339) (-1042.973) (-1047.448) [-1037.526] * (-1040.882) [-1038.405] (-1037.271) (-1039.880) -- 0:00:28
879000 -- (-1050.194) (-1044.475) [-1039.767] (-1038.738) * (-1050.297) (-1039.661) (-1034.702) [-1038.857] -- 0:00:27
879500 -- (-1034.143) [-1036.568] (-1036.012) (-1041.339) * (-1039.370) (-1039.089) [-1044.725] (-1047.233) -- 0:00:27
880000 -- [-1039.048] (-1037.609) (-1042.251) (-1043.773) * (-1042.900) (-1043.457) (-1038.745) [-1041.797] -- 0:00:27
Average standard deviation of split frequencies: 0.006118
880500 -- [-1035.956] (-1045.175) (-1037.407) (-1040.867) * [-1035.749] (-1042.760) (-1044.204) (-1043.631) -- 0:00:27
881000 -- (-1035.509) (-1043.782) [-1041.403] (-1041.980) * (-1045.809) (-1037.767) (-1036.188) [-1036.664] -- 0:00:27
881500 -- [-1040.582] (-1046.718) (-1038.644) (-1040.032) * (-1043.763) (-1042.586) [-1041.492] (-1043.983) -- 0:00:27
882000 -- (-1035.514) (-1051.179) (-1043.538) [-1040.851] * [-1040.471] (-1037.896) (-1039.408) (-1046.001) -- 0:00:27
882500 -- (-1041.835) (-1040.903) (-1046.061) [-1037.396] * (-1035.972) (-1046.620) [-1038.942] (-1037.957) -- 0:00:27
883000 -- (-1043.706) [-1038.978] (-1034.790) (-1042.734) * (-1041.235) (-1038.252) (-1036.547) [-1039.406] -- 0:00:27
883500 -- (-1037.828) (-1047.314) [-1040.078] (-1040.022) * (-1045.918) (-1040.103) [-1034.269] (-1038.886) -- 0:00:26
884000 -- (-1039.596) [-1041.519] (-1049.281) (-1042.477) * (-1038.412) [-1039.160] (-1037.864) (-1037.581) -- 0:00:26
884500 -- (-1040.996) [-1039.600] (-1040.258) (-1034.184) * (-1039.511) [-1037.612] (-1043.496) (-1041.525) -- 0:00:26
885000 -- (-1039.312) (-1032.302) [-1040.264] (-1044.010) * (-1046.916) (-1040.720) (-1047.918) [-1045.262] -- 0:00:26
Average standard deviation of split frequencies: 0.006233
885500 -- [-1035.355] (-1040.916) (-1044.066) (-1042.184) * (-1040.743) [-1040.435] (-1044.661) (-1044.090) -- 0:00:26
886000 -- [-1041.364] (-1039.984) (-1044.292) (-1040.965) * (-1039.840) (-1041.402) [-1044.787] (-1045.174) -- 0:00:26
886500 -- (-1040.710) (-1051.518) [-1037.206] (-1043.118) * (-1034.850) (-1036.988) (-1044.703) [-1038.850] -- 0:00:26
887000 -- (-1042.477) (-1039.657) (-1039.757) [-1039.565] * (-1041.315) (-1046.430) [-1052.494] (-1039.752) -- 0:00:26
887500 -- (-1045.961) [-1035.821] (-1038.708) (-1037.255) * (-1039.268) [-1042.147] (-1040.452) (-1038.512) -- 0:00:25
888000 -- (-1036.774) (-1036.880) [-1036.692] (-1039.836) * (-1036.115) (-1045.162) [-1042.639] (-1037.500) -- 0:00:25
888500 -- (-1040.324) (-1043.196) (-1038.727) [-1039.292] * [-1036.444] (-1045.947) (-1044.694) (-1034.715) -- 0:00:25
889000 -- (-1037.709) (-1041.405) [-1040.641] (-1035.731) * [-1044.639] (-1055.801) (-1043.382) (-1045.169) -- 0:00:25
889500 -- (-1046.679) (-1043.137) (-1042.122) [-1048.814] * (-1044.480) (-1044.293) (-1043.514) [-1046.007] -- 0:00:25
890000 -- (-1044.546) (-1038.039) [-1037.044] (-1039.662) * (-1036.348) (-1054.203) (-1041.429) [-1044.162] -- 0:00:25
Average standard deviation of split frequencies: 0.005746
890500 -- (-1048.979) (-1038.868) (-1038.504) [-1039.042] * (-1035.359) (-1048.990) (-1037.766) [-1043.772] -- 0:00:25
891000 -- (-1042.675) (-1048.504) [-1036.774] (-1040.730) * (-1048.139) (-1042.613) (-1038.413) [-1040.368] -- 0:00:25
891500 -- (-1036.485) (-1041.949) [-1040.831] (-1037.464) * (-1038.762) (-1052.548) (-1040.889) [-1037.150] -- 0:00:25
892000 -- (-1042.337) (-1038.493) (-1044.280) [-1045.565] * (-1051.952) (-1044.401) (-1045.452) [-1038.936] -- 0:00:24
892500 -- (-1039.902) (-1044.517) (-1035.485) [-1041.974] * (-1045.623) (-1036.981) [-1038.559] (-1043.768) -- 0:00:24
893000 -- (-1039.514) (-1043.396) [-1036.585] (-1039.335) * (-1040.000) (-1049.205) (-1042.544) [-1037.417] -- 0:00:24
893500 -- [-1038.716] (-1042.748) (-1038.487) (-1045.180) * (-1040.685) [-1042.862] (-1041.872) (-1033.928) -- 0:00:24
894000 -- [-1041.328] (-1040.380) (-1035.989) (-1045.434) * (-1045.436) [-1039.241] (-1040.270) (-1044.261) -- 0:00:24
894500 -- [-1041.222] (-1040.948) (-1044.180) (-1039.917) * (-1038.692) (-1044.615) [-1040.901] (-1045.004) -- 0:00:24
895000 -- (-1042.198) (-1044.440) (-1041.476) [-1036.303] * (-1041.666) (-1041.707) [-1036.412] (-1043.089) -- 0:00:24
Average standard deviation of split frequencies: 0.006313
895500 -- (-1045.124) (-1044.956) [-1042.036] (-1043.503) * [-1043.470] (-1053.722) (-1041.155) (-1042.904) -- 0:00:24
896000 -- (-1043.156) [-1040.632] (-1053.306) (-1041.663) * (-1037.935) [-1035.847] (-1046.730) (-1034.287) -- 0:00:24
896500 -- [-1037.084] (-1034.974) (-1046.580) (-1041.243) * (-1039.171) (-1044.199) (-1048.269) [-1034.630] -- 0:00:23
897000 -- [-1037.650] (-1035.626) (-1047.999) (-1045.280) * (-1044.675) (-1044.426) [-1045.887] (-1037.132) -- 0:00:23
897500 -- (-1045.394) (-1048.113) (-1043.235) [-1042.376] * (-1041.790) (-1048.563) (-1041.977) [-1037.889] -- 0:00:23
898000 -- [-1038.784] (-1036.708) (-1042.565) (-1037.597) * (-1035.440) (-1044.833) [-1038.230] (-1047.170) -- 0:00:23
898500 -- (-1039.622) (-1047.532) [-1036.049] (-1043.097) * (-1038.846) (-1049.640) [-1039.928] (-1039.910) -- 0:00:23
899000 -- (-1034.978) (-1041.101) [-1035.642] (-1033.742) * (-1045.958) (-1042.843) [-1042.417] (-1044.280) -- 0:00:23
899500 -- (-1043.529) (-1038.339) (-1034.448) [-1047.679] * (-1045.238) (-1041.821) [-1038.770] (-1038.013) -- 0:00:23
900000 -- (-1041.323) [-1037.852] (-1051.924) (-1045.520) * (-1038.661) [-1045.186] (-1043.239) (-1039.836) -- 0:00:23
Average standard deviation of split frequencies: 0.005757
900500 -- (-1042.730) [-1035.476] (-1044.898) (-1047.480) * (-1041.083) [-1040.499] (-1043.312) (-1037.328) -- 0:00:22
901000 -- [-1034.479] (-1040.913) (-1040.254) (-1036.894) * (-1044.386) (-1045.322) (-1049.106) [-1040.030] -- 0:00:22
901500 -- (-1047.075) [-1036.639] (-1040.480) (-1040.828) * (-1042.580) (-1045.810) (-1039.650) [-1040.063] -- 0:00:22
902000 -- [-1039.844] (-1039.062) (-1048.125) (-1036.953) * (-1040.258) [-1037.864] (-1039.470) (-1042.076) -- 0:00:22
902500 -- (-1041.368) [-1036.305] (-1047.180) (-1041.429) * (-1043.354) (-1041.004) (-1041.093) [-1037.252] -- 0:00:22
903000 -- (-1036.027) [-1039.057] (-1040.499) (-1047.429) * [-1044.493] (-1039.481) (-1038.152) (-1039.567) -- 0:00:22
903500 -- (-1042.553) (-1042.460) [-1041.040] (-1033.775) * (-1048.619) (-1040.207) [-1035.999] (-1043.547) -- 0:00:22
904000 -- [-1038.327] (-1040.946) (-1037.543) (-1042.542) * [-1036.678] (-1042.732) (-1039.943) (-1050.296) -- 0:00:22
904500 -- [-1034.445] (-1037.502) (-1044.696) (-1040.421) * [-1037.775] (-1037.249) (-1038.337) (-1037.394) -- 0:00:22
905000 -- (-1039.553) (-1037.459) (-1041.561) [-1039.845] * (-1037.160) (-1042.629) (-1034.470) [-1036.906] -- 0:00:21
Average standard deviation of split frequencies: 0.006169
905500 -- [-1036.026] (-1043.054) (-1037.934) (-1041.710) * (-1042.014) [-1040.366] (-1041.040) (-1048.277) -- 0:00:21
906000 -- (-1044.583) [-1039.473] (-1038.869) (-1036.238) * (-1037.498) [-1043.492] (-1039.094) (-1046.206) -- 0:00:21
906500 -- (-1046.282) (-1046.476) [-1044.690] (-1036.796) * (-1038.684) [-1036.367] (-1042.763) (-1038.093) -- 0:00:21
907000 -- (-1041.279) (-1041.065) (-1037.497) [-1040.750] * (-1034.829) [-1042.221] (-1035.426) (-1036.149) -- 0:00:21
907500 -- (-1045.521) [-1042.127] (-1040.021) (-1042.722) * (-1038.342) (-1040.877) [-1043.701] (-1045.344) -- 0:00:21
908000 -- (-1040.344) [-1041.033] (-1039.307) (-1040.777) * [-1040.976] (-1035.585) (-1042.860) (-1045.637) -- 0:00:21
908500 -- (-1037.882) (-1035.090) [-1037.467] (-1037.466) * [-1037.548] (-1040.429) (-1050.265) (-1039.288) -- 0:00:21
909000 -- (-1044.212) (-1046.475) [-1038.058] (-1043.121) * (-1040.710) [-1045.595] (-1042.022) (-1041.049) -- 0:00:21
909500 -- (-1040.403) (-1040.084) (-1042.498) [-1036.728] * (-1041.039) (-1049.578) [-1047.165] (-1036.884) -- 0:00:20
910000 -- (-1042.271) [-1038.811] (-1045.131) (-1033.726) * (-1039.147) (-1047.038) (-1040.146) [-1037.605] -- 0:00:20
Average standard deviation of split frequencies: 0.006582
910500 -- [-1043.006] (-1036.800) (-1041.392) (-1043.497) * [-1044.574] (-1050.593) (-1039.628) (-1038.726) -- 0:00:20
911000 -- (-1042.656) (-1036.660) [-1035.439] (-1049.397) * [-1034.646] (-1048.214) (-1044.080) (-1040.582) -- 0:00:20
911500 -- (-1036.938) (-1036.961) [-1046.307] (-1040.145) * (-1039.198) (-1048.500) (-1036.279) [-1045.568] -- 0:00:20
912000 -- (-1047.267) [-1037.747] (-1039.515) (-1040.755) * (-1050.891) [-1034.423] (-1035.608) (-1041.716) -- 0:00:20
912500 -- [-1041.944] (-1057.162) (-1034.985) (-1041.847) * (-1045.175) (-1043.326) [-1043.337] (-1046.752) -- 0:00:20
913000 -- (-1041.976) (-1045.589) (-1038.460) [-1037.037] * (-1043.118) [-1039.915] (-1043.308) (-1047.538) -- 0:00:20
913500 -- (-1039.497) (-1040.446) (-1040.435) [-1037.547] * (-1043.062) (-1039.090) (-1041.663) [-1046.663] -- 0:00:19
914000 -- [-1037.673] (-1043.543) (-1045.491) (-1042.022) * (-1039.532) (-1036.845) [-1040.298] (-1044.467) -- 0:00:19
914500 -- [-1035.031] (-1045.827) (-1037.609) (-1038.044) * (-1043.049) (-1040.804) (-1043.699) [-1041.824] -- 0:00:19
915000 -- (-1036.706) (-1044.759) (-1047.659) [-1037.386] * [-1043.873] (-1039.744) (-1035.191) (-1041.616) -- 0:00:19
Average standard deviation of split frequencies: 0.006470
915500 -- (-1044.334) (-1037.002) [-1037.098] (-1040.636) * (-1041.106) (-1041.913) [-1034.106] (-1045.259) -- 0:00:19
916000 -- (-1041.991) (-1047.572) [-1045.326] (-1036.935) * (-1044.027) [-1037.073] (-1038.590) (-1048.369) -- 0:00:19
916500 -- (-1045.382) [-1039.501] (-1036.902) (-1048.079) * (-1040.181) (-1047.420) [-1038.041] (-1045.015) -- 0:00:19
917000 -- [-1033.875] (-1042.378) (-1037.374) (-1038.683) * (-1046.052) (-1037.699) (-1037.454) [-1038.783] -- 0:00:19
917500 -- [-1038.818] (-1041.387) (-1051.071) (-1041.915) * (-1038.397) (-1041.617) (-1043.968) [-1038.862] -- 0:00:19
918000 -- (-1039.882) (-1040.388) [-1033.792] (-1044.135) * (-1038.836) [-1042.829] (-1034.803) (-1036.787) -- 0:00:18
918500 -- (-1042.476) [-1044.045] (-1042.767) (-1037.304) * (-1038.956) (-1038.296) [-1041.614] (-1036.143) -- 0:00:18
919000 -- (-1043.943) (-1032.378) [-1042.327] (-1041.662) * (-1039.124) (-1047.034) [-1037.894] (-1041.758) -- 0:00:18
919500 -- (-1037.639) [-1038.952] (-1039.457) (-1044.637) * (-1040.485) [-1045.512] (-1042.693) (-1041.013) -- 0:00:18
920000 -- [-1038.505] (-1049.957) (-1039.967) (-1041.852) * [-1042.688] (-1045.865) (-1039.439) (-1041.830) -- 0:00:18
Average standard deviation of split frequencies: 0.006364
920500 -- (-1045.486) [-1047.108] (-1041.682) (-1041.298) * (-1040.127) (-1041.286) (-1044.113) [-1049.406] -- 0:00:18
921000 -- (-1036.009) (-1044.559) [-1036.174] (-1048.650) * (-1043.562) (-1038.173) (-1050.221) [-1037.863] -- 0:00:18
921500 -- (-1040.798) (-1044.474) [-1043.542] (-1043.890) * (-1038.439) (-1039.681) [-1036.767] (-1039.401) -- 0:00:18
922000 -- (-1039.755) [-1044.458] (-1042.542) (-1046.637) * (-1044.753) [-1039.379] (-1037.101) (-1035.300) -- 0:00:18
922500 -- [-1039.666] (-1043.824) (-1043.045) (-1043.993) * (-1040.041) (-1039.361) [-1038.615] (-1038.571) -- 0:00:17
923000 -- [-1037.128] (-1045.891) (-1042.319) (-1042.738) * (-1044.718) (-1043.039) (-1035.174) [-1039.449] -- 0:00:17
923500 -- (-1039.570) [-1036.495] (-1040.944) (-1049.119) * (-1042.609) (-1037.680) [-1039.376] (-1040.838) -- 0:00:17
924000 -- (-1041.249) [-1039.588] (-1044.804) (-1043.795) * [-1041.823] (-1041.662) (-1049.276) (-1042.223) -- 0:00:17
924500 -- (-1042.897) (-1047.011) [-1039.007] (-1047.351) * (-1042.652) (-1046.761) [-1042.579] (-1038.689) -- 0:00:17
925000 -- [-1041.218] (-1040.726) (-1040.884) (-1045.817) * (-1036.975) [-1038.079] (-1039.519) (-1048.544) -- 0:00:17
Average standard deviation of split frequencies: 0.007200
925500 -- (-1035.201) (-1045.126) [-1042.673] (-1041.706) * (-1045.890) [-1034.229] (-1034.291) (-1047.294) -- 0:00:17
926000 -- (-1045.346) (-1040.577) (-1046.254) [-1040.375] * (-1043.424) (-1042.213) (-1037.005) [-1044.829] -- 0:00:17
926500 -- (-1047.506) (-1046.864) [-1041.943] (-1041.262) * (-1045.698) (-1043.825) (-1040.050) [-1039.205] -- 0:00:16
927000 -- [-1043.719] (-1050.623) (-1038.376) (-1041.917) * (-1039.238) [-1042.418] (-1041.815) (-1045.717) -- 0:00:16
927500 -- [-1042.691] (-1038.998) (-1038.995) (-1037.714) * [-1040.744] (-1042.993) (-1045.066) (-1052.181) -- 0:00:16
928000 -- (-1041.455) [-1037.689] (-1038.927) (-1040.649) * [-1040.514] (-1043.878) (-1046.665) (-1044.009) -- 0:00:16
928500 -- (-1043.761) (-1041.683) (-1043.116) [-1036.718] * (-1041.217) [-1038.742] (-1041.524) (-1041.445) -- 0:00:16
929000 -- (-1037.994) (-1036.344) [-1039.865] (-1039.056) * (-1041.530) [-1036.221] (-1043.277) (-1039.277) -- 0:00:16
929500 -- [-1036.389] (-1046.496) (-1037.305) (-1039.379) * [-1036.075] (-1039.654) (-1036.459) (-1037.619) -- 0:00:16
930000 -- (-1047.742) (-1045.081) [-1037.175] (-1047.309) * (-1037.100) (-1046.884) [-1040.482] (-1039.978) -- 0:00:16
Average standard deviation of split frequencies: 0.007670
930500 -- (-1044.180) (-1052.840) [-1039.465] (-1042.332) * [-1041.089] (-1049.977) (-1042.540) (-1042.394) -- 0:00:16
931000 -- [-1039.847] (-1042.677) (-1044.699) (-1040.456) * (-1040.482) [-1037.203] (-1040.596) (-1040.764) -- 0:00:15
931500 -- (-1040.077) (-1047.802) [-1036.334] (-1043.323) * (-1036.946) [-1036.161] (-1035.557) (-1038.601) -- 0:00:15
932000 -- [-1045.989] (-1037.059) (-1039.010) (-1040.350) * (-1058.532) [-1041.049] (-1038.841) (-1047.642) -- 0:00:15
932500 -- (-1047.657) [-1035.348] (-1039.732) (-1049.183) * [-1034.577] (-1040.689) (-1036.569) (-1041.622) -- 0:00:15
933000 -- (-1039.346) (-1034.449) [-1043.989] (-1039.770) * (-1046.363) (-1039.456) [-1036.439] (-1039.288) -- 0:00:15
933500 -- (-1044.444) [-1039.181] (-1039.381) (-1038.134) * (-1040.446) [-1036.657] (-1039.519) (-1042.209) -- 0:00:15
934000 -- (-1040.462) [-1043.935] (-1037.921) (-1037.153) * (-1040.602) [-1035.710] (-1045.140) (-1048.342) -- 0:00:15
934500 -- (-1039.881) [-1043.618] (-1037.281) (-1039.748) * (-1045.898) [-1039.772] (-1041.515) (-1038.408) -- 0:00:15
935000 -- (-1038.235) [-1040.467] (-1039.702) (-1037.620) * (-1042.904) (-1035.833) [-1041.927] (-1037.701) -- 0:00:15
Average standard deviation of split frequencies: 0.007986
935500 -- (-1040.974) (-1045.157) (-1038.138) [-1040.929] * (-1039.306) (-1040.195) [-1036.804] (-1040.708) -- 0:00:14
936000 -- (-1035.219) (-1038.282) (-1042.567) [-1033.908] * (-1037.028) [-1045.618] (-1034.397) (-1040.528) -- 0:00:14
936500 -- (-1045.019) (-1047.001) [-1038.139] (-1041.654) * (-1041.446) (-1035.153) (-1047.806) [-1040.728] -- 0:00:14
937000 -- [-1038.311] (-1039.259) (-1052.987) (-1041.738) * (-1045.664) (-1052.133) [-1037.128] (-1043.767) -- 0:00:14
937500 -- (-1047.465) (-1039.118) (-1039.182) [-1036.192] * (-1038.973) (-1038.370) [-1036.679] (-1041.875) -- 0:00:14
938000 -- (-1041.833) [-1037.611] (-1040.880) (-1040.538) * (-1037.974) (-1043.399) [-1035.864] (-1037.406) -- 0:00:14
938500 -- (-1039.429) [-1033.773] (-1045.178) (-1038.769) * (-1040.514) (-1037.184) (-1036.657) [-1038.167] -- 0:00:14
939000 -- (-1040.146) [-1040.628] (-1046.859) (-1036.939) * (-1036.413) (-1038.824) [-1040.983] (-1051.340) -- 0:00:14
939500 -- [-1039.588] (-1032.392) (-1039.497) (-1042.308) * (-1038.833) (-1043.603) (-1040.230) [-1045.414] -- 0:00:13
940000 -- [-1034.599] (-1038.991) (-1041.873) (-1040.450) * (-1038.375) (-1039.434) (-1047.622) [-1034.286] -- 0:00:13
Average standard deviation of split frequencies: 0.008161
940500 -- [-1038.618] (-1041.964) (-1034.667) (-1039.225) * (-1037.963) [-1039.943] (-1049.871) (-1047.385) -- 0:00:13
941000 -- (-1044.041) (-1041.378) [-1042.152] (-1037.271) * (-1036.934) (-1049.574) [-1038.712] (-1039.119) -- 0:00:13
941500 -- (-1037.322) [-1036.943] (-1035.058) (-1042.745) * (-1040.901) (-1044.614) (-1035.690) [-1038.611] -- 0:00:13
942000 -- (-1039.696) [-1032.990] (-1049.170) (-1048.522) * (-1042.355) (-1038.968) (-1043.683) [-1042.026] -- 0:00:13
942500 -- (-1042.243) (-1036.223) (-1037.622) [-1040.284] * (-1039.190) (-1043.793) [-1039.254] (-1037.047) -- 0:00:13
943000 -- [-1037.823] (-1040.972) (-1037.897) (-1040.416) * (-1045.264) (-1040.359) (-1036.064) [-1036.343] -- 0:00:13
943500 -- (-1038.126) (-1037.523) [-1044.995] (-1040.463) * (-1039.898) (-1037.480) (-1044.877) [-1037.632] -- 0:00:13
944000 -- (-1038.746) (-1037.069) [-1039.903] (-1045.421) * [-1039.372] (-1046.786) (-1041.630) (-1041.676) -- 0:00:12
944500 -- (-1040.204) (-1043.725) (-1048.979) [-1038.136] * [-1040.320] (-1039.860) (-1044.681) (-1041.808) -- 0:00:12
945000 -- (-1040.507) (-1037.566) (-1036.821) [-1033.956] * [-1043.307] (-1034.966) (-1041.175) (-1035.197) -- 0:00:12
Average standard deviation of split frequencies: 0.008258
945500 -- (-1038.446) (-1040.899) [-1045.631] (-1039.624) * (-1047.591) [-1036.785] (-1042.864) (-1044.718) -- 0:00:12
946000 -- [-1034.478] (-1042.887) (-1044.523) (-1045.107) * (-1039.905) [-1041.244] (-1042.781) (-1034.537) -- 0:00:12
946500 -- (-1043.151) [-1038.952] (-1042.838) (-1042.880) * (-1039.499) [-1037.585] (-1035.230) (-1040.496) -- 0:00:12
947000 -- [-1043.432] (-1042.592) (-1040.640) (-1037.412) * [-1042.385] (-1042.579) (-1036.591) (-1045.969) -- 0:00:12
947500 -- (-1043.966) [-1036.621] (-1041.031) (-1042.476) * (-1039.128) (-1037.557) [-1037.293] (-1042.276) -- 0:00:12
948000 -- (-1040.437) [-1034.247] (-1046.663) (-1041.596) * (-1038.434) (-1042.323) (-1038.135) [-1040.499] -- 0:00:12
948500 -- [-1035.737] (-1044.230) (-1047.090) (-1039.541) * (-1048.276) (-1044.114) [-1047.314] (-1038.108) -- 0:00:11
949000 -- [-1038.333] (-1037.721) (-1047.625) (-1041.099) * (-1038.560) (-1043.060) (-1042.825) [-1034.803] -- 0:00:11
949500 -- (-1040.407) [-1038.893] (-1044.410) (-1042.443) * (-1052.777) (-1042.360) [-1039.160] (-1037.890) -- 0:00:11
950000 -- (-1043.484) (-1037.954) [-1040.321] (-1047.228) * (-1036.326) [-1038.194] (-1038.509) (-1036.081) -- 0:00:11
Average standard deviation of split frequencies: 0.007934
950500 -- (-1041.444) (-1039.822) [-1043.551] (-1046.226) * (-1047.869) [-1038.152] (-1041.605) (-1043.841) -- 0:00:11
951000 -- (-1043.672) (-1043.233) [-1045.155] (-1036.437) * (-1035.007) (-1042.002) (-1039.060) [-1039.836] -- 0:00:11
951500 -- (-1046.529) (-1042.073) (-1048.545) [-1040.533] * (-1045.382) [-1042.639] (-1040.255) (-1042.620) -- 0:00:11
952000 -- (-1045.133) (-1043.283) (-1041.522) [-1040.676] * (-1040.868) (-1038.862) [-1039.011] (-1045.777) -- 0:00:11
952500 -- [-1043.233] (-1045.058) (-1039.016) (-1049.734) * (-1044.953) [-1045.281] (-1050.729) (-1043.490) -- 0:00:10
953000 -- (-1039.650) [-1034.573] (-1038.157) (-1043.217) * (-1036.359) [-1039.884] (-1039.888) (-1040.460) -- 0:00:10
953500 -- (-1043.048) (-1032.902) (-1045.016) [-1038.032] * (-1050.413) (-1035.528) (-1036.158) [-1040.358] -- 0:00:10
954000 -- (-1039.721) (-1045.909) [-1041.315] (-1040.674) * (-1034.905) [-1045.234] (-1040.540) (-1043.698) -- 0:00:10
954500 -- (-1037.782) (-1046.746) (-1046.189) [-1043.383] * (-1041.426) (-1041.619) [-1041.085] (-1037.056) -- 0:00:10
955000 -- (-1043.251) (-1042.823) (-1043.003) [-1038.963] * [-1042.348] (-1044.400) (-1048.542) (-1041.332) -- 0:00:10
Average standard deviation of split frequencies: 0.007608
955500 -- (-1040.618) [-1037.493] (-1040.197) (-1040.088) * (-1048.936) (-1041.715) [-1052.108] (-1040.120) -- 0:00:10
956000 -- (-1043.009) (-1040.569) (-1036.535) [-1039.411] * [-1035.694] (-1037.423) (-1038.311) (-1038.288) -- 0:00:10
956500 -- (-1042.195) (-1046.016) [-1037.539] (-1049.040) * [-1038.613] (-1049.977) (-1047.779) (-1040.037) -- 0:00:10
957000 -- (-1034.063) (-1041.523) [-1033.324] (-1038.317) * (-1040.128) (-1041.341) [-1041.398] (-1048.608) -- 0:00:09
957500 -- (-1041.172) (-1044.323) (-1039.895) [-1044.221] * (-1039.216) (-1045.512) (-1046.112) [-1040.687] -- 0:00:09
958000 -- (-1045.182) (-1044.537) [-1038.392] (-1043.453) * (-1049.635) [-1039.091] (-1041.672) (-1042.098) -- 0:00:09
958500 -- (-1049.094) (-1041.270) (-1036.902) [-1043.993] * (-1052.955) (-1036.293) [-1041.372] (-1048.575) -- 0:00:09
959000 -- [-1037.201] (-1044.254) (-1034.896) (-1039.236) * (-1043.571) (-1038.140) [-1038.864] (-1045.462) -- 0:00:09
959500 -- (-1038.847) (-1033.774) [-1042.217] (-1040.435) * (-1035.747) (-1035.766) [-1039.737] (-1039.749) -- 0:00:09
960000 -- (-1039.160) (-1038.920) (-1042.520) [-1035.803] * (-1043.286) [-1038.577] (-1048.582) (-1047.185) -- 0:00:09
Average standard deviation of split frequencies: 0.007431
960500 -- (-1037.748) (-1040.789) [-1036.408] (-1035.512) * (-1048.049) [-1038.926] (-1039.394) (-1036.559) -- 0:00:09
961000 -- (-1037.909) (-1048.869) (-1034.855) [-1034.242] * (-1053.826) (-1036.228) [-1040.643] (-1040.572) -- 0:00:09
961500 -- (-1043.844) [-1038.849] (-1044.765) (-1041.815) * (-1043.109) (-1041.893) (-1038.337) [-1039.091] -- 0:00:08
962000 -- [-1040.651] (-1038.152) (-1049.628) (-1034.253) * [-1038.577] (-1039.200) (-1043.047) (-1043.078) -- 0:00:08
962500 -- (-1043.928) (-1039.491) [-1037.507] (-1040.445) * [-1036.138] (-1042.748) (-1039.264) (-1040.680) -- 0:00:08
963000 -- [-1039.115] (-1047.230) (-1048.216) (-1041.656) * (-1049.957) (-1039.086) [-1044.654] (-1036.504) -- 0:00:08
963500 -- (-1041.088) [-1036.888] (-1039.004) (-1051.186) * [-1039.350] (-1042.064) (-1043.464) (-1039.617) -- 0:00:08
964000 -- (-1040.732) (-1037.909) [-1038.730] (-1044.829) * [-1038.838] (-1039.342) (-1045.508) (-1037.673) -- 0:00:08
964500 -- (-1046.701) [-1035.383] (-1038.848) (-1044.608) * (-1039.261) [-1035.015] (-1049.329) (-1037.027) -- 0:00:08
965000 -- (-1044.490) (-1039.333) (-1040.250) [-1044.472] * (-1037.715) (-1040.620) [-1038.466] (-1051.177) -- 0:00:08
Average standard deviation of split frequencies: 0.007669
965500 -- [-1036.907] (-1037.624) (-1041.567) (-1049.122) * (-1040.233) (-1048.071) [-1036.759] (-1041.128) -- 0:00:07
966000 -- [-1038.457] (-1037.028) (-1047.875) (-1047.910) * [-1043.824] (-1037.635) (-1044.264) (-1036.839) -- 0:00:07
966500 -- (-1042.378) (-1034.724) [-1038.904] (-1041.942) * (-1044.162) (-1042.922) (-1038.839) [-1036.405] -- 0:00:07
967000 -- [-1034.961] (-1043.615) (-1042.741) (-1044.491) * (-1036.575) [-1039.527] (-1045.390) (-1047.509) -- 0:00:07
967500 -- (-1036.876) (-1040.783) [-1038.647] (-1041.303) * [-1035.714] (-1048.199) (-1040.426) (-1039.488) -- 0:00:07
968000 -- (-1041.362) [-1040.356] (-1041.040) (-1056.752) * (-1043.986) (-1050.830) (-1050.488) [-1040.103] -- 0:00:07
968500 -- (-1052.955) (-1042.173) [-1042.394] (-1051.301) * (-1039.507) (-1055.209) (-1041.738) [-1035.552] -- 0:00:07
969000 -- (-1038.362) (-1038.259) (-1040.352) [-1047.519] * [-1035.350] (-1047.392) (-1041.587) (-1032.808) -- 0:00:07
969500 -- [-1043.682] (-1044.428) (-1046.582) (-1049.626) * [-1042.540] (-1046.252) (-1047.853) (-1036.517) -- 0:00:07
970000 -- [-1045.200] (-1051.844) (-1033.089) (-1053.595) * (-1039.831) (-1042.236) (-1036.709) [-1038.337] -- 0:00:06
Average standard deviation of split frequencies: 0.008048
970500 -- (-1040.504) (-1040.685) (-1041.457) [-1042.075] * [-1038.038] (-1041.031) (-1048.734) (-1041.226) -- 0:00:06
971000 -- (-1045.243) (-1045.737) [-1044.657] (-1047.012) * (-1033.675) (-1036.456) [-1045.902] (-1040.663) -- 0:00:06
971500 -- (-1043.218) [-1037.486] (-1041.241) (-1042.857) * (-1039.799) (-1036.628) [-1039.163] (-1046.839) -- 0:00:06
972000 -- (-1045.998) [-1038.393] (-1039.990) (-1045.659) * [-1035.536] (-1041.736) (-1035.543) (-1043.781) -- 0:00:06
972500 -- (-1042.364) (-1044.275) [-1042.486] (-1044.063) * (-1038.374) (-1041.909) (-1044.172) [-1044.193] -- 0:00:06
973000 -- (-1043.403) (-1045.536) (-1038.013) [-1037.075] * (-1041.526) (-1048.187) [-1034.731] (-1039.656) -- 0:00:06
973500 -- (-1036.904) (-1046.265) [-1040.501] (-1036.560) * (-1042.880) (-1047.676) (-1043.189) [-1047.576] -- 0:00:06
974000 -- [-1041.389] (-1049.272) (-1041.769) (-1039.221) * [-1038.943] (-1040.516) (-1042.362) (-1047.137) -- 0:00:06
974500 -- (-1036.673) (-1044.246) (-1042.000) [-1035.675] * [-1039.088] (-1039.421) (-1039.594) (-1046.830) -- 0:00:05
975000 -- (-1044.176) (-1036.100) [-1038.432] (-1041.147) * [-1041.902] (-1033.409) (-1040.404) (-1040.386) -- 0:00:05
Average standard deviation of split frequencies: 0.008004
975500 -- (-1042.448) [-1043.824] (-1044.880) (-1045.990) * (-1040.334) (-1040.810) [-1041.560] (-1037.009) -- 0:00:05
976000 -- [-1038.026] (-1041.712) (-1035.122) (-1041.928) * (-1042.132) [-1039.976] (-1041.543) (-1040.812) -- 0:00:05
976500 -- [-1038.121] (-1040.524) (-1040.505) (-1042.765) * (-1047.188) (-1039.056) (-1050.553) [-1035.623] -- 0:00:05
977000 -- (-1040.488) [-1042.612] (-1038.485) (-1040.489) * (-1047.343) (-1038.756) (-1047.095) [-1039.901] -- 0:00:05
977500 -- (-1035.972) (-1042.695) (-1040.333) [-1037.912] * (-1043.118) (-1049.509) (-1040.395) [-1037.345] -- 0:00:05
978000 -- (-1045.343) [-1039.036] (-1044.317) (-1036.674) * (-1035.114) [-1040.224] (-1039.109) (-1037.890) -- 0:00:05
978500 -- (-1044.739) [-1041.386] (-1037.914) (-1037.583) * (-1038.519) [-1039.219] (-1041.385) (-1041.326) -- 0:00:04
979000 -- (-1046.781) (-1038.984) (-1042.821) [-1039.150] * (-1047.565) (-1037.632) (-1041.703) [-1049.768] -- 0:00:04
979500 -- (-1046.807) (-1042.645) (-1036.666) [-1039.244] * (-1040.566) (-1045.993) [-1036.472] (-1036.652) -- 0:00:04
980000 -- (-1042.956) [-1043.734] (-1036.357) (-1044.105) * (-1041.000) (-1035.602) [-1043.169] (-1041.928) -- 0:00:04
Average standard deviation of split frequencies: 0.007622
980500 -- (-1041.914) [-1042.538] (-1044.160) (-1040.601) * (-1042.578) (-1050.387) [-1044.459] (-1047.345) -- 0:00:04
981000 -- (-1042.304) (-1041.724) (-1040.718) [-1037.239] * [-1040.180] (-1040.205) (-1038.481) (-1047.991) -- 0:00:04
981500 -- [-1042.922] (-1046.775) (-1039.030) (-1043.862) * (-1041.033) (-1038.231) (-1038.850) [-1041.226] -- 0:00:04
982000 -- (-1043.542) [-1039.490] (-1046.339) (-1039.716) * [-1043.230] (-1038.531) (-1054.811) (-1042.599) -- 0:00:04
982500 -- [-1047.931] (-1034.077) (-1042.145) (-1040.021) * (-1040.328) [-1039.268] (-1035.365) (-1038.053) -- 0:00:04
983000 -- (-1045.779) (-1044.080) [-1038.853] (-1039.872) * (-1040.948) [-1036.181] (-1039.225) (-1037.909) -- 0:00:03
983500 -- (-1053.468) (-1039.859) (-1043.216) [-1036.585] * (-1045.082) [-1040.338] (-1041.409) (-1043.662) -- 0:00:03
984000 -- (-1048.240) (-1040.537) [-1037.149] (-1041.149) * (-1047.140) (-1041.744) [-1044.795] (-1042.790) -- 0:00:03
984500 -- (-1043.299) (-1037.960) (-1040.027) [-1035.286] * (-1049.816) (-1041.179) [-1038.557] (-1048.014) -- 0:00:03
985000 -- (-1049.696) (-1039.399) [-1038.239] (-1048.888) * (-1040.947) (-1039.508) [-1038.535] (-1041.936) -- 0:00:03
Average standard deviation of split frequencies: 0.007513
985500 -- (-1043.519) [-1034.819] (-1038.847) (-1043.697) * (-1043.018) (-1040.661) (-1039.850) [-1042.014] -- 0:00:03
986000 -- (-1040.262) (-1038.563) (-1040.045) [-1040.551] * [-1048.282] (-1040.553) (-1041.742) (-1042.692) -- 0:00:03
986500 -- (-1036.450) (-1040.803) (-1042.114) [-1039.686] * (-1043.936) (-1034.047) [-1037.728] (-1042.541) -- 0:00:03
987000 -- (-1041.988) [-1038.644] (-1047.177) (-1035.941) * (-1042.367) (-1040.834) [-1038.410] (-1033.817) -- 0:00:03
987500 -- (-1046.455) [-1045.853] (-1038.836) (-1045.794) * (-1037.615) (-1043.036) (-1041.425) [-1039.718] -- 0:00:02
988000 -- (-1045.512) [-1038.511] (-1038.849) (-1048.699) * [-1039.333] (-1039.856) (-1038.016) (-1050.125) -- 0:00:02
988500 -- [-1034.061] (-1044.585) (-1046.118) (-1042.051) * [-1036.418] (-1047.920) (-1040.342) (-1042.066) -- 0:00:02
989000 -- [-1038.654] (-1045.773) (-1042.395) (-1041.951) * (-1036.145) (-1040.340) (-1042.719) [-1034.692] -- 0:00:02
989500 -- (-1040.388) (-1042.507) [-1041.312] (-1039.827) * (-1042.769) (-1038.492) (-1040.015) [-1037.324] -- 0:00:02
990000 -- (-1043.878) (-1040.152) [-1038.859] (-1045.304) * (-1038.694) (-1038.961) (-1042.796) [-1036.678] -- 0:00:02
Average standard deviation of split frequencies: 0.006730
990500 -- (-1040.920) (-1036.276) [-1037.318] (-1052.068) * [-1037.374] (-1039.140) (-1034.822) (-1038.662) -- 0:00:02
991000 -- (-1041.580) [-1034.706] (-1038.921) (-1051.977) * (-1041.531) [-1044.004] (-1041.872) (-1047.995) -- 0:00:02
991500 -- (-1040.208) [-1038.011] (-1038.103) (-1045.301) * (-1043.015) (-1039.949) (-1035.794) [-1038.674] -- 0:00:01
992000 -- [-1036.164] (-1041.886) (-1042.011) (-1038.513) * (-1041.183) [-1041.461] (-1039.243) (-1045.108) -- 0:00:01
992500 -- [-1037.311] (-1041.733) (-1044.862) (-1042.217) * (-1037.614) [-1035.363] (-1041.578) (-1042.047) -- 0:00:01
993000 -- (-1039.650) (-1039.681) (-1043.581) [-1037.016] * (-1041.699) (-1039.361) (-1044.260) [-1045.284] -- 0:00:01
993500 -- [-1044.225] (-1039.435) (-1046.359) (-1038.737) * (-1041.037) [-1038.560] (-1040.295) (-1040.357) -- 0:00:01
994000 -- (-1041.334) (-1037.696) [-1042.094] (-1042.010) * (-1043.138) (-1044.022) (-1037.058) [-1037.765] -- 0:00:01
994500 -- (-1039.978) (-1036.152) [-1037.940] (-1041.380) * (-1048.924) [-1035.120] (-1037.206) (-1040.415) -- 0:00:01
995000 -- (-1040.935) (-1037.962) [-1037.663] (-1038.482) * (-1046.113) [-1046.263] (-1044.668) (-1038.819) -- 0:00:01
Average standard deviation of split frequencies: 0.006829
995500 -- (-1038.426) (-1045.484) (-1036.178) [-1041.132] * (-1046.238) [-1035.512] (-1039.385) (-1040.809) -- 0:00:01
996000 -- [-1046.347] (-1043.582) (-1040.745) (-1045.374) * (-1043.976) [-1039.482] (-1040.694) (-1034.929) -- 0:00:00
996500 -- [-1046.352] (-1036.555) (-1041.090) (-1042.408) * (-1041.232) (-1040.575) [-1034.453] (-1035.593) -- 0:00:00
997000 -- [-1039.796] (-1038.645) (-1050.623) (-1044.593) * (-1041.486) (-1032.925) [-1037.065] (-1035.617) -- 0:00:00
997500 -- (-1039.968) (-1042.445) [-1044.134] (-1041.705) * (-1044.708) (-1045.318) [-1040.416] (-1050.770) -- 0:00:00
998000 -- (-1036.279) [-1037.521] (-1041.850) (-1052.288) * (-1042.800) (-1048.051) [-1032.452] (-1043.914) -- 0:00:00
998500 -- [-1039.175] (-1038.584) (-1046.600) (-1042.310) * (-1045.066) (-1041.275) (-1038.429) [-1045.475] -- 0:00:00
999000 -- (-1042.010) (-1045.899) [-1047.053] (-1038.824) * [-1040.243] (-1041.302) (-1052.067) (-1038.602) -- 0:00:00
999500 -- (-1039.834) [-1040.768] (-1042.982) (-1041.264) * [-1040.460] (-1037.516) (-1044.171) (-1049.788) -- 0:00:00
1000000 -- (-1044.205) (-1044.220) (-1042.070) [-1042.452] * (-1050.014) (-1041.550) [-1037.349] (-1049.419) -- 0:00:00
Average standard deviation of split frequencies: 0.007134
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1044.204748 -- 11.230441
Chain 1 -- -1044.204743 -- 11.230441
Chain 2 -- -1044.219901 -- 16.232364
Chain 2 -- -1044.219903 -- 16.232364
Chain 3 -- -1042.069801 -- 15.033608
Chain 3 -- -1042.069798 -- 15.033608
Chain 4 -- -1042.451736 -- 16.181817
Chain 4 -- -1042.451736 -- 16.181817
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1050.013715 -- 12.439665
Chain 1 -- -1050.013711 -- 12.439665
Chain 2 -- -1041.550178 -- 17.180226
Chain 2 -- -1041.550182 -- 17.180226
Chain 3 -- -1037.348964 -- 13.468743
Chain 3 -- -1037.348962 -- 13.468743
Chain 4 -- -1049.418852 -- 11.872913
Chain 4 -- -1049.418849 -- 11.872913
Analysis completed in 3 mins 51 seconds
Analysis used 231.02 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1029.42
Likelihood of best state for "cold" chain of run 2 was -1029.42
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
61.6 % ( 48 %) Dirichlet(Revmat{all})
74.2 % ( 58 %) Slider(Revmat{all})
30.8 % ( 28 %) Dirichlet(Pi{all})
32.4 % ( 20 %) Slider(Pi{all})
53.8 % ( 35 %) Multiplier(Alpha{1,2})
47.9 % ( 24 %) Multiplier(Alpha{3})
65.9 % ( 36 %) Slider(Pinvar{all})
18.4 % ( 14 %) ExtSPR(Tau{all},V{all})
6.7 % ( 10 %) ExtTBR(Tau{all},V{all})
18.4 % ( 23 %) NNI(Tau{all},V{all})
18.9 % ( 16 %) ParsSPR(Tau{all},V{all})
26.6 % ( 30 %) Multiplier(V{all})
45.2 % ( 44 %) Nodeslider(V{all})
26.2 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.0 % ( 48 %) Dirichlet(Revmat{all})
74.3 % ( 66 %) Slider(Revmat{all})
31.6 % ( 32 %) Dirichlet(Pi{all})
33.8 % ( 33 %) Slider(Pi{all})
53.4 % ( 35 %) Multiplier(Alpha{1,2})
48.6 % ( 30 %) Multiplier(Alpha{3})
66.7 % ( 39 %) Slider(Pinvar{all})
18.4 % ( 7 %) ExtSPR(Tau{all},V{all})
6.7 % ( 5 %) ExtTBR(Tau{all},V{all})
18.5 % ( 26 %) NNI(Tau{all},V{all})
19.1 % ( 16 %) ParsSPR(Tau{all},V{all})
26.7 % ( 24 %) Multiplier(V{all})
45.2 % ( 48 %) Nodeslider(V{all})
26.0 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166898 0.82 0.65
3 | 166797 166464 0.83
4 | 166473 166441 166927
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166101 0.82 0.65
3 | 166299 167174 0.83
4 | 166339 167205 166882
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1038.18
| 2 2 1 |
|2 |
| 1 2 1 1 2|
| 2 1 1 1 2 |
| 1 1 2 21 *1 1 2 1 2 |
| 1 2 2 2 22 * 21 2 |
|1 22 1 1 1 1 2 12 1 2 1 1 |
| * 12 1 * 2 2 1 1 2 122 1 12 1 1 |
| 1 1 2 1 1 2 2 2 2 1 1 1|
| 12 22 1 *2 2 1 1 11 11 2 22 |
| 2 2 2 2 |
| 2 1 11 2 2 2 2 |
| 2 |
| 1 |
| 1 2 1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1041.54
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1036.00 -1048.42
2 -1036.01 -1047.81
--------------------------------------
TOTAL -1036.00 -1048.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.624995 0.012503 0.438680 0.863462 0.611797 1249.03 1375.01 1.000
r(A<->C){all} 0.105391 0.001385 0.038143 0.181528 0.101938 837.82 881.02 1.000
r(A<->G){all} 0.311309 0.004988 0.174282 0.444794 0.307842 666.23 713.82 1.000
r(A<->T){all} 0.050957 0.001008 0.001344 0.109184 0.046350 651.22 711.42 1.000
r(C<->G){all} 0.087632 0.000906 0.030816 0.145342 0.085079 833.08 989.05 1.000
r(C<->T){all} 0.369866 0.004975 0.243559 0.516242 0.365753 672.25 740.70 1.001
r(G<->T){all} 0.074845 0.001259 0.014436 0.144237 0.070880 703.06 865.65 1.000
pi(A){all} 0.205809 0.000370 0.170731 0.245775 0.205589 1153.10 1255.89 1.000
pi(C){all} 0.340978 0.000497 0.295693 0.383798 0.340912 1030.76 1160.42 1.001
pi(G){all} 0.257333 0.000418 0.217707 0.297151 0.257194 1236.59 1283.30 1.000
pi(T){all} 0.195880 0.000352 0.160405 0.233346 0.195810 1131.40 1153.42 1.000
alpha{1,2} 0.092558 0.002990 0.000206 0.181726 0.093588 979.09 1144.70 1.000
alpha{3} 1.917777 0.615414 0.653820 3.433554 1.782068 1320.72 1360.63 1.000
pinvar{all} 0.284450 0.012594 0.069792 0.495317 0.288632 922.30 1132.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Key to taxon bipartitions (saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------
1 -- .******
2 -- .*.....
3 -- ..*....
4 -- ...*...
5 -- ....*..
6 -- .....*.
7 -- ......*
8 -- .....**
9 -- ...**..
10 -- ...****
11 -- .**....
12 -- .*.****
13 -- .****..
14 -- .**..**
-------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
8 3002 1.000000 0.000000 1.000000 1.000000 2
9 2841 0.946369 0.004240 0.943371 0.949367 2
10 2220 0.739507 0.008480 0.733511 0.745503 2
11 2075 0.691206 0.011777 0.682878 0.699534 2
12 401 0.133578 0.011777 0.125250 0.141905 2
13 342 0.113924 0.000942 0.113258 0.114590 2
14 313 0.104264 0.012719 0.095270 0.113258 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.022517 0.000115 0.004399 0.044018 0.021171 1.000 2
length{all}[2] 0.019229 0.000087 0.003751 0.036835 0.017733 1.001 2
length{all}[3] 0.007641 0.000032 0.000125 0.018495 0.006309 1.000 2
length{all}[4] 0.035949 0.000269 0.009974 0.069822 0.033688 1.000 2
length{all}[5] 0.083787 0.000694 0.037275 0.136951 0.080316 1.000 2
length{all}[6] 0.093698 0.001399 0.023976 0.166275 0.088676 1.000 2
length{all}[7] 0.102556 0.001493 0.035547 0.180317 0.097393 1.000 2
length{all}[8] 0.191118 0.003704 0.084922 0.308022 0.182212 1.000 2
length{all}[9] 0.040992 0.000460 0.002473 0.082049 0.038584 1.000 2
length{all}[10] 0.025694 0.000314 0.000045 0.059131 0.022543 1.000 2
length{all}[11] 0.009097 0.000047 0.000036 0.021909 0.007646 1.001 2
length{all}[12] 0.005972 0.000031 0.000013 0.015136 0.004587 0.998 2
length{all}[13] 0.008873 0.000053 0.000002 0.022972 0.006985 0.998 2
length{all}[14] 0.006724 0.000032 0.000040 0.017386 0.005117 1.002 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007134
Maximum standard deviation of split frequencies = 0.012719
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C4 (4)
| /-----------95----------+
| | \------------------------ C5 (5)
|-----------74----------+
+ | /------------------------ C6 (6)
| \----------100----------+
| \------------------------ C7 (7)
|
| /------------------------ C2 (2)
\-----------------------69----------------------+
\------------------------ C3 (3)
Phylogram (based on average branch lengths):
/----- C1 (1)
|
| /-------- C4 (4)
| /---------+
| | \------------------- C5 (5)
|----+
+ | /--------------------- C6 (6)
| \-------------------------------------------+
| \----------------------- C7 (7)
|
| /---- C2 (2)
\-+
\- C3 (3)
|----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (21 trees sampled):
90 % credible set contains 9 trees
95 % credible set contains 12 trees
99 % credible set contains 18 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 402
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sites with gaps or missing data are removed.
18 ambiguity characters in seq. 1
18 ambiguity characters in seq. 2
18 ambiguity characters in seq. 3
18 ambiguity characters in seq. 4
18 ambiguity characters in seq. 5
30 ambiguity characters in seq. 6
33 ambiguity characters in seq. 7
11 sites are removed. 7 8 9 10 15 40 130 131 132 133 134
Sequences read..
Counting site patterns.. 0:00
94 patterns at 123 / 123 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
91744 bytes for conP
12784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
229360 bytes for conP, adjusted
0.034811 0.035667 0.043640 0.067296 0.113030 0.229552 0.157371 0.174778 0.007709 0.030481 0.010856 0.300000 1.300000
ntime & nrate & np: 11 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 13
lnL0 = -1076.069931
Iterating by ming2
Initial: fx= 1076.069931
x= 0.03481 0.03567 0.04364 0.06730 0.11303 0.22955 0.15737 0.17478 0.00771 0.03048 0.01086 0.30000 1.30000
1 h-m-p 0.0000 0.0004 150.9431 ++YCYCCC 1070.503607 5 0.0003 29 | 0/13
2 h-m-p 0.0000 0.0003 2778.8521 ++ 1047.824182 m 0.0003 45 | 0/13
3 h-m-p 0.0000 0.0000 67216.8865 ++ 1047.047647 m 0.0000 61 | 0/13
4 h-m-p 0.0000 0.0000 4235.5846 ++ 1043.399976 m 0.0000 77 | 0/13
5 h-m-p 0.0002 0.0011 275.9474 +CYYYYCCCCC 1026.904856 9 0.0009 108 | 0/13
6 h-m-p 0.0003 0.0013 220.9735 +YYCCCC 1019.090546 5 0.0008 133 | 0/13
7 h-m-p 0.0001 0.0006 272.7886 ++ 1010.276702 m 0.0006 149 | 0/13
8 h-m-p 0.0000 0.0000 1803.1122
h-m-p: 1.90556377e-21 9.52781884e-21 1.80311223e+03 1010.276702
.. | 0/13
9 h-m-p 0.0000 0.0004 21413.1635 YCYYCCC 996.119987 6 0.0000 188 | 0/13
10 h-m-p 0.0001 0.0004 259.9519 +YYCYCCC 986.961918 6 0.0003 214 | 0/13
11 h-m-p 0.0000 0.0002 162.4983 +YYYYYC 984.635656 5 0.0002 236 | 0/13
12 h-m-p 0.0001 0.0009 266.0818 +CCCYC 971.962419 4 0.0007 261 | 0/13
13 h-m-p 0.0001 0.0006 670.3132 +YYYCCC 950.976366 5 0.0005 285 | 0/13
14 h-m-p 0.0000 0.0001 1667.8694 YCYCCCC 947.153612 6 0.0000 311 | 0/13
15 h-m-p 0.0000 0.0002 503.3829 CYCCCC 945.958140 5 0.0001 336 | 0/13
16 h-m-p 0.0011 0.0054 17.9764 YCC 945.842198 2 0.0007 355 | 0/13
17 h-m-p 0.0003 0.0066 38.1278 +YCCCC 944.755899 4 0.0032 379 | 0/13
18 h-m-p 0.0013 0.0112 92.0680 +YCYCCC 939.343998 5 0.0078 404 | 0/13
19 h-m-p 0.0008 0.0040 396.1434 +YCCCC 933.857171 4 0.0023 428 | 0/13
20 h-m-p 0.0014 0.0070 46.6713 YYYC 933.385936 3 0.0014 447 | 0/13
21 h-m-p 0.0041 0.0206 11.9302 YCCC 933.282079 3 0.0018 468 | 0/13
22 h-m-p 0.0269 1.8304 0.8054 ++CYCCCC 928.177453 5 0.7932 495 | 0/13
23 h-m-p 0.2566 1.2829 0.6379 +YCCC 923.313679 3 0.6877 530 | 0/13
24 h-m-p 0.7775 3.8876 0.1358 YCCCCC 921.615591 5 1.5112 568 | 0/13
25 h-m-p 1.0483 5.2417 0.0980 YCCCC 920.820216 4 0.6116 604 | 0/13
26 h-m-p 0.4379 3.2673 0.1369 +YCCC 920.235916 3 1.1994 639 | 0/13
27 h-m-p 1.6000 8.0000 0.0894 CYC 920.086170 2 1.7113 671 | 0/13
28 h-m-p 1.6000 8.0000 0.0028 YCC 920.078324 2 0.9427 703 | 0/13
29 h-m-p 0.2729 8.0000 0.0097 ++YC 920.070346 1 2.8423 735 | 0/13
30 h-m-p 1.6000 8.0000 0.0022 +YC 920.059551 1 4.2840 766 | 0/13
31 h-m-p 1.6000 8.0000 0.0013 +YC 920.048612 1 4.3149 797 | 0/13
32 h-m-p 1.6000 8.0000 0.0036 C 920.046078 0 1.5863 826 | 0/13
33 h-m-p 1.6000 8.0000 0.0013 C 920.045976 0 1.4395 855 | 0/13
34 h-m-p 1.6000 8.0000 0.0001 C 920.045969 0 1.8352 884 | 0/13
35 h-m-p 1.0989 8.0000 0.0002 +C 920.045964 0 4.4466 914 | 0/13
36 h-m-p 1.6000 8.0000 0.0000 ++ 920.045924 m 8.0000 943 | 0/13
37 h-m-p 0.9436 8.0000 0.0004 C 920.045840 0 1.1090 972 | 0/13
38 h-m-p 0.8924 8.0000 0.0005 C 920.045838 0 1.3666 1001 | 0/13
39 h-m-p 1.6000 8.0000 0.0000 Y 920.045838 0 1.1493 1030 | 0/13
40 h-m-p 1.6000 8.0000 0.0000 Y 920.045838 0 1.6000 1059 | 0/13
41 h-m-p 0.3526 8.0000 0.0000 --C 920.045838 0 0.0055 1090
Out..
lnL = -920.045838
1091 lfun, 1091 eigenQcodon, 12001 P(t)
Time used: 0:04
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
0.034811 0.035667 0.043640 0.067296 0.113030 0.229552 0.157371 0.174778 0.007709 0.030481 0.010856 2.443509 0.534390 0.193110
ntime & nrate & np: 11 2 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.080137
np = 14
lnL0 = -962.619706
Iterating by ming2
Initial: fx= 962.619706
x= 0.03481 0.03567 0.04364 0.06730 0.11303 0.22955 0.15737 0.17478 0.00771 0.03048 0.01086 2.44351 0.53439 0.19311
1 h-m-p 0.0000 0.0011 124.2972 ++++ 949.623310 m 0.0011 21 | 0/14
2 h-m-p 0.0000 0.0000 17767.2977 ++ 931.024078 m 0.0000 38 | 1/14
3 h-m-p 0.0000 0.0002 226.4695 ++ 929.194122 m 0.0002 55 | 1/14
4 h-m-p 0.0011 0.0056 22.9840 +YYYCCC 923.633311 5 0.0041 80 | 0/14
5 h-m-p 0.0001 0.0006 181.4226 YCCCC 921.676857 4 0.0002 104 | 0/14
6 h-m-p 0.0001 0.0003 214.4498 +YYCCC 919.430052 4 0.0002 128 | 0/14
7 h-m-p 0.0001 0.0003 92.2491 YCYCCC 918.884912 5 0.0002 153 | 0/14
8 h-m-p 0.0002 0.0009 69.6354 CYCCC 918.504437 4 0.0003 177 | 0/14
9 h-m-p 0.0004 0.0021 44.6092 CCCCC 918.148239 4 0.0006 202 | 0/14
10 h-m-p 0.0017 0.0085 10.7925 CCC 918.112430 2 0.0006 223 | 0/14
11 h-m-p 0.0011 0.0442 6.5601 YC 918.061628 1 0.0024 241 | 0/14
12 h-m-p 0.0036 0.0800 4.3297 CYC 918.015671 2 0.0034 261 | 0/14
13 h-m-p 0.0043 0.0893 3.3994 YCCC 917.849243 3 0.0093 283 | 0/14
14 h-m-p 0.0088 0.1810 3.5928 +CCCC 915.853901 3 0.0404 307 | 0/14
15 h-m-p 0.0020 0.0100 28.9506 YCCCCC 913.541022 5 0.0047 333 | 0/14
16 h-m-p 0.2670 5.3681 0.5046 +YYC 912.833685 2 0.8491 353 | 0/14
17 h-m-p 0.8750 5.0464 0.4897 YCCC 912.596351 3 0.5958 389 | 0/14
18 h-m-p 0.8249 4.1243 0.0803 YCCC 912.540497 3 0.4909 425 | 0/14
19 h-m-p 1.6000 8.0000 0.0180 CCC 912.479185 2 2.1042 460 | 0/14
20 h-m-p 1.6000 8.0000 0.0063 CC 912.446476 1 1.4398 493 | 0/14
21 h-m-p 0.4324 8.0000 0.0209 +YC 912.439500 1 1.2552 526 | 0/14
22 h-m-p 1.6000 8.0000 0.0025 YC 912.437108 1 1.1728 558 | 0/14
23 h-m-p 0.5697 8.0000 0.0052 +YC 912.436420 1 1.6381 591 | 0/14
24 h-m-p 1.6000 8.0000 0.0004 C 912.436355 0 1.4755 622 | 0/14
25 h-m-p 1.0084 8.0000 0.0006 C 912.436351 0 1.2196 653 | 0/14
26 h-m-p 1.6000 8.0000 0.0001 Y 912.436350 0 1.2348 684 | 0/14
27 h-m-p 1.6000 8.0000 0.0000 Y 912.436350 0 1.0724 715 | 0/14
28 h-m-p 1.6000 8.0000 0.0000 --Y 912.436350 0 0.0250 748
Out..
lnL = -912.436350
749 lfun, 2247 eigenQcodon, 16478 P(t)
Time used: 0:09
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
initial w for M2:NSpselection reset.
0.034811 0.035667 0.043640 0.067296 0.113030 0.229552 0.157371 0.174778 0.007709 0.030481 0.010856 2.513124 1.131355 0.291249 0.418683 2.981222
ntime & nrate & np: 11 3 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 3.864929
np = 16
lnL0 = -987.161664
Iterating by ming2
Initial: fx= 987.161664
x= 0.03481 0.03567 0.04364 0.06730 0.11303 0.22955 0.15737 0.17478 0.00771 0.03048 0.01086 2.51312 1.13136 0.29125 0.41868 2.98122
1 h-m-p 0.0000 0.0067 102.8700 +++++ 972.037868 m 0.0067 24 | 0/16
2 h-m-p 0.0000 0.0001 1558.1304 +CYCCC 966.460059 4 0.0000 52 | 0/16
3 h-m-p 0.0001 0.0004 47.5724 ++ 965.643651 m 0.0004 71 | 0/16
4 h-m-p 0.0004 0.0231 55.0337 +CYCCC 964.666900 4 0.0020 98 | 0/16
5 h-m-p 0.0033 0.0190 33.4028 YCCCC 961.848252 4 0.0081 124 | 0/16
6 h-m-p 0.0119 0.0660 22.8211 CCC 959.921256 2 0.0125 147 | 0/16
7 h-m-p 0.0232 0.1158 9.1755 YCCC 959.468261 3 0.0113 171 | 0/16
8 h-m-p 0.0156 0.0778 5.9875 +YYCCCC 957.981614 5 0.0493 199 | 0/16
9 h-m-p 0.0052 0.0261 48.3320 +YYCCCC 954.151865 5 0.0164 227 | 0/16
10 h-m-p 0.0029 0.0145 44.9069 +YYYCCCC 951.348542 6 0.0117 256 | 0/16
11 h-m-p 0.0047 0.0235 49.1667 ++ 946.642060 m 0.0235 275 | 1/16
12 h-m-p 0.0201 0.1003 9.8812 +YYYCCC 932.588517 5 0.0751 302 | 1/16
13 h-m-p 0.0016 0.0082 35.4081 YCCCC 931.317538 4 0.0035 328 | 1/16
14 h-m-p 0.0217 0.1085 4.6200 YCYCCC 929.847658 5 0.0453 355 | 0/16
15 h-m-p 0.0101 0.0952 20.6880 YCYCCC 928.880067 5 0.0048 382 | 0/16
16 h-m-p 0.0097 0.0507 10.2461 +CYYYCC 924.743271 5 0.0439 409 | 0/16
17 h-m-p 0.0325 0.1623 8.1917 +YCCC 922.623786 3 0.0927 434 | 0/16
18 h-m-p 0.1489 0.7443 1.2656 YCYCCC 918.969379 5 0.4166 461 | 0/16
19 h-m-p 0.0963 0.4813 1.5119 YYYC 918.463693 3 0.0905 483 | 0/16
20 h-m-p 0.1511 1.2560 0.9055 +CYC 917.334352 2 0.6147 506 | 0/16
21 h-m-p 0.2025 1.0126 0.9254 CYCCC 916.296664 4 0.3988 548 | 0/16
22 h-m-p 0.0899 0.4493 1.1451 YCCCC 915.517893 4 0.1800 590 | 0/16
23 h-m-p 0.1592 1.0435 1.2944 YCCCC 914.933048 4 0.2968 616 | 0/16
24 h-m-p 0.5053 3.3854 0.7604 CCCC 914.308695 3 0.7395 641 | 0/16
25 h-m-p 0.3303 1.6513 1.0633 CCCC 913.958283 3 0.4481 682 | 0/16
26 h-m-p 0.2931 3.2041 1.6257 YCC 913.464206 2 0.5609 704 | 0/16
27 h-m-p 0.3571 1.7853 1.4538 CCCC 913.261016 3 0.3794 729 | 0/16
28 h-m-p 0.5314 2.6572 0.9457 CCCC 913.028026 3 0.8141 754 | 0/16
29 h-m-p 0.6262 5.2641 1.2295 CCC 912.835612 2 0.7527 793 | 0/16
30 h-m-p 0.7830 8.0000 1.1820 CCC 912.668647 2 1.2543 816 | 0/16
31 h-m-p 0.6531 3.2656 1.5955 YC 912.602452 1 0.4550 836 | 0/16
32 h-m-p 0.5183 7.3725 1.4008 CCC 912.548270 2 0.7611 859 | 0/16
33 h-m-p 0.5863 5.2474 1.8183 YC 912.521196 1 0.3611 879 | 0/16
34 h-m-p 0.4703 8.0000 1.3960 CC 912.492255 1 0.7528 900 | 0/16
35 h-m-p 0.8144 8.0000 1.2904 CYC 912.471327 2 0.8646 922 | 0/16
36 h-m-p 0.7891 8.0000 1.4139 CC 912.456459 1 1.0146 943 | 0/16
37 h-m-p 1.3661 8.0000 1.0501 CYC 912.446617 2 1.5870 965 | 0/16
38 h-m-p 1.4152 8.0000 1.1775 CC 912.442387 1 1.1414 986 | 0/16
39 h-m-p 1.1385 8.0000 1.1805 CYC 912.439534 2 1.2486 1008 | 0/16
40 h-m-p 1.2559 8.0000 1.1737 C 912.438317 0 1.2112 1027 | 0/16
41 h-m-p 0.9428 8.0000 1.5078 CC 912.437461 1 0.8103 1048 | 0/16
42 h-m-p 1.1570 8.0000 1.0560 CC 912.436931 1 1.5900 1069 | 0/16
43 h-m-p 1.3578 8.0000 1.2366 YC 912.436696 1 0.9825 1089 | 0/16
44 h-m-p 1.1849 8.0000 1.0254 CC 912.436518 1 1.7329 1110 | 0/16
45 h-m-p 1.6000 8.0000 0.7521 C 912.436440 0 2.0457 1129 | 0/16
46 h-m-p 1.3081 8.0000 1.1761 YC 912.436385 1 2.3769 1165 | 0/16
47 h-m-p 1.6000 8.0000 0.3194 Y 912.436378 0 0.8153 1184 | 0/16
48 h-m-p 0.3452 8.0000 0.7543 +Y 912.436373 0 0.9193 1220 | 0/16
49 h-m-p 1.3320 8.0000 0.5206 ++ 912.436358 m 8.0000 1255 | 0/16
50 h-m-p 1.6000 8.0000 0.6521 Y 912.436353 0 1.2740 1290 | 0/16
51 h-m-p 1.1783 8.0000 0.7051 +Y 912.436352 0 3.0201 1326 | 0/16
52 h-m-p 1.6000 8.0000 1.0168 C 912.436351 0 2.3545 1361 | 0/16
53 h-m-p 1.0079 8.0000 2.3753 -----------Y 912.436351 0 0.0000 1391 | 0/16
54 h-m-p 0.0026 1.3039 34.9254 ------C 912.436351 0 0.0000 1416 | 0/16
55 h-m-p 0.0160 8.0000 0.1188 +Y 912.436351 0 0.1591 1436 | 0/16
56 h-m-p 1.6000 8.0000 0.0019 C 912.436351 0 0.6160 1471 | 0/16
57 h-m-p 0.9107 8.0000 0.0013 +Y 912.436351 0 2.5779 1507 | 0/16
58 h-m-p 1.6000 8.0000 0.0011 C 912.436351 0 1.6736 1542 | 0/16
59 h-m-p 1.6000 8.0000 0.0000 C 912.436351 0 1.6000 1577 | 0/16
60 h-m-p 0.0825 8.0000 0.0003 -------------Y 912.436351 0 0.0000 1625
Out..
lnL = -912.436351
1626 lfun, 6504 eigenQcodon, 53658 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -923.282850 S = -883.357558 -31.611520
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 94 patterns 0:25
did 20 / 94 patterns 0:26
did 30 / 94 patterns 0:26
did 40 / 94 patterns 0:26
did 50 / 94 patterns 0:26
did 60 / 94 patterns 0:26
did 70 / 94 patterns 0:26
did 80 / 94 patterns 0:26
did 90 / 94 patterns 0:26
did 94 / 94 patterns 0:26
Time used: 0:26
Model 3: discrete
TREE # 1
(1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
0.034811 0.035667 0.043640 0.067296 0.113030 0.229552 0.157371 0.174778 0.007709 0.030481 0.010856 2.513025 0.960589 0.897086 0.029263 0.075275 0.102514
ntime & nrate & np: 11 4 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 15.021926
np = 17
lnL0 = -919.610098
Iterating by ming2
Initial: fx= 919.610098
x= 0.03481 0.03567 0.04364 0.06730 0.11303 0.22955 0.15737 0.17478 0.00771 0.03048 0.01086 2.51302 0.96059 0.89709 0.02926 0.07528 0.10251
1 h-m-p 0.0000 0.0005 65.7414 ++CYYCCC 918.696681 5 0.0003 33 | 0/17
2 h-m-p 0.0000 0.0000 418.0698 ++ 917.722996 m 0.0000 53 | 1/17
3 h-m-p 0.0001 0.0010 83.7988 YCCC 917.450804 3 0.0003 78 | 1/17
4 h-m-p 0.0006 0.0037 36.6534 CYC 917.211781 2 0.0006 101 | 1/17
5 h-m-p 0.0009 0.0077 24.8494 +YCCCCC 915.709708 5 0.0042 131 | 1/17
6 h-m-p 0.0001 0.0005 222.4494 +YCYCCC 914.981667 5 0.0003 160 | 1/17
7 h-m-p 0.0003 0.0017 65.0497 YCCC 914.585194 3 0.0007 185 | 1/17
8 h-m-p 0.0005 0.0027 46.0272 YCCC 914.481386 3 0.0003 210 | 1/17
9 h-m-p 0.0009 0.0072 17.8452 YCC 914.419566 2 0.0007 233 | 1/17
10 h-m-p 0.0011 0.0066 11.0633 YYC 914.376783 2 0.0009 255 | 1/17
11 h-m-p 0.0016 0.0364 6.4161 YCC 914.328268 2 0.0027 278 | 1/17
12 h-m-p 0.0019 0.0305 9.0462 CCC 914.271348 2 0.0029 302 | 1/17
13 h-m-p 0.0038 0.1383 6.8208 +CCC 914.028592 2 0.0174 327 | 1/17
14 h-m-p 0.0026 0.1073 44.7256 YCCC 913.471544 3 0.0064 352 | 1/17
15 h-m-p 0.0055 0.0276 47.9091 CYCC 912.954204 3 0.0053 377 | 1/17
16 h-m-p 0.5914 2.9569 0.1691 YCCC 912.596233 3 1.0035 402 | 1/17
17 h-m-p 0.8650 8.0000 0.1962 CCC 912.476236 2 0.7383 442 | 0/17
18 h-m-p 0.0012 0.0238 118.0954 YCC 912.464845 2 0.0002 481 | 0/17
19 h-m-p 0.1359 5.7911 0.1760 ++YCCC 912.339734 3 1.4263 508 | 0/17
20 h-m-p 1.4624 7.3120 0.1014 YCC 912.298034 2 1.0514 548 | 0/17
21 h-m-p 0.7640 8.0000 0.1395 YCC 912.288046 2 0.5873 588 | 0/17
22 h-m-p 1.2062 8.0000 0.0679 YC 912.268184 1 2.3117 626 | 0/17
23 h-m-p 1.6000 8.0000 0.0763 YCCC 912.240049 3 3.0344 668 | 0/17
24 h-m-p 1.2532 6.2660 0.0531 CC 912.224196 1 1.6924 707 | 0/17
25 h-m-p 1.1520 8.0000 0.0780 YCC 912.220308 2 0.8887 747 | 0/17
26 h-m-p 1.6000 8.0000 0.0068 YC 912.219888 1 1.2453 785 | 0/17
27 h-m-p 1.1960 8.0000 0.0070 Y 912.219855 0 0.9011 822 | 0/17
28 h-m-p 1.6000 8.0000 0.0001 C 912.219849 0 2.0496 859 | 0/17
29 h-m-p 0.5931 8.0000 0.0005 +Y 912.219840 0 4.3648 897 | 0/17
30 h-m-p 1.6000 8.0000 0.0003 +C 912.219822 0 6.5113 935 | 0/17
31 h-m-p 0.4218 8.0000 0.0040 +++ 912.219659 m 8.0000 973 | 0/17
32 h-m-p 0.0489 0.2447 0.1585 +YC 912.219570 1 0.1499 1012 | 0/17
33 h-m-p 0.1081 0.5405 0.0275 ++ 912.219415 m 0.5405 1049 | 1/17
34 h-m-p 0.1640 3.8051 0.0897 --------------Y 912.219415 0 0.0000 1100 | 0/17
35 h-m-p 0.0000 0.0000 26345277262715296.0000
h-m-p: 1.20160218e-16 6.00801092e-16 2.63452773e+16 912.219415
.. | 0/17
36 h-m-p 0.0000 0.0078 2.4530 +YC 912.219013 1 0.0001 1155 | 0/17
37 h-m-p 0.0004 0.0055 0.8066 Y 912.218962 0 0.0002 1175 | 0/17
38 h-m-p 0.0001 0.0003 0.6214 ++ 912.218904 m 0.0003 1212 | 1/17
39 h-m-p 0.0002 0.0352 0.8286 Y 912.218885 0 0.0002 1249 | 1/17
40 h-m-p 0.0006 0.2918 0.4923 Y 912.218864 0 0.0004 1285 | 1/17
41 h-m-p 0.0013 0.6626 0.1806 C 912.218851 0 0.0011 1321 | 1/17
42 h-m-p 0.0052 2.5805 0.0648 Y 912.218849 0 0.0009 1357 | 1/17
43 h-m-p 0.0070 3.5033 0.0458 C 912.218848 0 0.0015 1393 | 1/17
44 h-m-p 0.0160 8.0000 0.0345 -Y 912.218847 0 0.0007 1430 | 1/17
45 h-m-p 0.0145 7.2455 0.0316 -Y 912.218847 0 0.0015 1467 | 1/17
46 h-m-p 0.0160 8.0000 0.0244 C 912.218844 0 0.0186 1503 | 1/17
47 h-m-p 0.0160 8.0000 0.0595 C 912.218842 0 0.0064 1539 | 1/17
48 h-m-p 0.0086 4.3051 0.0780 C 912.218841 0 0.0023 1575 | 1/17
49 h-m-p 0.0171 8.0000 0.0105 Y 912.218840 0 0.0103 1611 | 1/17
50 h-m-p 0.0160 8.0000 0.0590 +Y 912.218809 0 0.1287 1648 | 1/17
51 h-m-p 1.6000 8.0000 0.0026 Y 912.218806 0 1.0786 1684 | 1/17
52 h-m-p 0.6147 8.0000 0.0045 Y 912.218801 0 1.0846 1720 | 1/17
53 h-m-p 1.1477 8.0000 0.0043 ++ 912.218748 m 8.0000 1756 | 1/17
54 h-m-p 0.0633 5.1874 0.5385 ----------C 912.218748 0 0.0000 1802 | 1/17
55 h-m-p 0.0063 3.1614 32.3695 YCY 912.218594 2 0.0038 1841 | 1/17
56 h-m-p 1.1291 8.0000 0.1081 YC 912.218536 1 0.5532 1862 | 0/17
57 h-m-p 0.0085 4.2626 24.0839 YC 912.218492 1 0.0013 1899 | 0/17
58 h-m-p 0.5614 2.8068 0.0519 +YC 912.218304 1 1.7029 1921 | 0/17
59 h-m-p 0.1112 0.5559 0.0105 ++ 912.218211 m 0.5559 1958 | 1/17
60 h-m-p 0.0652 8.0000 0.0894 ++CCYC 912.217887 3 1.5583 2002 | 0/17
61 h-m-p 0.0000 0.0012 45606.8715 ---C 912.217887 0 0.0000 2041 | 0/17
62 h-m-p 0.0290 8.0000 0.0863 +++YC 912.217545 1 1.2441 2065 | 1/17
63 h-m-p 1.1760 8.0000 0.0913 YC 912.217358 1 0.6392 2103 | 0/17
64 h-m-p 0.0000 0.0003 188621.8964 ---C 912.217355 0 0.0000 2142 | 0/17
65 h-m-p 0.1874 8.0000 0.0341 +C 912.217077 0 0.8089 2163 | 0/17
66 h-m-p 0.0317 0.1586 0.0490 ++ 912.217034 m 0.1586 2200 | 1/17
67 h-m-p 0.0602 8.0000 0.1293 ++YY 912.216595 1 0.9627 2240 | 0/17
68 h-m-p -0.0000 -0.0000 61727.6530
h-m-p: -0.00000000e+00 -0.00000000e+00 6.17276530e+04 912.216595
.. | 0/17
69 h-m-p 0.0001 0.0272 1.4220 +Y 912.216414 0 0.0002 2294 | 0/17
70 h-m-p 0.0004 0.0025 0.5990 C 912.216393 0 0.0001 2314 | 0/17
71 h-m-p 0.0001 0.0004 0.5271 ++ 912.216327 m 0.0004 2351 | 1/17
72 h-m-p 0.0001 0.0387 4.2164 C 912.216322 0 0.0000 2388 | 1/17
73 h-m-p 0.0035 1.7465 0.0459 -C 912.216321 0 0.0003 2409 | 1/17
74 h-m-p 0.0012 0.6126 0.0666 C 912.216321 0 0.0003 2445 | 1/17
75 h-m-p 0.0080 4.0022 0.0339 Y 912.216320 0 0.0015 2481 | 1/17
76 h-m-p 0.0095 4.7387 0.0885 Y 912.216319 0 0.0017 2517 | 1/17
77 h-m-p 0.0160 8.0000 0.0752 C 912.216317 0 0.0039 2553 | 1/17
78 h-m-p 0.0053 2.6318 0.3029 C 912.216312 0 0.0019 2589 | 1/17
79 h-m-p 0.0120 5.9938 0.3007 YC 912.216297 1 0.0063 2626 | 1/17
80 h-m-p 0.0136 2.9367 0.1399 Y 912.216295 0 0.0026 2662 | 1/17
81 h-m-p 0.0160 8.0000 0.0766 C 912.216292 0 0.0045 2698 | 1/17
82 h-m-p 0.0160 8.0000 0.0427 C 912.216286 0 0.0244 2734 | 1/17
83 h-m-p 0.0160 8.0000 0.3268 C 912.216274 0 0.0064 2770 | 1/17
84 h-m-p 0.2389 8.0000 0.0087 +++ 912.215993 m 8.0000 2807 | 1/17
85 h-m-p 0.9712 8.0000 0.0718 YY 912.215789 1 0.9712 2844 | 0/17
86 h-m-p 0.0037 1.8488 42.0417 YC 912.215755 1 0.0005 2881 | 0/17
87 h-m-p 0.5520 2.7602 0.0186 ++ 912.215160 m 2.7602 2901 | 1/17
88 h-m-p 1.2634 8.0000 0.0407 +YCYC 912.213857 3 3.8427 2943 | 0/17
89 h-m-p 0.0000 0.0011 10124.4434 --Y 912.213857 0 0.0000 2981 | 0/17
90 h-m-p 0.0160 8.0000 0.2155 ++YC 912.213532 1 0.1941 3004 | 0/17
91 h-m-p 0.0753 0.3765 0.0438 ++ 912.213373 m 0.3765 3041 | 1/17
92 h-m-p 0.1655 8.0000 0.0995 +C 912.212572 0 0.6711 3079 | 0/17
93 h-m-p 0.0000 0.0001 1211148.8277 ---YC 912.212460 1 0.0000 3119 | 0/17
94 h-m-p 0.3535 1.7674 0.0298 ++ 912.211456 m 1.7674 3139 | 1/17
95 h-m-p 0.4780 8.0000 0.1101 YCYC 912.209311 3 1.2221 3180 | 0/17
96 h-m-p 0.0000 0.0014 12076.8293 --C 912.209310 0 0.0000 3218 | 0/17
97 h-m-p 0.0183 8.0000 0.1309 ++YC 912.208359 1 0.5000 3241 | 0/17
98 h-m-p 0.0795 0.3975 0.0328 ++ 912.207943 m 0.3975 3278 | 1/17
99 h-m-p 0.1378 8.0000 0.0945 +YCCC 912.205195 3 1.1280 3321 | 0/17
100 h-m-p 0.0000 0.0009 3613.3089 ---Y 912.205195 0 0.0000 3360 | 0/17
101 h-m-p 0.0057 0.0286 0.0472 ++ 912.205140 m 0.0286 3380 | 1/17
102 h-m-p 0.0160 8.0000 0.3047 ++CYCC 912.201238 3 0.4888 3424 | 0/17
103 h-m-p 0.0000 0.0061 14370.4303 --C 912.201236 0 0.0000 3462 | 0/17
104 h-m-p 0.0431 8.0000 0.0596 +++YYC 912.194953 2 2.5630 3487 | 0/17
105 h-m-p 0.0256 0.1280 0.1135 ++ 912.194374 m 0.1280 3524 | 1/17
106 h-m-p 0.0355 8.0000 0.4086 ++YYC 912.189802 2 0.5100 3565 | 0/17
107 h-m-p 0.0000 0.0003 22189.7185 --Y 912.189797 0 0.0000 3603 | 0/17
108 h-m-p 0.0247 8.0000 0.2417 +++YC 912.184765 1 0.9889 3627 | 0/17
109 h-m-p 0.0132 0.0660 0.3369 ++ 912.184550 m 0.0660 3664 | 1/17
110 h-m-p 0.0984 8.0000 0.2262 ++CC 912.180666 1 1.5422 3705 | 1/17
111 h-m-p 1.6000 8.0000 0.0432 YC 912.177519 1 2.7872 3742 | 1/17
112 h-m-p 1.0885 8.0000 0.1107 C 912.177027 0 1.1755 3778 | 1/17
113 h-m-p 1.6000 8.0000 0.0177 CC 912.176720 1 2.3275 3816 | 1/17
114 h-m-p 1.1559 8.0000 0.0356 YC 912.176228 1 2.4266 3853 | 1/17
115 h-m-p 1.6000 8.0000 0.0133 YC 912.175993 1 1.1582 3890 | 1/17
116 h-m-p 1.5611 8.0000 0.0099 Y 912.175986 0 1.1298 3926 | 1/17
117 h-m-p 1.6000 8.0000 0.0004 Y 912.175986 0 1.0790 3962 | 1/17
118 h-m-p 1.3065 8.0000 0.0003 Y 912.175986 0 0.8836 3998 | 1/17
119 h-m-p 1.6000 8.0000 0.0000 C 912.175986 0 1.6000 4034 | 1/17
120 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 1/17
121 h-m-p 0.0160 8.0000 0.0002 ----------C 912.175986 0 0.0000 4130
Out..
lnL = -912.175986
4131 lfun, 16524 eigenQcodon, 136323 P(t)
Time used: 1:07
Model 7: beta
TREE # 1
(1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
0.034811 0.035667 0.043640 0.067296 0.113030 0.229552 0.157371 0.174778 0.007709 0.030481 0.010856 2.484765 0.496071 1.323761
ntime & nrate & np: 11 1 14
Bounds (np=14):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.301670
np = 14
lnL0 = -933.852936
Iterating by ming2
Initial: fx= 933.852936
x= 0.03481 0.03567 0.04364 0.06730 0.11303 0.22955 0.15737 0.17478 0.00771 0.03048 0.01086 2.48476 0.49607 1.32376
1 h-m-p 0.0000 0.0009 79.3328 +++YYCC 932.161849 3 0.0006 26 | 0/14
2 h-m-p 0.0001 0.0020 319.8337 YYCCC 930.702990 4 0.0002 49 | 0/14
3 h-m-p 0.0002 0.0009 219.5674 ++ 922.908072 m 0.0009 66 | 0/14
4 h-m-p 0.0001 0.0003 803.2924 YCYCCC 918.357097 5 0.0002 91 | 0/14
5 h-m-p 0.0006 0.0030 30.9369 CYC 918.099152 2 0.0007 111 | 0/14
6 h-m-p 0.0012 0.0107 18.5935 CCCC 917.898433 3 0.0015 134 | 0/14
7 h-m-p 0.0029 0.0301 9.8176 CCCC 917.711937 3 0.0045 157 | 0/14
8 h-m-p 0.0027 0.0137 14.6377 YCCCC 917.406614 4 0.0056 181 | 0/14
9 h-m-p 0.0025 0.0240 32.8803 CCC 917.028026 2 0.0037 202 | 0/14
10 h-m-p 0.0029 0.0147 38.6551 CCCCC 916.524716 4 0.0040 227 | 0/14
11 h-m-p 0.0048 0.0241 21.7525 YYC 916.268510 2 0.0039 246 | 0/14
12 h-m-p 0.0095 0.0474 5.9494 CCC 916.227277 2 0.0029 267 | 0/14
13 h-m-p 0.0211 0.6594 0.8083 ++YYYYYCCCCC 913.663076 9 0.3488 299 | 0/14
14 h-m-p 0.0020 0.0099 26.7116 CCCC 913.250791 3 0.0024 336 | 0/14
15 h-m-p 0.1459 4.1222 0.4331 +CCCC 912.914307 3 0.7293 360 | 0/14
16 h-m-p 1.0022 6.3657 0.3152 YCC 912.800891 2 0.7452 394 | 0/14
17 h-m-p 0.9383 7.1041 0.2503 YCCC 912.556389 3 1.9131 430 | 0/14
18 h-m-p 0.6567 3.2837 0.4016 YYCCCCC 912.377948 6 0.7511 471 | 0/14
19 h-m-p 0.8378 4.1888 0.2623 YCCC 912.331498 3 0.5131 507 | 0/14
20 h-m-p 1.2516 8.0000 0.1075 YC 912.310129 1 0.5814 539 | 0/14
21 h-m-p 1.6000 8.0000 0.0224 CYC 912.287713 2 1.4017 573 | 0/14
22 h-m-p 0.4066 8.0000 0.0771 +YCC 912.265832 2 1.1535 608 | 0/14
23 h-m-p 1.6000 8.0000 0.0438 YC 912.257507 1 0.6499 640 | 0/14
24 h-m-p 1.6000 8.0000 0.0138 YC 912.256243 1 0.7089 672 | 0/14
25 h-m-p 1.6000 8.0000 0.0006 YC 912.256205 1 0.8358 704 | 0/14
26 h-m-p 1.6000 8.0000 0.0001 Y 912.256202 0 0.9049 735 | 0/14
27 h-m-p 1.6000 8.0000 0.0000 Y 912.256202 0 0.8347 766 | 0/14
28 h-m-p 1.6000 8.0000 0.0000 Y 912.256202 0 0.6477 797 | 0/14
29 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/14
30 h-m-p 0.0160 8.0000 0.0008 ------------- | 0/14
31 h-m-p 0.0160 8.0000 0.0008 -------------
Out..
lnL = -912.256202
927 lfun, 10197 eigenQcodon, 101970 P(t)
Time used: 1:38
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
initial w for M8:NSbetaw>1 reset.
0.034811 0.035667 0.043640 0.067296 0.113030 0.229552 0.157371 0.174778 0.007709 0.030481 0.010856 2.475377 0.900000 0.225525 1.016293 2.374037
ntime & nrate & np: 11 2 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.552653
np = 16
lnL0 = -935.133523
Iterating by ming2
Initial: fx= 935.133523
x= 0.03481 0.03567 0.04364 0.06730 0.11303 0.22955 0.15737 0.17478 0.00771 0.03048 0.01086 2.47538 0.90000 0.22553 1.01629 2.37404
1 h-m-p 0.0000 0.0006 202.8848 +++ 919.454981 m 0.0006 38 | 1/16
2 h-m-p 0.0001 0.0005 127.2654 +CCYCC 916.646356 4 0.0004 81 | 1/16
3 h-m-p 0.0000 0.0001 707.0653 +YCCCC 914.674019 4 0.0001 123 | 1/16
4 h-m-p 0.0009 0.0044 38.0526 YCCC 914.432433 3 0.0004 162 | 0/16
5 h-m-p 0.0003 0.0037 67.3770 CYC 913.921378 2 0.0003 199 | 0/16
6 h-m-p 0.0013 0.0085 15.6137 CCC 913.740091 2 0.0019 238 | 0/16
7 h-m-p 0.0017 0.0092 16.6547 YYC 913.640241 2 0.0014 275 | 0/16
8 h-m-p 0.0039 0.0308 5.9108 YC 913.616697 1 0.0017 311 | 0/16
9 h-m-p 0.0015 0.0573 6.6612 CC 913.599605 1 0.0015 348 | 0/16
10 h-m-p 0.0028 0.1568 3.4776 +CC 913.518567 1 0.0177 386 | 0/16
11 h-m-p 0.0019 0.0317 32.9381 +CCCCC 913.123352 4 0.0085 430 | 0/16
12 h-m-p 0.0030 0.0148 80.1855 CCCCC 912.665875 4 0.0041 473 | 0/16
13 h-m-p 0.0037 0.0186 21.9786 YYC 912.579721 2 0.0031 510 | 0/16
14 h-m-p 0.0082 0.0408 2.5554 CC 912.573448 1 0.0024 547 | 0/16
15 h-m-p 0.0036 0.3445 1.7377 ++YCCCC 912.289906 4 0.1464 591 | 0/16
16 h-m-p 0.7605 7.9300 0.3344 YCC 912.209498 2 0.5300 629 | 0/16
17 h-m-p 1.5767 8.0000 0.1124 CC 912.200351 1 0.4876 666 | 0/16
18 h-m-p 1.6000 8.0000 0.0342 YC 912.197579 1 1.2510 702 | 0/16
19 h-m-p 1.6000 8.0000 0.0257 C 912.195768 0 1.6000 737 | 0/16
20 h-m-p 0.8720 8.0000 0.0472 YC 912.193966 1 1.6278 773 | 0/16
21 h-m-p 1.6000 8.0000 0.0428 YC 912.193061 1 1.0482 809 | 0/16
22 h-m-p 1.6000 8.0000 0.0170 YC 912.192671 1 1.2375 845 | 0/16
23 h-m-p 1.6000 8.0000 0.0076 C 912.192437 0 1.4602 880 | 0/16
24 h-m-p 1.6000 8.0000 0.0063 +YC 912.192094 1 4.4335 917 | 0/16
25 h-m-p 0.9626 8.0000 0.0289 +CC 912.190774 1 4.3400 955 | 0/16
26 h-m-p 1.3760 6.8802 0.0709 CC 912.188821 1 2.2845 992 | 0/16
27 h-m-p 1.6000 8.0000 0.0619 YC 912.188186 1 0.8621 1028 | 0/16
28 h-m-p 0.6154 3.2266 0.0868 C 912.187909 0 0.6154 1063 | 0/16
29 h-m-p 1.6000 8.0000 0.0317 CC 912.187745 1 1.2475 1100 | 0/16
30 h-m-p 1.6000 8.0000 0.0189 YC 912.187716 1 1.0016 1136 | 0/16
31 h-m-p 1.6000 8.0000 0.0043 Y 912.187714 0 1.0018 1171 | 0/16
32 h-m-p 1.6000 8.0000 0.0014 Y 912.187714 0 1.1832 1206 | 0/16
33 h-m-p 1.6000 8.0000 0.0003 C 912.187714 0 1.9036 1241 | 0/16
34 h-m-p 1.6000 8.0000 0.0002 Y 912.187714 0 1.0742 1276 | 0/16
35 h-m-p 1.6000 8.0000 0.0001 Y 912.187714 0 0.8796 1311 | 0/16
36 h-m-p 1.6000 8.0000 0.0000 Y 912.187714 0 1.2399 1346 | 0/16
37 h-m-p 1.4427 8.0000 0.0000 --------Y 912.187714 0 0.0000 1389
Out..
lnL = -912.187714
1390 lfun, 16680 eigenQcodon, 168190 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -925.176428 S = -883.657186 -33.922695
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 94 patterns 2:30
did 20 / 94 patterns 2:31
did 30 / 94 patterns 2:31
did 40 / 94 patterns 2:31
did 50 / 94 patterns 2:31
did 60 / 94 patterns 2:31
did 70 / 94 patterns 2:32
did 80 / 94 patterns 2:32
did 90 / 94 patterns 2:32
did 94 / 94 patterns 2:32
Time used: 2:32
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=134
D_melanogaster_CG30273-PB MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
D_sechellia_CG30273-PB MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
D_simulans_CG30273-PB MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
D_yakuba_CG30273-PB MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
D_erecta_CG30273-PB MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
D_biarmipes_CG30273-PB MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
D_suzukii_CG30273-PB MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
****** .*** ** ************** **** . ****:*****
D_melanogaster_CG30273-PB QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
D_sechellia_CG30273-PB QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
D_simulans_CG30273-PB QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
D_yakuba_CG30273-PB QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
D_erecta_CG30273-PB QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
D_biarmipes_CG30273-PB QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
D_suzukii_CG30273-PB QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
*:.*******:********:******:******** :*************
D_melanogaster_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
D_sechellia_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
D_simulans_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
D_yakuba_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
D_erecta_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
D_biarmipes_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
D_suzukii_CG30273-PB CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo
***************************.*
>D_melanogaster_CG30273-PB ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA GATGCCCCCACCGAGCTATGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC GGGTGGTTCACCACACGACAGCACCTCCGCCCGTGGTGATCATACAACAT CAAGCTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGTGTGAAAA CTCACTGCATGGCCGCCATTCTATGCATCGTTGGCCTCTGGTGTTGTGCC TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT------------- -- >D_sechellia_CG30273-PB ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGATC GGGTGGTTCACCACACGGCAGCACCTCCGCCCATGGTGATCATACAACAT CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG CAATTGCAATAAGTTCGTCGGCGTCTACAACAGTGAT------------- -- >D_simulans_CG30273-PB ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC GGGTGGTTCACCACACGGCAGCACCTCCGCCCGTGGTGATCATACAACAT CAAACTGTATTACCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT------------- -- >D_yakuba_CG30273-PB ATGCAGTACAATCAGCAGCCGGCGGGAGCCCCGGGCTATCCCACCCACCA GATGCCACCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCCATTC GGGTGGTTCACTCGACC---GCACCACCGCCCGTGGTGATCATACAACAT CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA CTGCCACATCCAGAAGCTGACTCGCGTGGAGTACTCGCCCAGTGTGAAGA CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT------------- -- >D_erecta_CG30273-PB ATGCAGTACAATCAGCAACCACCGGGAGCCACGGGCTATCCCCCCCACCA GGTGCCACCACCCAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAATTC GGGTGGTTCACTCGCCA---GCCCCGCCGCCCGTGGTGATCATACAACAT CAGACCGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA CTGCCATGTCCAGAAGCTGACCCGCGTGCAGTACTCGCCCAGTGTGAAAA CGCACTGCATGGCCGCCATTCTGTGCATCGTTGGCCTCTGGTGCTGTGCC TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG CAATTGCAACAAGTTCGTCGGCGTCTACAACAGCGAT------------- -- >D_biarmipes_CG30273-PB ATGCAGTACAACCAACAGCAG---------CCGGGGTATCCG---CACCA GACGCCTCCTCCGAGCTACGAGCAAGTGGTCCATGTGCAGGCGCCAGTTC GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT CAAGCCGTGCTACCCGTGGGTCCCGACCCCAGTTTCATCACCTGCCCGCA CTGTCACGTCCAGAAACTGACCCGCGTCGAGTACTCGCCCAGTGTGAAAA CGCACGTCATGGCCGCCATTCTCTGCATAGTTGGCCTCTGGTGCTGCGCC TGTCTTCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG CAATTGCAACAAGTTCGTCGGCGTCTACAACGGCGAT------------- -- >D_suzukii_CG30273-PB ATGCAGTACAATCAACAA------------CCGGGGTATCCA---CATCA GATGCCGCCACCGAGCTACGAGCAAGTGGTCCATGTTCAGGCGCCAGTTC GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT CAAGCTGCATTGCCCGTGGGTCCCGATCCCAGCTTCATCACGTGCCCACA TTGTCATGTCCAGAAACTGACCCGCGTTGAGTATTCGCCGAGTGTTAAAA CACACGTTATAGCCGCCATTCTCTGCATAGTCGGCCTCTGGTGTTGCGCC TGCCTGCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG CAATTGCAACAAGTTCGTCGGCGTGTACAACAGCGAT------------- --
>D_melanogaster_CG30273-PB MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNSD >D_sechellia_CG30273-PB MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNSD >D_simulans_CG30273-PB MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNSD >D_yakuba_CG30273-PB MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNSD >D_erecta_CG30273-PB MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNSD >D_biarmipes_CG30273-PB MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNGD >D_suzukii_CG30273-PB MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA CLPYCATSCMNANHFCGNCNKFVGVYNSD
#NEXUS
[ID: 5152428019]
begin taxa;
dimensions ntax=7;
taxlabels
D_melanogaster_CG30273-PB
D_sechellia_CG30273-PB
D_simulans_CG30273-PB
D_yakuba_CG30273-PB
D_erecta_CG30273-PB
D_biarmipes_CG30273-PB
D_suzukii_CG30273-PB
;
end;
begin trees;
translate
1 D_melanogaster_CG30273-PB,
2 D_sechellia_CG30273-PB,
3 D_simulans_CG30273-PB,
4 D_yakuba_CG30273-PB,
5 D_erecta_CG30273-PB,
6 D_biarmipes_CG30273-PB,
7 D_suzukii_CG30273-PB
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02117146,((4:0.03368785,5:0.08031628)0.946:0.03858364,(6:0.08867605,7:0.09739303)1.000:0.1822121)0.740:0.02254327,(2:0.0177327,3:0.006309344)0.691:0.007645742);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02117146,((4:0.03368785,5:0.08031628):0.03858364,(6:0.08867605,7:0.09739303):0.1822121):0.02254327,(2:0.0177327,3:0.006309344):0.007645742);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1036.00 -1048.42
2 -1036.01 -1047.81
--------------------------------------
TOTAL -1036.00 -1048.16
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.624995 0.012503 0.438680 0.863462 0.611797 1249.03 1375.01 1.000
r(A<->C){all} 0.105391 0.001385 0.038143 0.181528 0.101938 837.82 881.02 1.000
r(A<->G){all} 0.311309 0.004988 0.174282 0.444794 0.307842 666.23 713.82 1.000
r(A<->T){all} 0.050957 0.001008 0.001344 0.109184 0.046350 651.22 711.42 1.000
r(C<->G){all} 0.087632 0.000906 0.030816 0.145342 0.085079 833.08 989.05 1.000
r(C<->T){all} 0.369866 0.004975 0.243559 0.516242 0.365753 672.25 740.70 1.001
r(G<->T){all} 0.074845 0.001259 0.014436 0.144237 0.070880 703.06 865.65 1.000
pi(A){all} 0.205809 0.000370 0.170731 0.245775 0.205589 1153.10 1255.89 1.000
pi(C){all} 0.340978 0.000497 0.295693 0.383798 0.340912 1030.76 1160.42 1.001
pi(G){all} 0.257333 0.000418 0.217707 0.297151 0.257194 1236.59 1283.30 1.000
pi(T){all} 0.195880 0.000352 0.160405 0.233346 0.195810 1131.40 1153.42 1.000
alpha{1,2} 0.092558 0.002990 0.000206 0.181726 0.093588 979.09 1144.70 1.000
alpha{3} 1.917777 0.615414 0.653820 3.433554 1.782068 1320.72 1360.63 1.000
pinvar{all} 0.284450 0.012594 0.069792 0.495317 0.288632 922.30 1132.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/105/CG30273-PB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 123
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 0 1 0 1 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 2 1 1 1 1 1 | Cys TGT 2 2 2 2 1 2
TTC 2 3 2 3 2 3 | TCC 0 0 0 0 0 0 | TAC 4 5 5 5 5 5 | TGC 9 9 9 9 10 8
Leu TTA 0 0 1 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 0 1 1 0 | TCG 1 1 1 2 2 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 1 | Pro CCT 2 2 2 0 0 3 | His CAT 3 3 3 1 2 2 | Arg CGT 0 0 0 0 0 0
CTC 1 2 2 2 1 2 | CCC 5 5 5 6 6 5 | CAC 6 6 6 7 6 6 | CGC 1 1 1 1 1 1
CTA 1 0 0 0 0 1 | CCA 2 2 2 3 4 1 | Gln CAA 2 2 2 2 2 4 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 3 1 | CCG 6 6 6 6 5 6 | CAG 7 7 7 7 8 5 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 2 2 1 | Thr ACT 1 1 1 2 0 0 | Asn AAT 4 4 4 4 3 3 | Ser AGT 1 1 0 1 1 2
ATC 3 3 3 4 3 2 | ACC 4 4 4 4 5 3 | AAC 2 2 2 2 3 3 | AGC 3 3 4 3 3 2
ATA 1 1 1 1 1 2 | ACA 0 0 0 0 0 2 | Lys AAA 2 2 2 0 1 2 | Arg AGA 0 0 0 0 0 0
Met ATG 4 5 4 4 3 3 | ACG 1 2 2 1 2 2 | AAG 1 1 1 3 2 1 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 2 3 2 2 3 | Ala GCT 1 0 0 0 0 0 | Asp GAT 2 3 2 2 2 1 | Gly GGT 1 1 1 1 1 1
GTC 3 3 3 2 3 6 | GCC 5 5 5 5 6 5 | GAC 0 0 0 0 0 1 | GGC 4 4 4 4 4 4
GTA 1 1 1 1 1 0 | GCA 1 1 1 1 0 2 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 9 8 9 9 10 8 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 1 2 | GGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 0 | Ser TCT 0 | Tyr TAT 2 | Cys TGT 2
TTC 3 | TCC 0 | TAC 4 | TGC 8
Leu TTA 0 | TCA 0 | *** TAA 0 | *** TGA 0
TTG 1 | TCG 1 | TAG 0 | Trp TGG 1
------------------------------------------------------
Leu CTT 0 | Pro CCT 1 | His CAT 5 | Arg CGT 0
CTC 2 | CCC 4 | CAC 3 | CGC 1
CTA 0 | CCA 4 | Gln CAA 5 | CGA 0
CTG 2 | CCG 6 | CAG 4 | CGG 1
------------------------------------------------------
Ile ATT 1 | Thr ACT 0 | Asn AAT 4 | Ser AGT 1
ATC 2 | ACC 2 | AAC 2 | AGC 4
ATA 3 | ACA 3 | Lys AAA 2 | Arg AGA 0
Met ATG 3 | ACG 1 | AAG 1 | AGG 0
------------------------------------------------------
Val GTT 6 | Ala GCT 1 | Asp GAT 2 | Gly GGT 1
GTC 4 | GCC 4 | GAC 0 | GGC 3
GTA 0 | GCA 3 | Glu GAA 0 | GGA 0
GTG 6 | GCG 1 | GAG 2 | GGG 1
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_CG30273-PB
position 1: T:0.18699 C:0.31707 A:0.22764 G:0.26829
position 2: T:0.26829 C:0.24390 A:0.30081 G:0.18699
position 3: T:0.19512 C:0.42276 A:0.08130 G:0.30081
Average T:0.21680 C:0.32791 A:0.20325 G:0.25203
#2: D_sechellia_CG30273-PB
position 1: T:0.18699 C:0.31707 A:0.24390 G:0.25203
position 2: T:0.26016 C:0.24390 A:0.30894 G:0.18699
position 3: T:0.17073 C:0.44715 A:0.07317 G:0.30894
Average T:0.20596 C:0.33604 A:0.20867 G:0.24932
#3: D_simulans_CG30273-PB
position 1: T:0.18699 C:0.31707 A:0.23577 G:0.26016
position 2: T:0.26829 C:0.24390 A:0.30081 G:0.18699
position 3: T:0.17073 C:0.44715 A:0.08130 G:0.30081
Average T:0.20867 C:0.33604 A:0.20596 G:0.24932
#4: D_yakuba_CG30273-PB
position 1: T:0.19512 C:0.30894 A:0.25203 G:0.24390
position 2: T:0.26829 C:0.25203 A:0.29268 G:0.18699
position 3: T:0.14634 C:0.46341 A:0.06504 G:0.32520
Average T:0.20325 C:0.34146 A:0.20325 G:0.25203
#5: D_erecta_CG30273-PB
position 1: T:0.19512 C:0.31707 A:0.23577 G:0.25203
position 2: T:0.26829 C:0.25203 A:0.29268 G:0.18699
position 3: T:0.13008 C:0.47154 A:0.07317 G:0.32520
Average T:0.19783 C:0.34688 A:0.20054 G:0.25474
#6: D_biarmipes_CG30273-PB
position 1: T:0.17073 C:0.31707 A:0.22764 G:0.28455
position 2: T:0.26829 C:0.25203 A:0.29268 G:0.18699
position 3: T:0.16260 C:0.45528 A:0.11382 G:0.26829
Average T:0.20054 C:0.34146 A:0.21138 G:0.24661
#7: D_suzukii_CG30273-PB
position 1: T:0.17886 C:0.30894 A:0.23577 G:0.27642
position 2: T:0.26829 C:0.25203 A:0.29268 G:0.18699
position 3: T:0.21138 C:0.37398 A:0.16260 G:0.25203
Average T:0.21951 C:0.31165 A:0.23035 G:0.23848
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 3 | Ser S TCT 0 | Tyr Y TAT 9 | Cys C TGT 13
TTC 18 | TCC 0 | TAC 33 | TGC 62
Leu L TTA 1 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 5 | TCG 9 | TAG 0 | Trp W TGG 7
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 10 | His H CAT 19 | Arg R CGT 0
CTC 12 | CCC 36 | CAC 40 | CGC 7
CTA 2 | CCA 18 | Gln Q CAA 19 | CGA 0
CTG 14 | CCG 41 | CAG 45 | CGG 7
------------------------------------------------------------------------------
Ile I ATT 9 | Thr T ACT 5 | Asn N AAT 26 | Ser S AGT 7
ATC 20 | ACC 26 | AAC 16 | AGC 22
ATA 10 | ACA 5 | Lys K AAA 11 | Arg R AGA 0
Met M ATG 26 | ACG 11 | AAG 10 | AGG 0
------------------------------------------------------------------------------
Val V GTT 21 | Ala A GCT 2 | Asp D GAT 14 | Gly G GGT 7
GTC 24 | GCC 35 | GAC 1 | GGC 27
GTA 5 | GCA 9 | Glu E GAA 0 | GGA 0
GTG 59 | GCG 7 | GAG 13 | GGG 2
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18583 C:0.31475 A:0.23693 G:0.26249
position 2: T:0.26713 C:0.24855 A:0.29733 G:0.18699
position 3: T:0.16957 C:0.44019 A:0.09292 G:0.29733
Average T:0.20751 C:0.33449 A:0.20906 G:0.24894
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_CG30273-PB
D_sechellia_CG30273-PB 0.1384 (0.0106 0.0763)
D_simulans_CG30273-PB 0.0564 (0.0035 0.0623) 0.1884 (0.0070 0.0372)
D_yakuba_CG30273-PB 0.0926 (0.0186 0.2011) 0.1281 (0.0221 0.1728) 0.0809 (0.0150 0.1859)
D_erecta_CG30273-PB 0.1285 (0.0296 0.2302) 0.1324 (0.0331 0.2501) 0.1124 (0.0259 0.2306) 0.0876 (0.0178 0.2029)
D_biarmipes_CG30273-PB 0.0439 (0.0269 0.6115) 0.0662 (0.0378 0.5704) 0.0568 (0.0305 0.5369) 0.0539 (0.0324 0.5998) 0.0738 (0.0436 0.5905)
D_suzukii_CG30273-PB 0.0473 (0.0268 0.5665) 0.0683 (0.0377 0.5517) 0.0536 (0.0304 0.5679) 0.0467 (0.0323 0.6916) 0.0639 (0.0435 0.6802) 0.0330 (0.0142 0.4312)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
lnL(ntime: 11 np: 13): -920.045838 +0.000000
8..1 8..9 9..10 10..4 10..5 9..11 11..6 11..7 8..12 12..2 12..3
0.034575 0.028607 0.060903 0.068991 0.130690 0.267021 0.168333 0.144821 0.008964 0.035180 0.008662 2.443509 0.058526
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.95675
(1: 0.034575, ((4: 0.068991, 5: 0.130690): 0.060903, (6: 0.168333, 7: 0.144821): 0.267021): 0.028607, (2: 0.035180, 3: 0.008662): 0.008964);
(D_melanogaster_CG30273-PB: 0.034575, ((D_yakuba_CG30273-PB: 0.068991, D_erecta_CG30273-PB: 0.130690): 0.060903, (D_biarmipes_CG30273-PB: 0.168333, D_suzukii_CG30273-PB: 0.144821): 0.267021): 0.028607, (D_sechellia_CG30273-PB: 0.035180, D_simulans_CG30273-PB: 0.008662): 0.008964);
Detailed output identifying parameters
kappa (ts/tv) = 2.44351
omega (dN/dS) = 0.05853
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.035 289.2 79.8 0.0585 0.0026 0.0440 0.7 3.5
8..9 0.029 289.2 79.8 0.0585 0.0021 0.0364 0.6 2.9
9..10 0.061 289.2 79.8 0.0585 0.0045 0.0775 1.3 6.2
10..4 0.069 289.2 79.8 0.0585 0.0051 0.0877 1.5 7.0
10..5 0.131 289.2 79.8 0.0585 0.0097 0.1662 2.8 13.3
9..11 0.267 289.2 79.8 0.0585 0.0199 0.3396 5.7 27.1
11..6 0.168 289.2 79.8 0.0585 0.0125 0.2141 3.6 17.1
11..7 0.145 289.2 79.8 0.0585 0.0108 0.1842 3.1 14.7
8..12 0.009 289.2 79.8 0.0585 0.0007 0.0114 0.2 0.9
12..2 0.035 289.2 79.8 0.0585 0.0026 0.0447 0.8 3.6
12..3 0.009 289.2 79.8 0.0585 0.0006 0.0110 0.2 0.9
tree length for dN: 0.0712
tree length for dS: 1.2168
Time used: 0:04
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
lnL(ntime: 11 np: 14): -912.436350 +0.000000
8..1 8..9 9..10 10..4 10..5 9..11 11..6 11..7 8..12 12..2 12..3
0.035145 0.033409 0.058173 0.073181 0.135224 0.287404 0.177434 0.155043 0.009169 0.035704 0.008779 2.513124 0.937371 0.022844
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.00866
(1: 0.035145, ((4: 0.073181, 5: 0.135224): 0.058173, (6: 0.177434, 7: 0.155043): 0.287404): 0.033409, (2: 0.035704, 3: 0.008779): 0.009169);
(D_melanogaster_CG30273-PB: 0.035145, ((D_yakuba_CG30273-PB: 0.073181, D_erecta_CG30273-PB: 0.135224): 0.058173, (D_biarmipes_CG30273-PB: 0.177434, D_suzukii_CG30273-PB: 0.155043): 0.287404): 0.033409, (D_sechellia_CG30273-PB: 0.035704, D_simulans_CG30273-PB: 0.008779): 0.009169);
Detailed output identifying parameters
kappa (ts/tv) = 2.51312
dN/dS (w) for site classes (K=2)
p: 0.93737 0.06263
w: 0.02284 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.035 288.9 80.1 0.0840 0.0035 0.0414 1.0 3.3
8..9 0.033 288.9 80.1 0.0840 0.0033 0.0394 1.0 3.2
9..10 0.058 288.9 80.1 0.0840 0.0058 0.0686 1.7 5.5
10..4 0.073 288.9 80.1 0.0840 0.0072 0.0863 2.1 6.9
10..5 0.135 288.9 80.1 0.0840 0.0134 0.1594 3.9 12.8
9..11 0.287 288.9 80.1 0.0840 0.0285 0.3388 8.2 27.1
11..6 0.177 288.9 80.1 0.0840 0.0176 0.2091 5.1 16.7
11..7 0.155 288.9 80.1 0.0840 0.0154 0.1827 4.4 14.6
8..12 0.009 288.9 80.1 0.0840 0.0009 0.0108 0.3 0.9
12..2 0.036 288.9 80.1 0.0840 0.0035 0.0421 1.0 3.4
12..3 0.009 288.9 80.1 0.0840 0.0009 0.0103 0.3 0.8
Time used: 0:09
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
lnL(ntime: 11 np: 16): -912.436351 +0.000000
8..1 8..9 9..10 10..4 10..5 9..11 11..6 11..7 8..12 12..2 12..3
0.035145 0.033409 0.058173 0.073181 0.135224 0.287404 0.177434 0.155043 0.009169 0.035704 0.008779 2.513025 0.937371 0.062629 0.022844 38.371335
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.00866
(1: 0.035145, ((4: 0.073181, 5: 0.135224): 0.058173, (6: 0.177434, 7: 0.155043): 0.287404): 0.033409, (2: 0.035704, 3: 0.008779): 0.009169);
(D_melanogaster_CG30273-PB: 0.035145, ((D_yakuba_CG30273-PB: 0.073181, D_erecta_CG30273-PB: 0.135224): 0.058173, (D_biarmipes_CG30273-PB: 0.177434, D_suzukii_CG30273-PB: 0.155043): 0.287404): 0.033409, (D_sechellia_CG30273-PB: 0.035704, D_simulans_CG30273-PB: 0.008779): 0.009169);
Detailed output identifying parameters
kappa (ts/tv) = 2.51302
dN/dS (w) for site classes (K=3)
p: 0.93737 0.06263 0.00000
w: 0.02284 1.00000 38.37133
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.035 288.9 80.1 0.0840 0.0035 0.0414 1.0 3.3
8..9 0.033 288.9 80.1 0.0840 0.0033 0.0394 1.0 3.2
9..10 0.058 288.9 80.1 0.0840 0.0058 0.0686 1.7 5.5
10..4 0.073 288.9 80.1 0.0840 0.0072 0.0863 2.1 6.9
10..5 0.135 288.9 80.1 0.0840 0.0134 0.1594 3.9 12.8
9..11 0.287 288.9 80.1 0.0840 0.0285 0.3388 8.2 27.1
11..6 0.177 288.9 80.1 0.0840 0.0176 0.2091 5.1 16.7
11..7 0.155 288.9 80.1 0.0840 0.0154 0.1827 4.4 14.6
8..12 0.009 288.9 80.1 0.0840 0.0009 0.0108 0.3 0.9
12..2 0.036 288.9 80.1 0.0840 0.0035 0.0421 1.0 3.4
12..3 0.009 288.9 80.1 0.0840 0.0009 0.0103 0.3 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30273-PB)
Pr(w>1) post mean +- SE for w
33 H 0.675 2.427 +- 1.965
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.418 0.211 0.116 0.072 0.050 0.038 0.030 0.025 0.021 0.019
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.015 0.981
sum of density on p0-p1 = 1.000000
Time used: 0:26
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
lnL(ntime: 11 np: 17): -912.175986 +0.000000
8..1 8..9 9..10 10..4 10..5 9..11 11..6 11..7 8..12 12..2 12..3
0.034916 0.031802 0.059481 0.072187 0.135336 0.284799 0.177103 0.152235 0.009122 0.035501 0.008719 2.484765 0.786764 0.188600 0.000001 0.240764 1.215634
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.00120
(1: 0.034916, ((4: 0.072187, 5: 0.135336): 0.059481, (6: 0.177103, 7: 0.152235): 0.284799): 0.031802, (2: 0.035501, 3: 0.008719): 0.009122);
(D_melanogaster_CG30273-PB: 0.034916, ((D_yakuba_CG30273-PB: 0.072187, D_erecta_CG30273-PB: 0.135336): 0.059481, (D_biarmipes_CG30273-PB: 0.177103, D_suzukii_CG30273-PB: 0.152235): 0.284799): 0.031802, (D_sechellia_CG30273-PB: 0.035501, D_simulans_CG30273-PB: 0.008719): 0.009122);
Detailed output identifying parameters
kappa (ts/tv) = 2.48476
dN/dS (w) for site classes (K=3)
p: 0.78676 0.18860 0.02464
w: 0.00000 0.24076 1.21563
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.035 289.0 80.0 0.0754 0.0032 0.0422 0.9 3.4
8..9 0.032 289.0 80.0 0.0754 0.0029 0.0384 0.8 3.1
9..10 0.059 289.0 80.0 0.0754 0.0054 0.0719 1.6 5.7
10..4 0.072 289.0 80.0 0.0754 0.0066 0.0873 1.9 7.0
10..5 0.135 289.0 80.0 0.0754 0.0123 0.1636 3.6 13.1
9..11 0.285 289.0 80.0 0.0754 0.0259 0.3443 7.5 27.5
11..6 0.177 289.0 80.0 0.0754 0.0161 0.2141 4.7 17.1
11..7 0.152 289.0 80.0 0.0754 0.0139 0.1841 4.0 14.7
8..12 0.009 289.0 80.0 0.0754 0.0008 0.0110 0.2 0.9
12..2 0.036 289.0 80.0 0.0754 0.0032 0.0429 0.9 3.4
12..3 0.009 289.0 80.0 0.0754 0.0008 0.0105 0.2 0.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30273-PB)
Pr(w>1) post mean +- SE for w
33 H 0.824 1.044
Time used: 1:07
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
check convergence..
lnL(ntime: 11 np: 14): -912.256202 +0.000000
8..1 8..9 9..10 10..4 10..5 9..11 11..6 11..7 8..12 12..2 12..3
0.034977 0.031599 0.059880 0.071268 0.134454 0.281967 0.174895 0.150438 0.009096 0.035630 0.008755 2.475377 0.073586 0.888730
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99296
(1: 0.034977, ((4: 0.071268, 5: 0.134454): 0.059880, (6: 0.174895, 7: 0.150438): 0.281967): 0.031599, (2: 0.035630, 3: 0.008755): 0.009096);
(D_melanogaster_CG30273-PB: 0.034977, ((D_yakuba_CG30273-PB: 0.071268, D_erecta_CG30273-PB: 0.134454): 0.059880, (D_biarmipes_CG30273-PB: 0.174895, D_suzukii_CG30273-PB: 0.150438): 0.281967): 0.031599, (D_sechellia_CG30273-PB: 0.035630, D_simulans_CG30273-PB: 0.008755): 0.009096);
Detailed output identifying parameters
kappa (ts/tv) = 2.47538
Parameters in M7 (beta):
p = 0.07359 q = 0.88873
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00002 0.00036 0.00346 0.02416 0.13083 0.56027
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.035 289.1 79.9 0.0719 0.0031 0.0427 0.9 3.4
8..9 0.032 289.1 79.9 0.0719 0.0028 0.0386 0.8 3.1
9..10 0.060 289.1 79.9 0.0719 0.0053 0.0731 1.5 5.8
10..4 0.071 289.1 79.9 0.0719 0.0063 0.0870 1.8 7.0
10..5 0.134 289.1 79.9 0.0719 0.0118 0.1642 3.4 13.1
9..11 0.282 289.1 79.9 0.0719 0.0248 0.3444 7.2 27.5
11..6 0.175 289.1 79.9 0.0719 0.0154 0.2136 4.4 17.1
11..7 0.150 289.1 79.9 0.0719 0.0132 0.1837 3.8 14.7
8..12 0.009 289.1 79.9 0.0719 0.0008 0.0111 0.2 0.9
12..2 0.036 289.1 79.9 0.0719 0.0031 0.0435 0.9 3.5
12..3 0.009 289.1 79.9 0.0719 0.0008 0.0107 0.2 0.9
Time used: 1:38
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), (6, 7)), (2, 3)); MP score: 91
lnL(ntime: 11 np: 16): -912.187714 +0.000000
8..1 8..9 9..10 10..4 10..5 9..11 11..6 11..7 8..12 12..2 12..3
0.034943 0.031928 0.059377 0.072107 0.135095 0.284427 0.176638 0.152076 0.009118 0.035536 0.008730 2.483651 0.975615 0.097000 1.688481 1.139519
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.99998
(1: 0.034943, ((4: 0.072107, 5: 0.135095): 0.059377, (6: 0.176638, 7: 0.152076): 0.284427): 0.031928, (2: 0.035536, 3: 0.008730): 0.009118);
(D_melanogaster_CG30273-PB: 0.034943, ((D_yakuba_CG30273-PB: 0.072107, D_erecta_CG30273-PB: 0.135095): 0.059377, (D_biarmipes_CG30273-PB: 0.176638, D_suzukii_CG30273-PB: 0.152076): 0.284427): 0.031928, (D_sechellia_CG30273-PB: 0.035536, D_simulans_CG30273-PB: 0.008730): 0.009118);
Detailed output identifying parameters
kappa (ts/tv) = 2.48365
Parameters in M8 (beta&w>1):
p0 = 0.97562 p = 0.09700 q = 1.68848
(p1 = 0.02438) w = 1.13952
dN/dS (w) for site classes (K=11)
p: 0.09756 0.09756 0.09756 0.09756 0.09756 0.09756 0.09756 0.09756 0.09756 0.09756 0.02438
w: 0.00000 0.00000 0.00000 0.00001 0.00013 0.00101 0.00565 0.02502 0.09505 0.35560 1.13952
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.035 289.0 80.0 0.0749 0.0032 0.0423 0.9 3.4
8..9 0.032 289.0 80.0 0.0749 0.0029 0.0387 0.8 3.1
9..10 0.059 289.0 80.0 0.0749 0.0054 0.0719 1.6 5.7
10..4 0.072 289.0 80.0 0.0749 0.0065 0.0873 1.9 7.0
10..5 0.135 289.0 80.0 0.0749 0.0122 0.1636 3.5 13.1
9..11 0.284 289.0 80.0 0.0749 0.0258 0.3444 7.5 27.5
11..6 0.177 289.0 80.0 0.0749 0.0160 0.2139 4.6 17.1
11..7 0.152 289.0 80.0 0.0749 0.0138 0.1841 4.0 14.7
8..12 0.009 289.0 80.0 0.0749 0.0008 0.0110 0.2 0.9
12..2 0.036 289.0 80.0 0.0749 0.0032 0.0430 0.9 3.4
12..3 0.009 289.0 80.0 0.0749 0.0008 0.0106 0.2 0.8
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30273-PB)
Pr(w>1) post mean +- SE for w
33 H 0.741 0.935
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_CG30273-PB)
Pr(w>1) post mean +- SE for w
33 H 0.834 2.498 +- 1.948
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.010 0.037 0.091 0.173 0.281 0.407
ws: 0.464 0.219 0.112 0.065 0.043 0.030 0.023 0.018 0.014 0.012
Time used: 2:32
Model 1: NearlyNeutral -912.43635 Model 2: PositiveSelection -912.436351 Model 0: one-ratio -920.045838 Model 3: discrete -912.175986 Model 7: beta -912.256202 Model 8: beta&w>1 -912.187714 Model 0 vs 1 15.218976000000112 Model 2 vs 1 1.9999999949504854E-6 Model 8 vs 7 0.1369760000000042
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
