--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Nov 18 01:49:29 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/105/CG30273-PB/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1036.00         -1048.42
2      -1036.01         -1047.81
--------------------------------------
TOTAL    -1036.00         -1048.16
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.624995    0.012503    0.438680    0.863462    0.611797   1249.03   1375.01    1.000
r(A<->C){all}   0.105391    0.001385    0.038143    0.181528    0.101938    837.82    881.02    1.000
r(A<->G){all}   0.311309    0.004988    0.174282    0.444794    0.307842    666.23    713.82    1.000
r(A<->T){all}   0.050957    0.001008    0.001344    0.109184    0.046350    651.22    711.42    1.000
r(C<->G){all}   0.087632    0.000906    0.030816    0.145342    0.085079    833.08    989.05    1.000
r(C<->T){all}   0.369866    0.004975    0.243559    0.516242    0.365753    672.25    740.70    1.001
r(G<->T){all}   0.074845    0.001259    0.014436    0.144237    0.070880    703.06    865.65    1.000
pi(A){all}      0.205809    0.000370    0.170731    0.245775    0.205589   1153.10   1255.89    1.000
pi(C){all}      0.340978    0.000497    0.295693    0.383798    0.340912   1030.76   1160.42    1.001
pi(G){all}      0.257333    0.000418    0.217707    0.297151    0.257194   1236.59   1283.30    1.000
pi(T){all}      0.195880    0.000352    0.160405    0.233346    0.195810   1131.40   1153.42    1.000
alpha{1,2}      0.092558    0.002990    0.000206    0.181726    0.093588    979.09   1144.70    1.000
alpha{3}        1.917777    0.615414    0.653820    3.433554    1.782068   1320.72   1360.63    1.000
pinvar{all}     0.284450    0.012594    0.069792    0.495317    0.288632    922.30   1132.32    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-912.43635
Model 2: PositiveSelection	-912.436351
Model 0: one-ratio	-920.045838
Model 3: discrete	-912.175986
Model 7: beta	-912.256202
Model 8: beta&w>1	-912.187714


Model 0 vs 1	15.218976000000112

Model 2 vs 1	1.9999999949504854E-6

Model 8 vs 7	0.1369760000000042
>C1
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQHQ
AVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C2
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQHQ
TVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C3
MQYNQQPAGAPGYPHQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQHQ
TVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHSTAPPPVVIIQHQ
TVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSPAPPPVVIIQHQ
TVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCAC
LPYCATSCMNANHFCGNCNKFVGVYNSD
>C6
MQYNQQQPGYPHQTPPPSYEQVVHVQAPVRVVHTTAPPPVVIIQHQAVLP
VGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCACLPYC
ATSCMNANHFCGNCNKFVGVYNGDoooo
>C7
MQYNQQPGYPHQMPPPSYEQVVHVQAPVRVVHTTAPPPVVIIQHQAALPV
GPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCACLPYCA
TSCMNANHFCGNCNKFVGVYNSDooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=134 

C1              MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
C2              MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
C3              MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
C4              MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
C5              MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
C6              MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
C7              MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
                ******    .*** ** ************** **** . ****:*****

C1              QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C2              QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C3              QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C4              QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
C5              QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
C6              QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
C7              QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
                *:.*******:********:******:******** :*************

C1              CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C2              CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C3              CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C4              CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C5              CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
C6              CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
C7              CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo
                ***************************.*     




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length  128 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length  128 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5800]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [5800]--->[5726]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/105/CG30273-PB/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.358 Mb, Max= 30.588 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C2
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C3
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C6
MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
>C7
MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo

FORMAT of file /tmp/tmp2594903912118287865aln Not Supported[FATAL:T-COFFEE]
>C1
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C2
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C3
MQYNQQPAGAPGYP-HQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHST-APPPVVIIQH
QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSP-APPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD-----
>C6
MQYNQQQ---PGYP-HQTPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNGDoooo-
>C7
MQYNQQ----PGYP-HQMPPPSYEQVVHVQAPVRVVHTT-APPPVVIIQH
QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSDooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:134 S:97 BS:134
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES 
BOT	    0    1	 96.88 C1	 C2	 96.88
TOP	    1    0	 96.88 C2	 C1	 96.88
BOT	    0    2	 98.44 C1	 C3	 98.44
TOP	    2    0	 98.44 C3	 C1	 98.44
BOT	    0    3	 96.85 C1	 C4	 96.85
TOP	    3    0	 96.85 C4	 C1	 96.85
BOT	    0    4	 93.70 C1	 C5	 93.70
TOP	    4    0	 93.70 C5	 C1	 93.70
BOT	    0    5	 95.16 C1	 C6	 95.16
TOP	    5    0	 95.16 C6	 C1	 95.16
BOT	    0    6	 95.93 C1	 C7	 95.93
TOP	    6    0	 95.93 C7	 C1	 95.93
BOT	    1    2	 98.44 C2	 C3	 98.44
TOP	    2    1	 98.44 C3	 C2	 98.44
BOT	    1    3	 96.85 C2	 C4	 96.85
TOP	    3    1	 96.85 C4	 C2	 96.85
BOT	    1    4	 93.70 C2	 C5	 93.70
TOP	    4    1	 93.70 C5	 C2	 93.70
BOT	    1    5	 92.74 C2	 C6	 92.74
TOP	    5    1	 92.74 C6	 C2	 92.74
BOT	    1    6	 93.50 C2	 C7	 93.50
TOP	    6    1	 93.50 C7	 C2	 93.50
BOT	    2    3	 97.64 C3	 C4	 97.64
TOP	    3    2	 97.64 C4	 C3	 97.64
BOT	    2    4	 94.49 C3	 C5	 94.49
TOP	    4    2	 94.49 C5	 C3	 94.49
BOT	    2    5	 94.35 C3	 C6	 94.35
TOP	    5    2	 94.35 C6	 C3	 94.35
BOT	    2    6	 95.12 C3	 C7	 95.12
TOP	    6    2	 95.12 C7	 C3	 95.12
BOT	    3    4	 94.53 C4	 C5	 94.53
TOP	    4    3	 94.53 C5	 C4	 94.53
BOT	    3    5	 92.74 C4	 C6	 92.74
TOP	    5    3	 92.74 C6	 C4	 92.74
BOT	    3    6	 93.50 C4	 C7	 93.50
TOP	    6    3	 93.50 C7	 C4	 93.50
BOT	    4    5	 91.13 C5	 C6	 91.13
TOP	    5    4	 91.13 C6	 C5	 91.13
BOT	    4    6	 91.06 C5	 C7	 91.06
TOP	    6    4	 91.06 C7	 C5	 91.06
BOT	    5    6	 96.85 C6	 C7	 96.85
TOP	    6    5	 96.85 C7	 C6	 96.85
AVG	 0	 C1	  *	 96.16
AVG	 1	 C2	  *	 95.35
AVG	 2	 C3	  *	 96.41
AVG	 3	 C4	  *	 95.35
AVG	 4	 C5	  *	 93.10
AVG	 5	 C6	  *	 93.83
AVG	 6	 C7	  *	 94.33
TOT	 TOT	  *	 94.93
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
C2              ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
C3              ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
C4              ATGCAGTACAATCAGCAGCCGGCGGGAGCCCCGGGCTATCCCACCCACCA
C5              ATGCAGTACAATCAGCAACCACCGGGAGCCACGGGCTATCCCCCCCACCA
C6              ATGCAGTACAACCAACAGCAG---------CCGGGGTATCCG---CACCA
C7              ATGCAGTACAATCAACAA------------CCGGGGTATCCA---CATCA
                *********** **.**.            .**** *****    ** **

C1              GATGCCCCCACCGAGCTATGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
C2              GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGATC
C3              GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
C4              GATGCCACCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCCATTC
C5              GGTGCCACCACCCAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAATTC
C6              GACGCCTCCTCCGAGCTACGAGCAAGTGGTCCATGTGCAGGCGCCAGTTC
C7              GATGCCGCCACCGAGCTACGAGCAAGTGGTCCATGTTCAGGCGCCAGTTC
                *. *** **:** ***** *****.***** ** ** ********..:**

C1              GGGTGGTTCACCACACGACAGCACCTCCGCCCGTGGTGATCATACAACAT
C2              GGGTGGTTCACCACACGGCAGCACCTCCGCCCATGGTGATCATACAACAT
C3              GGGTGGTTCACCACACGGCAGCACCTCCGCCCGTGGTGATCATACAACAT
C4              GGGTGGTTCACTCGACC---GCACCACCGCCCGTGGTGATCATACAACAT
C5              GGGTGGTTCACTCGCCA---GCCCCGCCGCCCGTGGTGATCATACAACAT
C6              GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
C7              GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
                *********** . .*    **.** ******.*****************

C1              CAAGCTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C2              CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C3              CAAACTGTATTACCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C4              CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C5              CAGACCGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
C6              CAAGCCGTGCTACCCGTGGGTCCCGACCCCAGTTTCATCACCTGCCCGCA
C7              CAAGCTGCATTGCCCGTGGGTCCCGATCCCAGCTTCATCACGTGCCCACA
                **..* * . *.** ******** ** ****  ******** *****.**

C1              TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGTGTGAAAA
C2              TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
C3              TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
C4              CTGCCACATCCAGAAGCTGACTCGCGTGGAGTACTCGCCCAGTGTGAAGA
C5              CTGCCATGTCCAGAAGCTGACCCGCGTGCAGTACTCGCCCAGTGTGAAAA
C6              CTGTCACGTCCAGAAACTGACCCGCGTCGAGTACTCGCCCAGTGTGAAAA
C7              TTGTCATGTCCAGAAACTGACCCGCGTTGAGTATTCGCCGAGTGTTAAAA
                 ** ** .*******.***** *****  **** ***** ** ** **.*

C1              CTCACTGCATGGCCGCCATTCTATGCATCGTTGGCCTCTGGTGTTGTGCC
C2              CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
C3              CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
C4              CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
C5              CGCACTGCATGGCCGCCATTCTGTGCATCGTTGGCCTCTGGTGCTGTGCC
C6              CGCACGTCATGGCCGCCATTCTCTGCATAGTTGGCCTCTGGTGCTGCGCC
C7              CACACGTTATAGCCGCCATTCTCTGCATAGTCGGCCTCTGGTGTTGCGCC
                * ***   **.*********** *****.** *********** ** ***

C1              TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
C2              TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
C3              TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
C4              TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
C5              TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
C6              TGTCTTCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
C7              TGCCTGCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
                ** ** ** *********************** **.******** *****

C1              CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C2              CAATTGCAATAAGTTCGTCGGCGTCTACAACAGTGAT-------------
C3              CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C4              CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C5              CAATTGCAACAAGTTCGTCGGCGTCTACAACAGCGAT-------------
C6              CAATTGCAACAAGTTCGTCGGCGTCTACAACGGCGAT-------------
C7              CAATTGCAACAAGTTCGTCGGCGTGTACAACAGCGAT-------------
                ********* ************** ******.* ***             

C1              --
C2              --
C3              --
C4              --
C5              --
C6              --
C7              --
                  



>C1
ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
GATGCCCCCACCGAGCTATGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
GGGTGGTTCACCACACGACAGCACCTCCGCCCGTGGTGATCATACAACAT
CAAGCTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGTGTGAAAA
CTCACTGCATGGCCGCCATTCTATGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C2
ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGATC
GGGTGGTTCACCACACGGCAGCACCTCCGCCCATGGTGATCATACAACAT
CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGTGAT-------------
--
>C3
ATGCAGTACAATCAGCAGCCGGCGGGAGCGCCGGGCTATCCC---CACCA
GATGCCCCCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAGTTC
GGGTGGTTCACCACACGGCAGCACCTCCGCCCGTGGTGATCATACAACAT
CAAACTGTATTACCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
TTGCCATGTCCAGAAACTGACCCGCGTGGAGTACTCGCCCAGCGTGAAAA
CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCTTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C4
ATGCAGTACAATCAGCAGCCGGCGGGAGCCCCGGGCTATCCCACCCACCA
GATGCCACCACCGAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCCATTC
GGGTGGTTCACTCGACC---GCACCACCGCCCGTGGTGATCATACAACAT
CAAACTGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
CTGCCACATCCAGAAGCTGACTCGCGTGGAGTACTCGCCCAGTGTGAAGA
CGCACTGCATGGCCGCCATTCTCTGCATCGTTGGCCTCTGGTGTTGTGCC
TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTCTGCGG
CAATTGCAATAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C5
ATGCAGTACAATCAGCAACCACCGGGAGCCACGGGCTATCCCCCCCACCA
GGTGCCACCACCCAGCTACGAGCAGGTGGTGCACGTGCAGGCGCCAATTC
GGGTGGTTCACTCGCCA---GCCCCGCCGCCCGTGGTGATCATACAACAT
CAGACCGTATTGCCGGTGGGTCCGGATCCCACCTTCATCACCTGCCCGCA
CTGCCATGTCCAGAAGCTGACCCGCGTGCAGTACTCGCCCAGTGTGAAAA
CGCACTGCATGGCCGCCATTCTGTGCATCGTTGGCCTCTGGTGCTGTGCC
TGCCTGCCCTACTGCGCCACCAGCTGCATGAACGCCAATCACTTTTGCGG
CAATTGCAACAAGTTCGTCGGCGTCTACAACAGCGAT-------------
--
>C6
ATGCAGTACAACCAACAGCAG---------CCGGGGTATCCG---CACCA
GACGCCTCCTCCGAGCTACGAGCAAGTGGTCCATGTGCAGGCGCCAGTTC
GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
CAAGCCGTGCTACCCGTGGGTCCCGACCCCAGTTTCATCACCTGCCCGCA
CTGTCACGTCCAGAAACTGACCCGCGTCGAGTACTCGCCCAGTGTGAAAA
CGCACGTCATGGCCGCCATTCTCTGCATAGTTGGCCTCTGGTGCTGCGCC
TGTCTTCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
CAATTGCAACAAGTTCGTCGGCGTCTACAACGGCGAT-------------
--
>C7
ATGCAGTACAATCAACAA------------CCGGGGTATCCA---CATCA
GATGCCGCCACCGAGCTACGAGCAAGTGGTCCATGTTCAGGCGCCAGTTC
GGGTGGTTCACACAACA---GCACCTCCGCCCGTGGTGATCATACAACAT
CAAGCTGCATTGCCCGTGGGTCCCGATCCCAGCTTCATCACGTGCCCACA
TTGTCATGTCCAGAAACTGACCCGCGTTGAGTATTCGCCGAGTGTTAAAA
CACACGTTATAGCCGCCATTCTCTGCATAGTCGGCCTCTGGTGTTGCGCC
TGCCTGCCGTACTGCGCCACCAGCTGCATGAATGCAAATCACTTCTGCGG
CAATTGCAACAAGTTCGTCGGCGTGTACAACAGCGAT-------------
--
>C1
MQYNQQPAGAPGYPoHQMPPPSYEQVVHVQAPVRVVHHTTAPPPVVIIQH
QAVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C2
MQYNQQPAGAPGYPoHQMPPPSYEQVVHVQAPDRVVHHTAAPPPMVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C3
MQYNQQPAGAPGYPoHQMPPPSYEQVVHVQAPVRVVHHTAAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C4
MQYNQQPAGAPGYPTHQMPPPSYEQVVHVQAPIRVVHSToAPPPVVIIQH
QTVLPVGPDPTFITCPHCHIQKLTRVEYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C5
MQYNQQPPGATGYPPHQVPPPSYEQVVHVQAPIRVVHSPoAPPPVVIIQH
QTVLPVGPDPTFITCPHCHVQKLTRVQYSPSVKTHCMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD
>C6
MQYNQQQoooPGYPoHQTPPPSYEQVVHVQAPVRVVHTToAPPPVVIIQH
QAVLPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVMAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNGD
>C7
MQYNQQooooPGYPoHQMPPPSYEQVVHVQAPVRVVHTToAPPPVVIIQH
QAALPVGPDPSFITCPHCHVQKLTRVEYSPSVKTHVIAAILCIVGLWCCA
CLPYCATSCMNANHFCGNCNKFVGVYNSD


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 7 taxa and 402 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Taxon 7 -> C7
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479433385
      Setting output file names to "/opt/ADOPS/105/CG30273-PB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1916063435
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5152428019
      Seed = 24113112
      Swapseed = 1479433385
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 22 unique site patterns
      Division 2 has 16 unique site patterns
      Division 3 has 53 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1357.374785 -- -24.557203
         Chain 2 -- -1356.395700 -- -24.557203
         Chain 3 -- -1342.859931 -- -24.557203
         Chain 4 -- -1298.223851 -- -24.557203

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1366.486141 -- -24.557203
         Chain 2 -- -1286.949097 -- -24.557203
         Chain 3 -- -1338.063912 -- -24.557203
         Chain 4 -- -1362.306675 -- -24.557203


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1357.375] (-1356.396) (-1342.860) (-1298.224) * [-1366.486] (-1286.949) (-1338.064) (-1362.307) 
        500 -- (-1082.767) (-1074.406) [-1073.494] (-1076.975) * (-1069.161) (-1073.526) [-1072.496] (-1073.898) -- 0:33:19
       1000 -- (-1065.671) (-1064.366) [-1056.792] (-1071.114) * (-1063.113) (-1076.171) [-1062.534] (-1062.071) -- 0:16:39
       1500 -- (-1053.633) (-1069.484) (-1052.735) [-1055.924] * (-1058.232) (-1060.855) [-1054.230] (-1064.158) -- 0:11:05
       2000 -- (-1065.618) [-1047.229] (-1046.981) (-1043.240) * [-1059.367] (-1059.586) (-1044.217) (-1056.749) -- 0:08:19
       2500 -- (-1050.827) [-1043.390] (-1046.613) (-1044.741) * (-1050.325) (-1051.940) [-1043.916] (-1043.442) -- 0:06:39
       3000 -- (-1050.894) (-1038.255) (-1044.144) [-1037.594] * (-1042.108) (-1049.942) [-1046.494] (-1047.200) -- 0:05:32
       3500 -- [-1048.903] (-1041.878) (-1047.309) (-1039.090) * (-1039.347) (-1050.231) (-1052.712) [-1039.711] -- 0:04:44
       4000 -- [-1042.391] (-1042.230) (-1045.570) (-1038.397) * (-1040.286) (-1041.821) [-1039.825] (-1046.606) -- 0:04:09
       4500 -- (-1045.806) (-1044.937) (-1042.927) [-1044.055] * (-1040.946) [-1041.197] (-1040.306) (-1039.858) -- 0:03:41
       5000 -- (-1045.793) (-1035.381) (-1044.427) [-1042.316] * (-1043.759) [-1038.301] (-1049.432) (-1041.241) -- 0:06:38

      Average standard deviation of split frequencies: 0.047140

       5500 -- (-1042.654) [-1036.027] (-1044.777) (-1047.722) * [-1044.409] (-1042.376) (-1045.918) (-1042.183) -- 0:06:01
       6000 -- (-1041.339) (-1035.582) (-1047.030) [-1034.581] * (-1039.461) (-1038.540) (-1037.434) [-1045.730] -- 0:05:31
       6500 -- (-1043.246) (-1040.731) (-1051.004) [-1036.660] * (-1039.836) [-1040.555] (-1037.700) (-1042.126) -- 0:05:05
       7000 -- (-1044.875) [-1034.066] (-1041.492) (-1042.808) * (-1043.696) (-1047.755) (-1036.852) [-1034.437] -- 0:04:43
       7500 -- (-1043.670) (-1043.177) [-1047.366] (-1040.167) * [-1041.066] (-1047.877) (-1035.996) (-1044.710) -- 0:04:24
       8000 -- [-1042.279] (-1049.455) (-1038.253) (-1037.845) * (-1039.752) [-1039.225] (-1038.395) (-1043.289) -- 0:04:08
       8500 -- (-1047.542) (-1049.700) [-1042.134] (-1039.255) * (-1038.058) [-1038.642] (-1044.546) (-1044.511) -- 0:03:53
       9000 -- (-1042.882) (-1051.692) [-1037.498] (-1031.904) * [-1042.202] (-1041.054) (-1042.320) (-1037.292) -- 0:05:30
       9500 -- (-1040.829) [-1038.722] (-1040.915) (-1041.605) * (-1036.771) (-1038.808) (-1048.517) [-1040.915] -- 0:05:12
      10000 -- (-1054.252) (-1037.042) [-1039.798] (-1042.439) * (-1046.410) (-1036.337) [-1036.592] (-1051.126) -- 0:04:57

      Average standard deviation of split frequencies: 0.044194

      10500 -- [-1039.868] (-1042.005) (-1040.534) (-1040.915) * (-1037.726) [-1036.099] (-1041.996) (-1035.693) -- 0:04:42
      11000 -- (-1038.106) (-1039.677) (-1055.406) [-1038.951] * (-1038.195) (-1041.194) [-1039.134] (-1041.154) -- 0:04:29
      11500 -- (-1042.170) [-1044.928] (-1046.604) (-1035.518) * (-1042.028) [-1038.041] (-1036.122) (-1044.203) -- 0:04:17
      12000 -- [-1042.543] (-1043.642) (-1046.291) (-1035.098) * (-1035.779) (-1040.951) [-1041.332] (-1045.219) -- 0:04:07
      12500 -- [-1041.861] (-1040.029) (-1040.373) (-1041.398) * [-1037.912] (-1040.330) (-1046.852) (-1037.322) -- 0:03:57
      13000 -- (-1042.653) [-1039.805] (-1042.691) (-1042.507) * [-1036.282] (-1044.743) (-1042.186) (-1041.885) -- 0:03:47
      13500 -- (-1039.028) (-1042.274) (-1039.687) [-1038.621] * [-1040.475] (-1039.219) (-1042.312) (-1047.946) -- 0:04:52
      14000 -- (-1041.543) (-1039.557) (-1041.654) [-1037.079] * (-1040.747) (-1038.176) (-1050.525) [-1044.660] -- 0:04:41
      14500 -- [-1039.921] (-1042.685) (-1041.255) (-1040.147) * [-1041.126] (-1040.760) (-1042.472) (-1050.179) -- 0:04:31
      15000 -- [-1042.638] (-1042.524) (-1038.901) (-1041.489) * (-1042.683) [-1041.429] (-1044.938) (-1051.984) -- 0:04:22

      Average standard deviation of split frequencies: 0.036828

      15500 -- [-1041.889] (-1038.005) (-1034.231) (-1039.366) * (-1040.827) [-1039.690] (-1044.851) (-1043.502) -- 0:04:14
      16000 -- (-1042.797) (-1044.459) [-1049.284] (-1038.808) * (-1042.352) (-1040.822) (-1040.743) [-1041.565] -- 0:04:06
      16500 -- (-1043.701) (-1045.707) (-1045.296) [-1038.945] * (-1042.283) (-1038.861) (-1038.587) [-1037.442] -- 0:03:58
      17000 -- (-1047.256) (-1039.376) (-1043.700) [-1039.501] * [-1040.521] (-1041.342) (-1040.652) (-1037.004) -- 0:03:51
      17500 -- (-1041.869) [-1040.640] (-1038.384) (-1035.304) * (-1040.945) (-1043.824) [-1042.656] (-1039.771) -- 0:03:44
      18000 -- (-1038.710) [-1045.254] (-1034.863) (-1040.315) * [-1040.158] (-1040.393) (-1039.646) (-1044.197) -- 0:04:32
      18500 -- (-1043.127) (-1038.169) [-1036.909] (-1039.066) * (-1042.299) (-1050.637) (-1041.630) [-1036.192] -- 0:04:25
      19000 -- (-1036.604) (-1047.461) (-1034.233) [-1034.239] * (-1042.354) (-1044.855) [-1040.483] (-1043.095) -- 0:04:18
      19500 -- (-1045.318) (-1047.994) (-1045.608) [-1038.852] * (-1044.180) [-1036.992] (-1044.959) (-1038.678) -- 0:04:11
      20000 -- (-1039.572) (-1042.193) (-1036.787) [-1043.711] * (-1050.816) (-1035.255) (-1043.351) [-1045.686] -- 0:04:05

      Average standard deviation of split frequencies: 0.029327

      20500 -- [-1042.293] (-1050.792) (-1048.842) (-1039.949) * [-1043.878] (-1041.361) (-1041.644) (-1046.756) -- 0:03:58
      21000 -- (-1040.722) (-1046.556) [-1042.786] (-1040.921) * (-1048.266) (-1038.397) [-1037.877] (-1049.809) -- 0:03:53
      21500 -- (-1036.098) (-1049.905) [-1040.556] (-1043.196) * [-1051.171] (-1043.337) (-1039.523) (-1036.975) -- 0:03:47
      22000 -- (-1041.784) (-1043.245) (-1040.160) [-1044.767] * [-1046.888] (-1033.634) (-1043.512) (-1041.030) -- 0:03:42
      22500 -- (-1048.929) [-1042.800] (-1039.851) (-1043.593) * (-1042.611) (-1037.373) [-1038.009] (-1043.213) -- 0:04:20
      23000 -- [-1037.074] (-1048.420) (-1046.457) (-1040.800) * (-1044.478) [-1043.395] (-1045.124) (-1042.767) -- 0:04:14
      23500 -- (-1046.832) (-1033.409) (-1035.988) [-1040.219] * (-1034.953) (-1045.442) [-1035.390] (-1038.449) -- 0:04:09
      24000 -- [-1048.070] (-1042.208) (-1032.174) (-1039.896) * (-1041.911) (-1040.277) [-1040.277] (-1046.311) -- 0:04:04
      24500 -- (-1037.758) (-1037.539) [-1038.384] (-1043.100) * (-1045.192) (-1039.666) (-1044.046) [-1048.714] -- 0:03:58
      25000 -- (-1038.000) [-1040.204] (-1035.947) (-1043.196) * (-1045.112) (-1038.902) (-1040.323) [-1037.844] -- 0:03:54

      Average standard deviation of split frequencies: 0.052378

      25500 -- (-1045.051) (-1041.922) [-1038.506] (-1037.477) * (-1034.734) (-1043.755) (-1047.308) [-1037.867] -- 0:03:49
      26000 -- [-1049.655] (-1040.347) (-1040.295) (-1039.197) * (-1044.516) [-1048.809] (-1042.558) (-1036.572) -- 0:03:44
      26500 -- (-1037.991) (-1044.590) (-1037.880) [-1043.956] * (-1038.247) (-1040.074) (-1040.420) [-1038.798] -- 0:04:17
      27000 -- [-1040.862] (-1036.978) (-1049.593) (-1042.142) * (-1038.435) [-1042.374] (-1040.970) (-1037.927) -- 0:04:12
      27500 -- (-1041.025) [-1038.235] (-1040.133) (-1043.309) * (-1040.574) [-1040.351] (-1039.826) (-1039.676) -- 0:04:07
      28000 -- (-1041.982) (-1041.326) (-1046.728) [-1037.850] * (-1042.352) (-1047.195) [-1032.363] (-1039.507) -- 0:04:03
      28500 -- [-1041.771] (-1037.943) (-1047.376) (-1043.943) * [-1040.838] (-1042.699) (-1038.676) (-1039.852) -- 0:03:58
      29000 -- [-1037.994] (-1041.254) (-1042.684) (-1050.724) * [-1035.825] (-1047.756) (-1044.079) (-1042.794) -- 0:03:54
      29500 -- [-1044.522] (-1037.950) (-1039.324) (-1045.612) * (-1047.533) (-1041.489) (-1039.786) [-1043.371] -- 0:03:50
      30000 -- (-1037.457) (-1042.908) (-1043.471) [-1046.732] * (-1040.374) (-1036.917) [-1038.126] (-1050.622) -- 0:03:46

      Average standard deviation of split frequencies: 0.051240

      30500 -- [-1038.077] (-1042.434) (-1054.667) (-1041.593) * [-1047.003] (-1040.613) (-1039.949) (-1042.114) -- 0:03:42
      31000 -- [-1035.992] (-1044.734) (-1040.890) (-1043.789) * [-1045.255] (-1049.928) (-1039.640) (-1045.397) -- 0:04:10
      31500 -- (-1045.854) (-1046.359) [-1038.549] (-1039.679) * (-1046.616) (-1042.301) [-1042.028] (-1038.563) -- 0:04:05
      32000 -- [-1044.984] (-1042.518) (-1041.347) (-1045.310) * (-1045.686) (-1045.643) (-1049.429) [-1042.681] -- 0:04:02
      32500 -- (-1041.894) (-1041.331) (-1040.617) [-1040.303] * (-1042.498) (-1041.290) [-1038.757] (-1042.812) -- 0:03:58
      33000 -- (-1045.111) (-1040.137) (-1039.375) [-1045.034] * (-1045.209) (-1042.286) (-1041.818) [-1039.267] -- 0:03:54
      33500 -- (-1044.853) [-1037.533] (-1045.599) (-1040.592) * (-1046.956) (-1043.775) (-1041.235) [-1036.378] -- 0:03:50
      34000 -- (-1041.628) [-1037.678] (-1044.067) (-1043.869) * (-1044.214) [-1038.820] (-1046.130) (-1034.210) -- 0:03:47
      34500 -- (-1044.138) (-1040.364) (-1042.263) [-1045.253] * [-1047.063] (-1038.090) (-1042.413) (-1037.403) -- 0:03:43
      35000 -- (-1039.160) [-1043.217] (-1042.429) (-1052.184) * (-1039.887) [-1036.821] (-1038.934) (-1040.138) -- 0:03:40

      Average standard deviation of split frequencies: 0.040739

      35500 -- (-1040.274) (-1039.627) [-1039.219] (-1053.046) * (-1040.431) [-1037.165] (-1038.083) (-1043.777) -- 0:04:04
      36000 -- (-1039.633) [-1037.094] (-1037.481) (-1039.267) * (-1044.879) (-1040.157) [-1036.948] (-1044.961) -- 0:04:01
      36500 -- (-1046.841) [-1035.825] (-1041.722) (-1037.409) * (-1046.224) (-1043.262) [-1036.588] (-1041.869) -- 0:03:57
      37000 -- (-1040.847) [-1041.377] (-1037.604) (-1044.845) * [-1034.622] (-1039.483) (-1036.470) (-1047.080) -- 0:03:54
      37500 -- (-1044.065) (-1036.326) [-1035.887] (-1044.432) * (-1045.050) [-1036.262] (-1041.605) (-1041.856) -- 0:03:51
      38000 -- (-1041.032) [-1042.445] (-1038.969) (-1042.224) * (-1042.907) (-1047.269) (-1042.251) [-1036.019] -- 0:03:47
      38500 -- (-1045.277) (-1040.404) (-1042.508) [-1035.517] * (-1041.111) (-1050.411) [-1042.909] (-1043.841) -- 0:03:44
      39000 -- (-1037.473) (-1047.003) (-1040.123) [-1041.542] * [-1036.345] (-1037.449) (-1046.879) (-1043.169) -- 0:03:41
      39500 -- [-1043.098] (-1052.924) (-1039.997) (-1043.838) * (-1038.226) [-1036.856] (-1044.884) (-1045.251) -- 0:04:03
      40000 -- (-1039.458) (-1040.032) (-1038.164) [-1043.070] * (-1037.642) (-1048.303) (-1040.600) [-1046.392] -- 0:04:00

      Average standard deviation of split frequencies: 0.034776

      40500 -- [-1038.862] (-1040.136) (-1039.780) (-1035.727) * (-1041.141) (-1052.705) [-1040.436] (-1049.567) -- 0:03:56
      41000 -- [-1041.417] (-1044.713) (-1049.944) (-1042.520) * [-1034.292] (-1045.929) (-1047.137) (-1041.459) -- 0:03:53
      41500 -- (-1039.351) [-1036.793] (-1046.391) (-1035.656) * [-1036.403] (-1036.012) (-1037.993) (-1039.083) -- 0:03:50
      42000 -- (-1041.172) [-1037.544] (-1046.665) (-1035.586) * [-1035.402] (-1041.297) (-1039.214) (-1034.913) -- 0:03:48
      42500 -- (-1039.609) (-1035.906) (-1041.755) [-1038.740] * (-1044.048) [-1045.302] (-1042.425) (-1042.165) -- 0:03:45
      43000 -- (-1041.580) (-1045.219) (-1042.555) [-1042.746] * [-1038.748] (-1045.509) (-1050.227) (-1041.693) -- 0:03:42
      43500 -- [-1039.256] (-1039.300) (-1044.390) (-1046.418) * (-1037.621) (-1047.390) (-1039.989) [-1043.994] -- 0:03:39
      44000 -- (-1043.178) (-1047.496) (-1039.982) [-1046.217] * [-1036.655] (-1046.529) (-1038.198) (-1042.479) -- 0:03:59
      44500 -- [-1040.583] (-1038.746) (-1038.778) (-1043.826) * [-1038.390] (-1039.034) (-1041.021) (-1047.051) -- 0:03:56
      45000 -- (-1042.562) (-1038.840) (-1032.860) [-1044.571] * (-1036.736) (-1041.706) [-1041.169] (-1048.889) -- 0:03:53

      Average standard deviation of split frequencies: 0.031882

      45500 -- (-1041.969) [-1040.260] (-1043.584) (-1052.894) * (-1043.932) (-1045.502) (-1045.359) [-1041.303] -- 0:03:50
      46000 -- (-1038.637) (-1035.960) [-1041.912] (-1042.061) * [-1039.064] (-1035.981) (-1044.949) (-1037.074) -- 0:03:48
      46500 -- (-1036.570) [-1034.562] (-1044.949) (-1041.993) * [-1034.917] (-1038.352) (-1043.981) (-1046.391) -- 0:03:45
      47000 -- (-1044.616) [-1040.459] (-1036.532) (-1041.033) * (-1046.352) (-1047.893) [-1040.302] (-1039.348) -- 0:03:43
      47500 -- (-1042.905) [-1038.443] (-1041.111) (-1040.642) * [-1037.621] (-1045.235) (-1042.486) (-1042.336) -- 0:03:40
      48000 -- (-1044.465) (-1040.898) [-1042.961] (-1049.612) * (-1040.049) (-1049.910) [-1041.855] (-1047.448) -- 0:03:38
      48500 -- (-1047.799) [-1039.885] (-1037.098) (-1044.458) * [-1040.934] (-1038.106) (-1043.232) (-1048.172) -- 0:03:55
      49000 -- (-1041.543) (-1035.230) [-1041.027] (-1039.531) * (-1042.836) (-1038.032) [-1042.007] (-1039.701) -- 0:03:52
      49500 -- (-1044.364) [-1034.125] (-1041.000) (-1041.290) * (-1043.518) [-1038.602] (-1034.983) (-1037.524) -- 0:03:50
      50000 -- [-1040.949] (-1040.853) (-1045.071) (-1038.132) * (-1040.408) [-1040.924] (-1042.178) (-1036.986) -- 0:03:48

      Average standard deviation of split frequencies: 0.027912

      50500 -- (-1045.166) (-1041.495) [-1043.299] (-1048.393) * (-1038.452) (-1039.016) [-1044.101] (-1041.323) -- 0:03:45
      51000 -- (-1055.646) (-1045.601) (-1048.980) [-1037.853] * [-1040.179] (-1041.923) (-1041.916) (-1043.004) -- 0:03:43
      51500 -- (-1050.620) (-1045.900) [-1037.537] (-1042.495) * (-1040.342) [-1037.425] (-1042.916) (-1039.606) -- 0:03:41
      52000 -- (-1041.222) (-1041.454) (-1041.197) [-1034.169] * (-1048.768) (-1042.423) [-1037.462] (-1043.372) -- 0:03:38
      52500 -- [-1043.122] (-1045.306) (-1036.967) (-1040.419) * (-1039.390) (-1045.029) (-1040.521) [-1037.926] -- 0:03:54
      53000 -- (-1042.005) (-1046.338) [-1044.201] (-1036.263) * (-1041.593) (-1048.493) [-1041.649] (-1034.164) -- 0:03:52
      53500 -- [-1039.716] (-1044.837) (-1044.650) (-1042.337) * (-1037.095) (-1046.501) (-1043.451) [-1039.329] -- 0:03:49
      54000 -- (-1044.825) [-1039.386] (-1038.982) (-1042.483) * (-1040.179) (-1037.143) [-1035.725] (-1040.306) -- 0:03:47
      54500 -- (-1035.312) (-1052.215) [-1038.270] (-1039.807) * [-1033.662] (-1036.433) (-1035.917) (-1035.311) -- 0:03:45
      55000 -- [-1043.959] (-1038.203) (-1046.755) (-1039.361) * (-1035.137) (-1042.457) (-1039.473) [-1038.713] -- 0:03:43

      Average standard deviation of split frequencies: 0.030064

      55500 -- [-1037.183] (-1041.868) (-1038.279) (-1039.237) * (-1036.455) (-1050.137) (-1038.879) [-1034.921] -- 0:03:41
      56000 -- [-1043.931] (-1041.460) (-1039.304) (-1041.542) * (-1039.916) (-1046.539) (-1037.708) [-1039.760] -- 0:03:39
      56500 -- (-1037.252) (-1042.363) [-1033.211] (-1040.961) * (-1045.244) (-1046.347) (-1045.049) [-1049.743] -- 0:03:37
      57000 -- (-1037.197) (-1041.547) [-1034.470] (-1040.322) * (-1037.038) (-1044.407) [-1038.947] (-1048.305) -- 0:03:51
      57500 -- (-1044.736) (-1043.637) [-1036.961] (-1046.997) * (-1043.459) (-1055.228) [-1043.549] (-1043.946) -- 0:03:49
      58000 -- (-1041.977) (-1041.558) (-1037.359) [-1042.059] * (-1043.524) (-1044.724) (-1039.025) [-1043.557] -- 0:03:47
      58500 -- (-1036.265) (-1042.940) [-1042.631] (-1050.579) * (-1040.068) (-1047.048) (-1045.891) [-1045.875] -- 0:03:45
      59000 -- (-1044.667) (-1045.243) [-1045.045] (-1047.992) * (-1041.241) [-1036.173] (-1043.140) (-1048.468) -- 0:03:43
      59500 -- [-1039.248] (-1042.925) (-1042.546) (-1041.284) * (-1039.822) (-1043.639) (-1039.090) [-1036.718] -- 0:03:41
      60000 -- [-1039.103] (-1052.279) (-1051.151) (-1039.275) * (-1032.922) [-1044.811] (-1047.737) (-1041.631) -- 0:03:39

      Average standard deviation of split frequencies: 0.027751

      60500 -- (-1037.784) (-1045.026) (-1044.473) [-1037.884] * (-1037.410) (-1039.445) [-1039.366] (-1050.758) -- 0:03:37
      61000 -- [-1037.860] (-1043.728) (-1047.163) (-1038.770) * [-1034.665] (-1041.918) (-1033.222) (-1046.652) -- 0:03:35
      61500 -- [-1043.126] (-1050.275) (-1039.533) (-1047.653) * (-1041.001) (-1039.249) (-1037.355) [-1041.514] -- 0:03:48
      62000 -- (-1037.757) [-1044.366] (-1038.909) (-1040.725) * (-1041.887) (-1049.257) (-1039.590) [-1037.334] -- 0:03:46
      62500 -- (-1037.857) [-1037.684] (-1039.611) (-1046.750) * [-1040.488] (-1042.781) (-1038.246) (-1037.321) -- 0:03:45
      63000 -- (-1042.189) (-1039.601) (-1039.148) [-1038.379] * (-1033.611) (-1049.234) [-1040.588] (-1039.700) -- 0:03:43
      63500 -- (-1045.254) (-1043.244) (-1036.815) [-1034.518] * (-1041.866) (-1046.094) [-1036.957] (-1039.996) -- 0:03:41
      64000 -- [-1043.068] (-1044.484) (-1044.292) (-1039.793) * (-1038.395) [-1043.571] (-1043.198) (-1042.445) -- 0:03:39
      64500 -- (-1042.905) (-1044.440) [-1038.481] (-1046.076) * (-1042.356) [-1050.338] (-1039.800) (-1040.845) -- 0:03:37
      65000 -- [-1041.736] (-1038.210) (-1039.159) (-1034.784) * (-1044.928) (-1050.379) [-1044.466] (-1047.462) -- 0:03:35

      Average standard deviation of split frequencies: 0.024489

      65500 -- (-1041.427) [-1041.973] (-1050.913) (-1039.561) * (-1037.915) [-1038.946] (-1038.618) (-1043.127) -- 0:03:34
      66000 -- [-1036.038] (-1050.275) (-1041.647) (-1043.386) * (-1039.506) (-1042.469) (-1047.629) [-1042.066] -- 0:03:46
      66500 -- (-1038.511) (-1041.860) [-1041.607] (-1041.277) * (-1040.340) [-1038.836] (-1042.874) (-1041.374) -- 0:03:44
      67000 -- (-1042.742) (-1038.776) (-1045.656) [-1038.107] * (-1041.337) [-1035.641] (-1040.630) (-1044.412) -- 0:03:42
      67500 -- (-1048.519) (-1038.567) [-1040.063] (-1044.076) * (-1047.257) (-1048.191) [-1040.441] (-1044.412) -- 0:03:41
      68000 -- (-1047.864) [-1039.761] (-1036.253) (-1040.505) * (-1042.197) (-1041.940) [-1039.779] (-1040.486) -- 0:03:39
      68500 -- (-1042.946) [-1035.753] (-1038.813) (-1043.821) * (-1035.042) (-1045.512) (-1046.229) [-1035.696] -- 0:03:37
      69000 -- [-1049.376] (-1042.044) (-1049.281) (-1042.669) * (-1041.409) (-1046.353) (-1042.207) [-1046.647] -- 0:03:35
      69500 -- (-1048.378) (-1039.928) (-1043.664) [-1044.342] * [-1038.557] (-1043.436) (-1040.452) (-1038.530) -- 0:03:34
      70000 -- [-1035.104] (-1043.191) (-1042.508) (-1041.750) * [-1038.449] (-1041.046) (-1043.968) (-1042.210) -- 0:03:32

      Average standard deviation of split frequencies: 0.026683

      70500 -- [-1033.707] (-1040.027) (-1045.508) (-1040.686) * [-1038.358] (-1039.897) (-1041.049) (-1034.393) -- 0:03:44
      71000 -- (-1038.035) (-1043.600) (-1047.552) [-1035.063] * [-1040.180] (-1040.869) (-1035.888) (-1045.271) -- 0:03:42
      71500 -- (-1045.665) (-1033.881) (-1038.234) [-1040.441] * (-1040.086) (-1042.447) (-1038.376) [-1047.895] -- 0:03:40
      72000 -- (-1043.075) (-1043.339) (-1057.310) [-1047.039] * (-1041.150) (-1050.420) [-1038.223] (-1047.988) -- 0:03:39
      72500 -- (-1043.097) [-1035.508] (-1041.183) (-1033.121) * (-1038.584) [-1049.523] (-1046.769) (-1038.936) -- 0:03:37
      73000 -- (-1048.458) (-1037.688) [-1038.526] (-1038.084) * (-1036.331) (-1044.933) (-1041.355) [-1038.360] -- 0:03:35
      73500 -- (-1041.551) (-1039.501) (-1041.485) [-1036.677] * [-1037.684] (-1043.308) (-1044.250) (-1036.894) -- 0:03:34
      74000 -- [-1045.052] (-1042.739) (-1041.846) (-1038.888) * [-1034.151] (-1042.842) (-1037.592) (-1034.759) -- 0:03:32
      74500 -- (-1042.418) [-1039.469] (-1047.319) (-1042.480) * [-1035.777] (-1047.666) (-1034.123) (-1040.115) -- 0:03:31
      75000 -- (-1047.688) [-1041.959] (-1040.049) (-1041.668) * (-1034.833) [-1037.809] (-1043.699) (-1037.998) -- 0:03:42

      Average standard deviation of split frequencies: 0.025697

      75500 -- (-1045.426) (-1037.594) [-1037.423] (-1038.515) * (-1037.126) [-1041.280] (-1040.136) (-1038.863) -- 0:03:40
      76000 -- (-1043.531) (-1040.673) (-1038.046) [-1037.943] * [-1042.659] (-1040.736) (-1048.657) (-1037.454) -- 0:03:38
      76500 -- (-1040.759) [-1042.279] (-1039.502) (-1045.335) * [-1041.750] (-1036.948) (-1039.656) (-1042.562) -- 0:03:37
      77000 -- (-1039.397) [-1034.680] (-1035.020) (-1040.599) * (-1046.372) (-1042.415) (-1035.401) [-1038.080] -- 0:03:35
      77500 -- (-1039.399) (-1041.421) (-1043.375) [-1041.565] * (-1039.747) (-1043.019) [-1039.986] (-1037.496) -- 0:03:34
      78000 -- (-1038.347) (-1041.087) (-1043.687) [-1041.479] * (-1050.663) (-1044.072) (-1043.238) [-1043.704] -- 0:03:32
      78500 -- (-1042.993) [-1036.453] (-1048.407) (-1038.969) * (-1037.684) (-1043.041) [-1040.252] (-1037.854) -- 0:03:31
      79000 -- (-1038.031) (-1037.860) (-1042.533) [-1042.721] * (-1038.191) [-1040.418] (-1039.300) (-1038.123) -- 0:03:29
      79500 -- [-1038.299] (-1035.710) (-1050.277) (-1040.440) * [-1038.964] (-1044.884) (-1039.477) (-1039.145) -- 0:03:39
      80000 -- (-1041.502) (-1036.479) (-1035.741) [-1042.623] * (-1040.606) (-1046.813) [-1039.349] (-1039.760) -- 0:03:38

      Average standard deviation of split frequencies: 0.022541

      80500 -- (-1040.149) (-1041.251) [-1042.100] (-1038.975) * (-1039.987) (-1043.256) [-1040.362] (-1046.306) -- 0:03:37
      81000 -- [-1039.383] (-1037.447) (-1044.686) (-1039.626) * [-1038.140] (-1045.522) (-1035.855) (-1041.662) -- 0:03:35
      81500 -- [-1048.922] (-1049.765) (-1046.586) (-1043.206) * (-1043.864) (-1038.865) [-1036.930] (-1043.654) -- 0:03:34
      82000 -- (-1036.828) (-1037.949) [-1040.075] (-1037.979) * (-1041.510) (-1039.272) (-1036.858) [-1047.773] -- 0:03:32
      82500 -- (-1048.319) [-1042.522] (-1042.879) (-1040.357) * [-1041.661] (-1042.490) (-1043.196) (-1043.833) -- 0:03:31
      83000 -- (-1041.578) [-1033.215] (-1040.219) (-1034.939) * [-1040.782] (-1048.968) (-1043.167) (-1040.065) -- 0:03:29
      83500 -- [-1039.174] (-1039.383) (-1037.745) (-1036.550) * [-1035.178] (-1039.801) (-1040.175) (-1039.200) -- 0:03:28
      84000 -- (-1043.036) [-1042.475] (-1040.256) (-1041.278) * (-1036.044) (-1042.982) (-1040.394) [-1042.197] -- 0:03:38
      84500 -- (-1038.853) [-1042.584] (-1039.762) (-1043.658) * (-1044.271) [-1044.389] (-1040.998) (-1040.034) -- 0:03:36
      85000 -- (-1041.802) [-1039.001] (-1045.232) (-1038.393) * (-1039.295) (-1039.978) (-1038.216) [-1039.173] -- 0:03:35

      Average standard deviation of split frequencies: 0.023492

      85500 -- (-1039.664) (-1043.336) [-1042.258] (-1044.619) * [-1045.618] (-1035.795) (-1038.885) (-1040.350) -- 0:03:33
      86000 -- (-1045.692) (-1046.667) (-1046.720) [-1036.534] * (-1046.197) [-1038.790] (-1042.713) (-1041.182) -- 0:03:32
      86500 -- (-1038.638) [-1044.758] (-1041.313) (-1052.226) * [-1041.235] (-1036.390) (-1046.617) (-1045.365) -- 0:03:31
      87000 -- [-1043.640] (-1046.436) (-1043.681) (-1047.157) * (-1036.536) (-1044.724) (-1040.079) [-1036.541] -- 0:03:29
      87500 -- (-1041.778) (-1043.598) [-1039.594] (-1036.070) * (-1040.774) (-1044.411) (-1039.281) [-1034.560] -- 0:03:28
      88000 -- [-1041.593] (-1037.645) (-1044.427) (-1041.728) * (-1042.619) (-1044.059) [-1037.907] (-1043.009) -- 0:03:27
      88500 -- (-1041.779) [-1038.540] (-1038.226) (-1039.626) * [-1043.084] (-1040.843) (-1036.911) (-1046.975) -- 0:03:36
      89000 -- [-1037.698] (-1049.338) (-1038.899) (-1035.644) * (-1037.851) [-1036.531] (-1045.993) (-1039.207) -- 0:03:34
      89500 -- (-1043.238) (-1044.706) [-1033.875] (-1044.520) * (-1040.205) [-1038.114] (-1038.158) (-1044.875) -- 0:03:33
      90000 -- (-1033.759) [-1039.722] (-1045.601) (-1044.567) * (-1051.637) [-1035.613] (-1036.155) (-1044.150) -- 0:03:32

      Average standard deviation of split frequencies: 0.024511

      90500 -- (-1043.139) (-1039.013) (-1041.648) [-1039.507] * (-1034.779) [-1035.198] (-1041.282) (-1037.601) -- 0:03:31
      91000 -- (-1039.508) (-1046.182) [-1038.173] (-1043.346) * (-1043.057) (-1037.821) (-1038.959) [-1042.967] -- 0:03:29
      91500 -- (-1036.828) (-1047.334) [-1040.069] (-1038.541) * (-1038.108) (-1039.636) [-1034.452] (-1034.358) -- 0:03:28
      92000 -- (-1040.743) [-1034.112] (-1047.952) (-1038.671) * [-1042.151] (-1038.886) (-1036.047) (-1041.470) -- 0:03:27
      92500 -- (-1037.797) [-1035.747] (-1049.969) (-1038.299) * (-1040.807) (-1044.468) [-1037.126] (-1043.937) -- 0:03:35
      93000 -- (-1046.318) (-1034.943) (-1041.469) [-1043.669] * (-1045.838) [-1044.619] (-1035.764) (-1041.267) -- 0:03:34
      93500 -- (-1041.816) [-1036.010] (-1043.931) (-1049.154) * [-1045.558] (-1045.036) (-1044.811) (-1040.309) -- 0:03:33
      94000 -- (-1035.652) [-1036.519] (-1036.783) (-1040.129) * (-1036.812) [-1038.228] (-1049.327) (-1040.893) -- 0:03:32
      94500 -- (-1040.359) (-1040.853) [-1038.343] (-1045.751) * [-1039.744] (-1040.287) (-1040.661) (-1043.394) -- 0:03:30
      95000 -- (-1043.043) [-1042.577] (-1042.115) (-1038.015) * (-1041.467) [-1039.871] (-1043.349) (-1037.032) -- 0:03:29

      Average standard deviation of split frequencies: 0.028060

      95500 -- (-1038.208) [-1038.394] (-1042.712) (-1042.626) * (-1040.919) (-1044.884) (-1040.388) [-1044.472] -- 0:03:28
      96000 -- (-1040.451) (-1049.243) (-1042.863) [-1038.274] * (-1038.227) (-1046.890) (-1038.310) [-1039.434] -- 0:03:27
      96500 -- [-1037.010] (-1042.743) (-1045.322) (-1039.430) * (-1041.581) (-1042.303) (-1045.739) [-1040.581] -- 0:03:25
      97000 -- (-1045.159) [-1041.010] (-1035.688) (-1037.211) * [-1048.334] (-1039.374) (-1047.809) (-1042.610) -- 0:03:34
      97500 -- (-1045.331) (-1047.245) [-1040.237] (-1047.070) * (-1042.930) (-1037.957) [-1039.611] (-1045.543) -- 0:03:32
      98000 -- (-1040.402) (-1039.698) [-1045.666] (-1039.827) * (-1040.232) (-1040.897) (-1040.102) [-1043.917] -- 0:03:31
      98500 -- (-1039.730) [-1043.485] (-1044.861) (-1037.783) * [-1040.424] (-1045.215) (-1038.503) (-1046.903) -- 0:03:30
      99000 -- (-1034.862) (-1048.676) (-1044.307) [-1036.052] * (-1042.603) [-1045.275] (-1042.315) (-1046.175) -- 0:03:29
      99500 -- [-1034.385] (-1043.759) (-1051.495) (-1036.942) * (-1037.126) (-1040.680) (-1040.270) [-1039.360] -- 0:03:28
      100000 -- [-1039.486] (-1036.899) (-1045.296) (-1032.743) * (-1040.441) [-1041.421] (-1039.423) (-1052.973) -- 0:03:27

      Average standard deviation of split frequencies: 0.027428

      100500 -- [-1033.170] (-1037.012) (-1038.554) (-1039.946) * [-1040.412] (-1048.231) (-1041.892) (-1044.936) -- 0:03:25
      101000 -- (-1032.945) (-1041.107) [-1045.462] (-1037.449) * [-1045.535] (-1047.568) (-1040.564) (-1042.829) -- 0:03:33
      101500 -- (-1045.176) [-1042.387] (-1040.317) (-1037.963) * (-1044.736) [-1041.606] (-1045.159) (-1040.002) -- 0:03:32
      102000 -- (-1042.485) (-1043.891) (-1043.628) [-1039.739] * (-1036.950) [-1039.278] (-1045.428) (-1043.431) -- 0:03:31
      102500 -- (-1040.440) (-1040.642) (-1033.080) [-1043.425] * (-1037.008) (-1038.041) [-1040.615] (-1039.170) -- 0:03:30
      103000 -- (-1038.821) (-1042.611) [-1049.391] (-1045.419) * [-1037.715] (-1034.620) (-1046.289) (-1041.683) -- 0:03:29
      103500 -- (-1036.832) (-1034.465) [-1036.995] (-1037.461) * [-1037.073] (-1039.330) (-1041.647) (-1040.695) -- 0:03:27
      104000 -- [-1035.528] (-1038.287) (-1045.840) (-1042.716) * (-1037.544) [-1036.760] (-1057.541) (-1036.544) -- 0:03:26
      104500 -- (-1042.244) (-1040.003) (-1044.129) [-1040.316] * (-1039.753) (-1050.078) [-1038.781] (-1039.473) -- 0:03:25
      105000 -- (-1040.144) [-1036.448] (-1042.902) (-1037.653) * (-1045.218) [-1039.379] (-1037.541) (-1038.584) -- 0:03:24

      Average standard deviation of split frequencies: 0.023507

      105500 -- (-1048.255) (-1042.761) [-1041.652] (-1042.775) * (-1038.370) (-1039.597) (-1039.596) [-1039.378] -- 0:03:31
      106000 -- [-1039.421] (-1032.525) (-1042.216) (-1044.329) * (-1045.623) (-1041.058) (-1048.513) [-1039.574] -- 0:03:30
      106500 -- [-1039.726] (-1040.416) (-1042.689) (-1036.375) * (-1040.073) (-1037.255) (-1038.197) [-1042.056] -- 0:03:29
      107000 -- (-1037.839) (-1040.412) (-1036.927) [-1034.815] * [-1038.665] (-1037.138) (-1039.438) (-1035.707) -- 0:03:28
      107500 -- [-1033.058] (-1035.241) (-1051.127) (-1041.238) * (-1039.276) [-1038.534] (-1034.443) (-1039.723) -- 0:03:27
      108000 -- (-1036.708) (-1042.437) (-1042.137) [-1043.687] * [-1041.724] (-1040.702) (-1039.373) (-1043.517) -- 0:03:26
      108500 -- (-1042.673) (-1043.435) (-1048.236) [-1041.836] * (-1034.772) [-1036.036] (-1037.648) (-1037.880) -- 0:03:25
      109000 -- (-1041.207) (-1044.442) [-1038.180] (-1045.243) * [-1040.374] (-1036.325) (-1033.605) (-1042.288) -- 0:03:24
      109500 -- [-1040.781] (-1045.460) (-1040.514) (-1045.191) * (-1037.750) (-1053.222) (-1041.521) [-1041.500] -- 0:03:31
      110000 -- [-1041.418] (-1044.189) (-1044.535) (-1037.746) * (-1043.826) (-1040.309) (-1038.386) [-1040.058] -- 0:03:30

      Average standard deviation of split frequencies: 0.023732

      110500 -- (-1044.932) (-1043.197) [-1037.232] (-1041.719) * (-1041.615) [-1039.938] (-1039.339) (-1046.823) -- 0:03:29
      111000 -- (-1043.126) (-1042.619) [-1042.326] (-1044.828) * [-1039.681] (-1039.388) (-1043.537) (-1043.389) -- 0:03:28
      111500 -- (-1039.954) (-1039.958) (-1041.198) [-1040.136] * (-1047.901) [-1036.665] (-1044.243) (-1046.026) -- 0:03:27
      112000 -- [-1035.847] (-1038.008) (-1036.019) (-1041.807) * (-1041.989) [-1035.646] (-1036.293) (-1041.018) -- 0:03:26
      112500 -- [-1038.020] (-1036.811) (-1040.465) (-1055.721) * (-1045.703) (-1044.144) [-1036.797] (-1041.383) -- 0:03:25
      113000 -- (-1037.844) (-1041.563) (-1045.825) [-1042.345] * [-1038.531] (-1044.845) (-1044.658) (-1043.439) -- 0:03:24
      113500 -- (-1040.620) (-1046.788) [-1041.810] (-1042.864) * [-1040.698] (-1043.759) (-1038.147) (-1040.370) -- 0:03:30
      114000 -- [-1038.331] (-1037.410) (-1054.990) (-1036.456) * (-1036.386) [-1039.930] (-1042.306) (-1047.763) -- 0:03:29
      114500 -- (-1042.741) (-1041.151) [-1044.448] (-1045.453) * [-1037.094] (-1047.488) (-1039.516) (-1039.384) -- 0:03:28
      115000 -- (-1036.629) (-1056.061) (-1048.170) [-1050.216] * (-1043.925) (-1039.638) (-1043.231) [-1036.861] -- 0:03:27

      Average standard deviation of split frequencies: 0.027286

      115500 -- (-1046.873) (-1042.562) [-1038.632] (-1054.373) * (-1042.404) (-1046.163) (-1050.284) [-1037.965] -- 0:03:26
      116000 -- (-1042.406) (-1043.392) (-1038.438) [-1045.370] * [-1040.476] (-1041.054) (-1048.428) (-1041.702) -- 0:03:25
      116500 -- (-1045.157) (-1050.905) [-1041.059] (-1045.817) * (-1035.846) (-1044.820) [-1040.071] (-1045.638) -- 0:03:24
      117000 -- (-1038.854) (-1039.959) [-1037.284] (-1041.195) * [-1038.099] (-1042.786) (-1045.421) (-1040.030) -- 0:03:23
      117500 -- (-1042.809) (-1040.431) (-1044.088) [-1037.684] * [-1038.648] (-1037.339) (-1041.839) (-1045.023) -- 0:03:30
      118000 -- [-1033.590] (-1047.892) (-1038.442) (-1036.034) * (-1051.250) (-1036.396) (-1038.793) [-1036.039] -- 0:03:29
      118500 -- [-1038.062] (-1051.788) (-1039.101) (-1039.988) * (-1037.347) (-1041.597) [-1043.613] (-1036.605) -- 0:03:28
      119000 -- (-1041.657) [-1038.760] (-1036.593) (-1045.727) * (-1039.415) [-1041.272] (-1037.408) (-1037.520) -- 0:03:27
      119500 -- (-1042.629) [-1041.708] (-1042.944) (-1044.595) * [-1044.170] (-1046.288) (-1037.386) (-1042.170) -- 0:03:26
      120000 -- [-1043.397] (-1039.998) (-1040.716) (-1051.484) * (-1046.378) (-1044.415) [-1038.175] (-1046.773) -- 0:03:25

      Average standard deviation of split frequencies: 0.023998

      120500 -- (-1038.128) [-1047.433] (-1041.215) (-1040.926) * (-1040.942) [-1045.570] (-1042.998) (-1038.432) -- 0:03:24
      121000 -- [-1038.436] (-1043.285) (-1043.433) (-1038.169) * (-1055.123) [-1044.794] (-1036.852) (-1040.560) -- 0:03:23
      121500 -- (-1039.663) (-1044.271) [-1040.126] (-1043.668) * [-1038.629] (-1043.328) (-1048.601) (-1039.113) -- 0:03:22
      122000 -- [-1034.511] (-1046.115) (-1038.054) (-1045.456) * (-1038.319) (-1042.620) (-1045.219) [-1038.012] -- 0:03:28
      122500 -- (-1040.605) (-1035.589) (-1044.867) [-1036.130] * [-1039.944] (-1039.307) (-1039.469) (-1044.797) -- 0:03:27
      123000 -- (-1039.674) [-1036.539] (-1042.758) (-1045.488) * (-1041.613) (-1040.869) [-1037.950] (-1035.616) -- 0:03:26
      123500 -- (-1041.539) (-1043.002) [-1044.181] (-1051.888) * [-1038.521] (-1046.678) (-1038.732) (-1041.665) -- 0:03:25
      124000 -- (-1040.058) [-1037.422] (-1045.894) (-1042.231) * (-1034.236) (-1048.729) [-1035.558] (-1036.224) -- 0:03:24
      124500 -- [-1037.854] (-1042.376) (-1039.155) (-1042.637) * [-1043.943] (-1038.498) (-1042.083) (-1039.275) -- 0:03:23
      125000 -- (-1042.238) (-1035.023) [-1038.753] (-1040.012) * (-1045.549) (-1037.244) (-1040.776) [-1038.815] -- 0:03:23

      Average standard deviation of split frequencies: 0.022448

      125500 -- (-1042.111) (-1044.372) [-1038.339] (-1043.746) * (-1043.166) [-1041.368] (-1036.373) (-1041.274) -- 0:03:22
      126000 -- (-1043.582) (-1045.473) (-1043.438) [-1036.405] * (-1041.940) (-1040.823) (-1038.669) [-1041.154] -- 0:03:28
      126500 -- (-1038.926) (-1042.652) [-1041.520] (-1036.669) * (-1041.437) (-1040.258) (-1035.287) [-1041.144] -- 0:03:27
      127000 -- (-1040.948) (-1046.047) [-1038.188] (-1042.509) * (-1047.589) (-1041.126) (-1047.379) [-1041.822] -- 0:03:26
      127500 -- (-1037.741) (-1042.513) [-1039.310] (-1039.558) * (-1040.363) (-1039.103) (-1040.044) [-1034.939] -- 0:03:25
      128000 -- (-1039.235) (-1042.225) [-1038.519] (-1042.422) * (-1039.965) (-1040.933) [-1040.141] (-1040.531) -- 0:03:24
      128500 -- [-1034.368] (-1044.782) (-1044.429) (-1048.825) * (-1053.533) (-1038.790) [-1038.748] (-1039.085) -- 0:03:23
      129000 -- (-1038.248) (-1039.060) (-1039.049) [-1035.624] * (-1047.630) (-1047.700) (-1041.000) [-1042.933] -- 0:03:22
      129500 -- [-1042.819] (-1042.522) (-1039.742) (-1040.931) * (-1041.504) [-1046.603] (-1039.538) (-1040.308) -- 0:03:21
      130000 -- (-1038.427) (-1036.401) [-1037.332] (-1036.742) * [-1042.152] (-1042.366) (-1037.797) (-1051.050) -- 0:03:27

      Average standard deviation of split frequencies: 0.015977

      130500 -- (-1035.957) (-1036.805) [-1041.246] (-1040.909) * (-1038.353) [-1045.879] (-1038.125) (-1046.151) -- 0:03:26
      131000 -- [-1035.244] (-1037.897) (-1037.201) (-1041.227) * (-1040.791) [-1043.159] (-1039.296) (-1036.826) -- 0:03:25
      131500 -- (-1040.142) (-1037.101) (-1043.012) [-1040.275] * (-1049.595) (-1039.479) [-1034.665] (-1040.394) -- 0:03:24
      132000 -- (-1044.668) (-1038.813) (-1040.196) [-1040.144] * (-1043.586) [-1035.842] (-1037.088) (-1037.940) -- 0:03:23
      132500 -- [-1038.277] (-1046.288) (-1043.386) (-1041.101) * (-1035.957) (-1048.472) [-1042.255] (-1045.265) -- 0:03:22
      133000 -- (-1045.151) (-1049.504) [-1044.455] (-1044.014) * (-1046.109) (-1038.780) [-1037.822] (-1049.046) -- 0:03:22
      133500 -- (-1041.902) [-1035.092] (-1046.084) (-1044.017) * (-1043.706) (-1038.428) [-1036.805] (-1044.257) -- 0:03:21
      134000 -- (-1042.537) [-1037.278] (-1044.472) (-1040.390) * [-1043.690] (-1033.002) (-1044.244) (-1038.991) -- 0:03:20
      134500 -- (-1044.778) (-1036.260) (-1042.321) [-1034.648] * (-1037.834) (-1045.240) (-1038.556) [-1036.877] -- 0:03:25
      135000 -- (-1036.002) [-1038.685] (-1040.353) (-1042.934) * (-1038.741) [-1035.802] (-1039.866) (-1045.130) -- 0:03:25

      Average standard deviation of split frequencies: 0.010894

      135500 -- (-1042.597) [-1037.871] (-1044.485) (-1045.964) * (-1040.891) (-1037.984) [-1033.810] (-1035.143) -- 0:03:24
      136000 -- (-1044.046) (-1041.080) (-1043.712) [-1037.738] * [-1042.155] (-1037.457) (-1036.012) (-1042.871) -- 0:03:23
      136500 -- [-1038.755] (-1038.214) (-1040.669) (-1045.614) * [-1038.428] (-1036.924) (-1036.043) (-1039.954) -- 0:03:22
      137000 -- (-1040.020) [-1037.578] (-1038.539) (-1044.832) * (-1042.791) [-1040.364] (-1036.616) (-1042.443) -- 0:03:21
      137500 -- (-1040.635) [-1038.409] (-1036.822) (-1039.751) * [-1040.644] (-1034.730) (-1040.361) (-1036.897) -- 0:03:20
      138000 -- (-1037.928) [-1038.241] (-1038.237) (-1036.943) * (-1049.562) (-1037.215) (-1043.162) [-1039.647] -- 0:03:19
      138500 -- (-1046.981) [-1039.791] (-1046.730) (-1037.876) * (-1044.154) [-1038.914] (-1043.719) (-1039.866) -- 0:03:25
      139000 -- (-1037.144) (-1038.540) (-1041.111) [-1041.485] * (-1042.198) (-1041.023) (-1041.361) [-1039.439] -- 0:03:24
      139500 -- (-1046.551) (-1036.521) (-1040.351) [-1041.709] * (-1039.799) (-1042.360) [-1041.162] (-1045.580) -- 0:03:23
      140000 -- (-1045.109) (-1040.776) (-1037.243) [-1038.389] * (-1042.248) (-1039.544) (-1042.576) [-1038.607] -- 0:03:22

      Average standard deviation of split frequencies: 0.012447

      140500 -- (-1041.236) (-1040.616) (-1035.743) [-1037.345] * (-1039.965) (-1039.193) (-1045.036) [-1037.066] -- 0:03:21
      141000 -- [-1045.400] (-1039.342) (-1041.207) (-1038.109) * (-1037.517) (-1048.752) (-1037.715) [-1036.404] -- 0:03:21
      141500 -- (-1042.733) [-1041.270] (-1036.080) (-1038.198) * (-1037.930) (-1047.803) [-1038.195] (-1039.987) -- 0:03:20
      142000 -- (-1053.460) (-1038.303) (-1045.703) [-1038.154] * (-1041.130) (-1047.768) [-1039.666] (-1040.618) -- 0:03:19
      142500 -- (-1038.541) (-1038.604) [-1038.490] (-1041.236) * (-1046.033) (-1044.286) [-1044.178] (-1035.185) -- 0:03:18
      143000 -- [-1041.350] (-1039.735) (-1044.495) (-1041.006) * (-1040.454) (-1040.910) (-1037.963) [-1035.857] -- 0:03:23
      143500 -- (-1038.350) (-1039.552) (-1043.788) [-1045.359] * (-1043.568) (-1039.910) [-1032.311] (-1036.939) -- 0:03:22
      144000 -- [-1039.154] (-1041.620) (-1043.375) (-1043.801) * (-1036.624) [-1038.730] (-1036.824) (-1047.304) -- 0:03:22
      144500 -- (-1041.949) (-1041.283) (-1041.627) [-1041.014] * (-1044.916) [-1045.572] (-1041.757) (-1044.212) -- 0:03:21
      145000 -- [-1043.042] (-1050.078) (-1038.436) (-1042.943) * [-1046.898] (-1038.605) (-1043.311) (-1041.728) -- 0:03:20

      Average standard deviation of split frequencies: 0.011531

      145500 -- (-1039.096) (-1042.123) (-1046.483) [-1035.040] * [-1041.657] (-1037.874) (-1034.757) (-1043.273) -- 0:03:19
      146000 -- (-1043.885) (-1047.647) (-1049.691) [-1039.460] * (-1040.439) (-1042.786) (-1042.178) [-1039.163] -- 0:03:18
      146500 -- (-1045.875) (-1039.484) (-1042.709) [-1035.873] * (-1043.087) (-1041.362) [-1040.525] (-1041.940) -- 0:03:23
      147000 -- [-1046.294] (-1046.704) (-1040.513) (-1037.463) * (-1047.861) (-1043.200) [-1031.676] (-1039.192) -- 0:03:23
      147500 -- (-1048.298) (-1051.217) [-1039.424] (-1040.392) * (-1044.199) (-1047.266) (-1050.047) [-1036.879] -- 0:03:22
      148000 -- (-1051.852) (-1052.501) [-1045.152] (-1036.183) * (-1041.165) [-1041.002] (-1038.003) (-1038.496) -- 0:03:21
      148500 -- (-1040.843) (-1044.574) (-1037.798) [-1038.527] * (-1044.365) (-1040.023) [-1041.820] (-1036.507) -- 0:03:20
      149000 -- (-1042.722) (-1047.149) [-1034.791] (-1038.973) * (-1040.848) [-1037.073] (-1039.926) (-1038.738) -- 0:03:19
      149500 -- (-1042.351) (-1039.036) (-1034.562) [-1034.564] * (-1044.171) (-1035.893) [-1037.312] (-1044.537) -- 0:03:19
      150000 -- (-1051.709) (-1036.708) [-1039.768] (-1045.660) * (-1050.560) (-1042.579) [-1042.495] (-1039.468) -- 0:03:18

      Average standard deviation of split frequencies: 0.011621

      150500 -- (-1043.850) (-1042.055) [-1042.924] (-1046.973) * (-1040.213) (-1040.584) [-1034.266] (-1045.596) -- 0:03:23
      151000 -- (-1038.502) (-1041.019) [-1037.673] (-1048.215) * (-1035.329) [-1043.370] (-1038.085) (-1050.075) -- 0:03:22
      151500 -- (-1044.453) [-1044.654] (-1044.874) (-1044.877) * (-1041.115) (-1040.780) (-1042.823) [-1036.517] -- 0:03:21
      152000 -- (-1040.755) (-1036.239) (-1043.542) [-1037.504] * [-1041.874] (-1038.835) (-1047.652) (-1037.755) -- 0:03:20
      152500 -- (-1043.772) [-1041.702] (-1039.860) (-1051.292) * (-1041.458) (-1040.413) [-1036.295] (-1039.668) -- 0:03:20
      153000 -- [-1040.130] (-1038.638) (-1047.317) (-1044.479) * [-1046.309] (-1041.811) (-1041.985) (-1046.861) -- 0:03:19
      153500 -- (-1043.697) (-1045.996) [-1045.711] (-1047.438) * (-1036.727) (-1042.611) [-1037.570] (-1036.539) -- 0:03:18
      154000 -- (-1042.554) (-1045.677) [-1037.718] (-1040.161) * (-1039.211) [-1041.928] (-1039.619) (-1046.738) -- 0:03:17
      154500 -- (-1047.178) [-1039.584] (-1044.271) (-1042.719) * (-1040.746) (-1043.728) [-1038.183] (-1039.987) -- 0:03:17
      155000 -- (-1038.433) [-1038.438] (-1036.026) (-1047.790) * (-1056.825) (-1038.644) (-1035.394) [-1038.622] -- 0:03:21

      Average standard deviation of split frequencies: 0.012951

      155500 -- (-1043.621) (-1036.092) [-1038.575] (-1048.939) * [-1034.251] (-1042.114) (-1038.872) (-1041.409) -- 0:03:20
      156000 -- (-1044.385) [-1034.808] (-1038.081) (-1042.641) * (-1046.158) (-1041.442) [-1041.242] (-1044.015) -- 0:03:20
      156500 -- (-1039.078) (-1041.972) [-1040.864] (-1038.356) * (-1038.531) (-1038.913) (-1038.449) [-1039.142] -- 0:03:19
      157000 -- [-1039.190] (-1047.535) (-1044.659) (-1041.805) * (-1039.848) (-1036.660) (-1043.798) [-1040.021] -- 0:03:18
      157500 -- (-1038.941) [-1041.003] (-1043.511) (-1033.757) * (-1036.376) (-1042.311) (-1041.611) [-1038.404] -- 0:03:17
      158000 -- (-1046.253) (-1034.635) (-1040.040) [-1038.192] * (-1051.193) (-1055.774) (-1039.349) [-1042.582] -- 0:03:17
      158500 -- (-1041.683) (-1039.024) [-1039.692] (-1046.210) * (-1040.904) (-1045.921) [-1036.488] (-1040.083) -- 0:03:16
      159000 -- (-1037.002) [-1037.275] (-1042.737) (-1045.336) * (-1038.200) [-1039.032] (-1042.878) (-1037.853) -- 0:03:15
      159500 -- [-1040.770] (-1040.461) (-1048.951) (-1042.619) * (-1042.700) [-1039.219] (-1037.269) (-1057.948) -- 0:03:20
      160000 -- [-1034.731] (-1043.358) (-1046.441) (-1044.742) * (-1044.430) [-1047.500] (-1051.722) (-1044.953) -- 0:03:19

      Average standard deviation of split frequencies: 0.015509

      160500 -- (-1045.287) [-1043.969] (-1040.905) (-1042.762) * (-1041.260) [-1036.931] (-1045.921) (-1036.098) -- 0:03:18
      161000 -- (-1037.108) [-1045.823] (-1041.055) (-1040.782) * (-1041.406) (-1041.620) (-1036.718) [-1041.218] -- 0:03:18
      161500 -- (-1041.868) (-1044.672) (-1043.777) [-1040.733] * (-1045.790) (-1037.176) (-1046.734) [-1035.662] -- 0:03:17
      162000 -- (-1038.684) (-1042.944) (-1051.998) [-1046.517] * [-1045.089] (-1036.599) (-1049.138) (-1041.816) -- 0:03:16
      162500 -- (-1041.217) (-1037.838) [-1036.155] (-1040.900) * [-1040.679] (-1042.059) (-1041.135) (-1036.423) -- 0:03:15