--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:29:03 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/2res/gidB/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1018.17 -1021.36
2 -1018.17 -1021.37
--------------------------------------
TOTAL -1018.17 -1021.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.905153 0.092386 0.369773 1.524082 0.868701 1443.18 1469.70 1.000
r(A<->C){all} 0.183087 0.022214 0.000036 0.484401 0.147267 196.59 199.36 1.004
r(A<->G){all} 0.166040 0.019929 0.000337 0.457689 0.128301 156.47 222.50 1.004
r(A<->T){all} 0.151048 0.017158 0.000007 0.424938 0.112053 189.95 220.42 1.001
r(C<->G){all} 0.176979 0.021425 0.000072 0.474096 0.136889 205.13 231.32 1.013
r(C<->T){all} 0.160529 0.017442 0.000032 0.424880 0.128246 133.12 204.29 1.005
r(G<->T){all} 0.162316 0.017786 0.000015 0.428818 0.129973 238.23 264.87 1.007
pi(A){all} 0.217595 0.000229 0.189683 0.248446 0.217673 1227.59 1311.53 1.000
pi(C){all} 0.187093 0.000195 0.159881 0.214556 0.186912 1207.05 1307.62 1.000
pi(G){all} 0.311351 0.000273 0.280295 0.344782 0.310813 1165.63 1251.17 1.000
pi(T){all} 0.283960 0.000276 0.252141 0.316673 0.283615 1195.32 1246.63 1.001
alpha{1,2} 0.419730 0.211994 0.000140 1.328387 0.263099 1301.41 1385.37 1.000
alpha{3} 0.453390 0.239721 0.000135 1.432013 0.297066 1158.74 1208.13 1.000
pinvar{all} 0.997884 0.000006 0.993279 0.999999 0.998666 1067.61 1162.63 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -977.601994
Model 2: PositiveSelection -977.60194
Model 0: one-ratio -977.601946
Model 7: beta -977.602046
Model 8: beta&w>1 -977.601945
Model 0 vs 1 9.599999998499698E-5
Model 2 vs 1 1.0799999995469989E-4
Model 8 vs 7 2.0199999994474638E-4
>C1
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C2
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C3
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C4
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C5
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C6
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=248
C1 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C2 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C3 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C4 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C5 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C6 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
**************************************************
C1 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C2 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C3 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C4 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C5 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C6 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
**************************************************
C1 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C2 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C3 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C4 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C5 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C6 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
**************************************************
C1 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C2 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C3 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C4 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C5 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C6 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
**************************************************
C1 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C2 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C3 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C4 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C5 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C6 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
************************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 248 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 248 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7440]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7440]--->[7440]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.483 Mb, Max= 30.790 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C2 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C3 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C4 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C5 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
C6 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
**************************************************
C1 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C2 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C3 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C4 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C5 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
C6 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
**************************************************
C1 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C2 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C3 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C4 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C5 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
C6 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
**************************************************
C1 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C2 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C3 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C4 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C5 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
C6 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
**************************************************
C1 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C2 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C3 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C4 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C5 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
C6 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
************************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
C2 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
C3 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
C4 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
C5 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
C6 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
**************************************************
C1 GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
C2 GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
C3 GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
C4 GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
C5 GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
C6 GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
**************************************************
C1 TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
C2 TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
C3 TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
C4 TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
C5 TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
C6 TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
**************************************************
C1 GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
C2 GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
C3 GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
C4 GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
C5 GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
C6 GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
**************************************************
C1 GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
C2 GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
C3 GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
C4 GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
C5 GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
C6 GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
**************************************************
C1 ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
C2 ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
C3 ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
C4 ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
C5 ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
C6 ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
**************************************************
C1 TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
C2 TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
C3 TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
C4 TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
C5 TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
C6 TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
**************************************************
C1 ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
C2 ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
C3 ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
C4 ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
C5 ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
C6 ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
**************************************************
C1 TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
C2 TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
C3 TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
C4 TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
C5 TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
C6 TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
**************************************************
C1 CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
C2 CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
C3 CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
C4 CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
C5 CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
C6 CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
**************************************************
C1 CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
C2 CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
C3 CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
C4 CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
C5 CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
C6 CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
**************************************************
C1 TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
C2 TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
C3 TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
C4 TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
C5 TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
C6 TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
**************************************************
C1 GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
C2 GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
C3 GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
C4 GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
C5 GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
C6 GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
**************************************************
C1 GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
C2 GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
C3 GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
C4 GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
C5 GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
C6 GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
**************************************************
C1 AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
C2 AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
C3 AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
C4 AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
C5 AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
C6 AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
********************************************
>C1
GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>C2
GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>C3
GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>C4
GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>C5
GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>C6
GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC
GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA
TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC
GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG
GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG
ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG
TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC
ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC
TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT
CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA
CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC
TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT
GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC
GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC
AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>C1
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C2
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C3
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C4
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C5
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
>C6
VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 744 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789667
Setting output file names to "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 366604599
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0531505978
Seed = 288803753
Swapseed = 1579789667
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1665.107407 -- -24.965149
Chain 2 -- -1665.107659 -- -24.965149
Chain 3 -- -1665.107562 -- -24.965149
Chain 4 -- -1665.107562 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1665.107659 -- -24.965149
Chain 2 -- -1665.107407 -- -24.965149
Chain 3 -- -1665.107659 -- -24.965149
Chain 4 -- -1665.107659 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1665.107] (-1665.108) (-1665.108) (-1665.108) * [-1665.108] (-1665.107) (-1665.108) (-1665.108)
500 -- [-1035.543] (-1066.310) (-1037.691) (-1040.322) * [-1027.281] (-1029.419) (-1022.632) (-1042.403) -- 0:00:00
1000 -- (-1027.721) (-1032.462) [-1025.347] (-1033.201) * (-1025.615) [-1030.679] (-1026.381) (-1029.310) -- 0:00:00
1500 -- [-1029.208] (-1029.375) (-1037.040) (-1031.813) * (-1030.642) (-1022.195) [-1028.328] (-1033.754) -- 0:00:00
2000 -- (-1031.369) (-1029.662) (-1028.093) [-1028.046] * (-1030.149) (-1028.001) (-1031.528) [-1024.558] -- 0:00:00
2500 -- (-1030.773) (-1033.454) [-1024.178] (-1026.306) * (-1024.400) (-1027.091) [-1025.889] (-1031.704) -- 0:00:00
3000 -- (-1028.459) (-1028.133) (-1032.352) [-1025.873] * (-1023.726) (-1027.667) (-1025.714) [-1027.236] -- 0:00:00
3500 -- (-1029.925) [-1023.881] (-1026.016) (-1028.074) * (-1023.404) (-1026.338) [-1021.131] (-1030.252) -- 0:00:00
4000 -- [-1029.775] (-1031.750) (-1031.403) (-1026.421) * (-1025.866) [-1034.919] (-1026.306) (-1032.330) -- 0:00:00
4500 -- (-1027.625) (-1033.121) [-1025.155] (-1029.309) * [-1023.466] (-1029.556) (-1032.030) (-1035.702) -- 0:00:00
5000 -- (-1035.497) [-1025.941] (-1025.345) (-1029.256) * (-1025.371) (-1025.280) [-1022.741] (-1034.730) -- 0:00:00
Average standard deviation of split frequencies: 0.114280
5500 -- (-1022.258) [-1024.805] (-1026.370) (-1028.125) * (-1028.904) [-1025.600] (-1024.500) (-1027.578) -- 0:00:00
6000 -- (-1029.816) (-1028.828) [-1026.938] (-1030.607) * (-1026.995) (-1026.149) [-1023.078] (-1023.552) -- 0:02:45
6500 -- (-1028.378) (-1025.886) [-1025.887] (-1032.960) * (-1028.387) [-1023.765] (-1026.906) (-1028.142) -- 0:02:32
7000 -- (-1028.019) (-1036.732) [-1027.116] (-1031.617) * (-1024.269) (-1027.001) [-1024.569] (-1028.187) -- 0:02:21
7500 -- [-1028.571] (-1030.507) (-1029.563) (-1024.073) * (-1026.173) (-1023.174) [-1027.314] (-1026.351) -- 0:02:12
8000 -- (-1023.958) (-1021.753) (-1032.735) [-1029.265] * (-1025.913) (-1026.681) [-1025.265] (-1026.985) -- 0:02:04
8500 -- [-1025.999] (-1029.128) (-1030.212) (-1039.902) * (-1035.654) [-1029.353] (-1038.073) (-1029.900) -- 0:01:56
9000 -- (-1029.742) [-1026.263] (-1039.632) (-1034.801) * [-1028.091] (-1024.824) (-1025.145) (-1027.991) -- 0:01:50
9500 -- (-1026.177) (-1042.927) (-1023.678) [-1026.049] * (-1031.563) [-1027.491] (-1026.429) (-1029.296) -- 0:01:44
10000 -- (-1029.394) (-1030.118) [-1025.878] (-1038.309) * (-1025.231) (-1029.556) [-1022.598] (-1033.237) -- 0:01:39
Average standard deviation of split frequencies: 0.064082
10500 -- (-1033.440) (-1033.388) [-1027.306] (-1026.901) * (-1025.752) (-1025.419) [-1023.724] (-1025.590) -- 0:01:34
11000 -- (-1034.134) (-1028.364) (-1024.087) [-1025.734] * (-1029.219) (-1029.257) (-1020.280) [-1029.086] -- 0:01:29
11500 -- (-1024.014) (-1029.153) (-1026.408) [-1027.500] * [-1031.061] (-1027.174) (-1027.859) (-1027.094) -- 0:01:25
12000 -- (-1028.285) (-1033.994) [-1029.770] (-1029.864) * (-1033.008) (-1033.571) [-1028.400] (-1028.995) -- 0:01:22
12500 -- [-1026.246] (-1030.476) (-1033.117) (-1030.036) * (-1031.180) (-1023.503) (-1024.063) [-1032.306] -- 0:01:19
13000 -- [-1030.364] (-1033.657) (-1029.899) (-1038.294) * (-1027.381) (-1027.321) [-1024.299] (-1025.028) -- 0:01:15
13500 -- [-1029.647] (-1027.744) (-1027.785) (-1035.640) * [-1030.569] (-1031.408) (-1043.215) (-1032.012) -- 0:01:13
14000 -- [-1026.249] (-1026.492) (-1031.480) (-1033.796) * [-1031.131] (-1022.935) (-1034.766) (-1032.505) -- 0:01:10
14500 -- (-1032.493) (-1028.392) [-1023.587] (-1039.431) * (-1027.751) (-1021.275) (-1039.880) [-1025.363] -- 0:01:07
15000 -- [-1025.047] (-1027.792) (-1025.726) (-1025.600) * (-1027.718) [-1017.870] (-1029.676) (-1031.648) -- 0:01:05
Average standard deviation of split frequencies: 0.050087
15500 -- [-1022.523] (-1035.606) (-1030.832) (-1025.296) * (-1036.094) (-1018.558) [-1022.414] (-1026.214) -- 0:01:03
16000 -- (-1035.779) (-1024.544) (-1029.506) [-1028.254] * (-1034.885) (-1017.612) [-1027.633] (-1029.532) -- 0:01:01
16500 -- [-1024.433] (-1031.236) (-1028.857) (-1034.004) * [-1026.563] (-1017.626) (-1025.985) (-1030.665) -- 0:00:59
17000 -- (-1029.837) (-1028.932) [-1027.724] (-1026.772) * [-1021.774] (-1018.782) (-1032.613) (-1023.472) -- 0:00:57
17500 -- (-1024.458) [-1025.338] (-1036.861) (-1033.569) * [-1023.827] (-1019.173) (-1029.037) (-1028.554) -- 0:00:56
18000 -- [-1024.118] (-1031.763) (-1029.921) (-1034.470) * [-1027.779] (-1018.995) (-1022.593) (-1040.631) -- 0:00:54
18500 -- (-1026.373) (-1033.464) (-1026.238) [-1021.777] * (-1029.976) (-1018.942) (-1032.819) [-1032.507] -- 0:00:53
19000 -- (-1026.127) (-1035.723) [-1027.545] (-1028.197) * (-1029.818) (-1019.968) (-1035.606) [-1025.082] -- 0:00:51
19500 -- (-1027.478) (-1028.267) [-1025.480] (-1033.599) * (-1034.547) (-1021.111) [-1028.227] (-1027.060) -- 0:00:50
20000 -- (-1028.538) (-1034.142) [-1027.432] (-1022.086) * (-1035.244) (-1020.127) [-1024.616] (-1021.643) -- 0:00:49
Average standard deviation of split frequencies: 0.041343
20500 -- (-1026.258) (-1030.797) [-1026.664] (-1032.978) * [-1027.749] (-1021.884) (-1020.953) (-1035.277) -- 0:01:35
21000 -- (-1037.206) (-1033.448) (-1023.255) [-1024.982] * [-1035.016] (-1018.476) (-1026.862) (-1027.033) -- 0:01:33
21500 -- (-1025.578) [-1027.329] (-1033.979) (-1025.990) * [-1017.443] (-1018.194) (-1027.512) (-1025.214) -- 0:01:31
22000 -- (-1020.321) (-1025.349) [-1025.901] (-1033.897) * (-1019.800) (-1022.339) (-1026.857) [-1023.214] -- 0:01:28
22500 -- (-1019.013) (-1025.531) [-1033.292] (-1027.865) * [-1017.860] (-1019.147) (-1028.875) (-1032.161) -- 0:01:26
23000 -- [-1016.845] (-1027.433) (-1040.251) (-1029.209) * [-1017.654] (-1016.826) (-1027.901) (-1032.190) -- 0:01:24
23500 -- (-1018.861) (-1039.018) [-1025.908] (-1029.347) * (-1017.649) (-1018.334) (-1025.284) [-1031.908] -- 0:01:23
24000 -- (-1018.942) [-1023.590] (-1027.755) (-1038.294) * (-1020.518) (-1017.670) [-1025.063] (-1032.511) -- 0:01:21
24500 -- (-1018.315) (-1019.263) [-1025.053] (-1018.006) * (-1017.108) [-1019.788] (-1028.709) (-1025.063) -- 0:01:19
25000 -- [-1020.429] (-1017.433) (-1034.049) (-1019.845) * [-1017.039] (-1020.993) (-1020.959) (-1034.416) -- 0:01:18
Average standard deviation of split frequencies: 0.033672
25500 -- (-1020.946) [-1018.673] (-1028.296) (-1020.208) * (-1016.797) (-1022.907) [-1027.944] (-1026.261) -- 0:01:16
26000 -- (-1017.452) (-1016.682) (-1026.153) [-1021.029] * (-1018.223) [-1018.353] (-1029.596) (-1024.199) -- 0:01:14
26500 -- [-1018.557] (-1019.413) (-1022.467) (-1020.278) * [-1022.961] (-1017.779) (-1026.820) (-1035.667) -- 0:01:13
27000 -- [-1018.577] (-1019.094) (-1021.608) (-1021.961) * [-1017.586] (-1018.776) (-1037.612) (-1037.996) -- 0:01:12
27500 -- [-1019.621] (-1016.979) (-1019.144) (-1019.115) * (-1019.946) [-1018.197] (-1028.276) (-1029.261) -- 0:01:10
28000 -- (-1022.652) (-1018.663) [-1017.713] (-1019.809) * [-1017.790] (-1020.965) (-1033.407) (-1032.179) -- 0:01:09
28500 -- (-1023.592) (-1020.257) (-1017.199) [-1016.651] * [-1017.194] (-1019.049) (-1023.087) (-1030.132) -- 0:01:08
29000 -- (-1023.636) (-1020.577) [-1019.168] (-1017.113) * (-1018.040) [-1018.475] (-1031.386) (-1026.042) -- 0:01:06
29500 -- (-1019.259) (-1019.558) [-1019.057] (-1019.471) * [-1018.923] (-1018.475) (-1027.524) (-1027.662) -- 0:01:05
30000 -- (-1018.054) (-1025.711) [-1019.738] (-1020.581) * (-1018.451) (-1020.362) [-1038.212] (-1030.038) -- 0:01:04
Average standard deviation of split frequencies: 0.030744
30500 -- (-1020.440) (-1020.071) [-1021.598] (-1022.943) * (-1017.452) (-1017.248) (-1025.347) [-1023.849] -- 0:01:03
31000 -- (-1021.264) [-1021.621] (-1020.945) (-1018.928) * [-1017.826] (-1017.669) (-1024.090) (-1030.431) -- 0:01:02
31500 -- [-1018.556] (-1020.292) (-1020.324) (-1018.711) * (-1018.083) (-1017.484) [-1030.379] (-1026.418) -- 0:01:01
32000 -- (-1019.877) [-1020.532] (-1020.108) (-1019.393) * (-1018.083) (-1017.634) (-1029.373) [-1026.289] -- 0:01:00
32500 -- (-1022.050) [-1018.310] (-1019.640) (-1021.811) * (-1022.222) (-1018.649) [-1024.959] (-1028.697) -- 0:00:59
33000 -- [-1022.085] (-1020.401) (-1020.324) (-1021.865) * (-1019.436) (-1017.499) [-1028.086] (-1023.321) -- 0:00:58
33500 -- [-1019.396] (-1017.639) (-1026.533) (-1019.225) * (-1017.035) [-1018.920] (-1024.979) (-1037.428) -- 0:00:57
34000 -- (-1019.337) [-1019.583] (-1023.037) (-1021.740) * (-1017.255) [-1018.549] (-1026.016) (-1032.145) -- 0:00:56
34500 -- [-1016.960] (-1019.169) (-1020.182) (-1017.722) * (-1018.850) (-1018.938) [-1024.672] (-1030.956) -- 0:00:55
35000 -- (-1017.976) (-1019.208) (-1019.350) [-1018.203] * [-1017.896] (-1021.417) (-1029.738) (-1028.400) -- 0:00:55
Average standard deviation of split frequencies: 0.036010
35500 -- (-1022.572) (-1019.680) (-1018.684) [-1018.022] * (-1019.167) (-1019.336) [-1026.147] (-1030.738) -- 0:01:21
36000 -- [-1018.500] (-1024.221) (-1019.235) (-1016.708) * (-1017.241) (-1021.980) [-1025.527] (-1031.849) -- 0:01:20
36500 -- (-1021.792) (-1017.471) [-1019.743] (-1018.724) * (-1017.547) (-1018.497) [-1026.121] (-1043.294) -- 0:01:19
37000 -- [-1018.200] (-1018.637) (-1019.238) (-1018.781) * (-1016.748) (-1019.289) (-1029.055) [-1016.752] -- 0:01:18
37500 -- (-1021.467) (-1020.672) (-1021.062) [-1018.917] * (-1018.454) (-1018.294) (-1032.551) [-1017.210] -- 0:01:17
38000 -- (-1023.934) (-1022.651) [-1019.941] (-1024.709) * (-1017.708) (-1018.818) (-1038.942) [-1017.085] -- 0:01:15
38500 -- [-1018.617] (-1024.652) (-1019.351) (-1023.017) * [-1017.336] (-1019.154) (-1031.171) (-1018.960) -- 0:01:14
39000 -- (-1017.363) (-1022.961) (-1021.111) [-1023.542] * (-1017.092) [-1018.035] (-1030.519) (-1020.254) -- 0:01:13
39500 -- (-1017.505) (-1019.300) [-1024.167] (-1018.391) * (-1018.000) (-1018.544) [-1026.731] (-1025.978) -- 0:01:12
40000 -- [-1017.739] (-1022.413) (-1024.339) (-1019.265) * [-1017.074] (-1019.368) (-1036.352) (-1028.907) -- 0:01:12
Average standard deviation of split frequencies: 0.028065
40500 -- (-1019.072) (-1021.450) (-1020.208) [-1021.003] * [-1020.014] (-1020.195) (-1025.644) (-1021.814) -- 0:01:11
41000 -- (-1018.934) (-1018.128) [-1017.223] (-1019.532) * (-1022.505) [-1020.067] (-1033.140) (-1019.498) -- 0:01:10
41500 -- (-1021.769) (-1019.157) (-1018.450) [-1018.723] * (-1019.496) (-1021.793) [-1028.720] (-1020.316) -- 0:01:09
42000 -- (-1018.710) (-1020.015) (-1018.469) [-1018.990] * (-1024.550) (-1021.174) [-1024.230] (-1018.677) -- 0:01:08
42500 -- (-1016.590) (-1018.599) [-1018.517] (-1020.245) * (-1024.795) (-1020.382) [-1021.678] (-1018.863) -- 0:01:07
43000 -- (-1018.594) (-1021.468) [-1017.278] (-1018.389) * (-1016.946) [-1020.064] (-1021.490) (-1020.355) -- 0:01:06
43500 -- (-1019.548) (-1017.185) [-1017.725] (-1021.362) * (-1017.575) (-1022.537) (-1021.712) [-1021.782] -- 0:01:05
44000 -- (-1020.170) [-1018.263] (-1017.836) (-1019.319) * (-1018.032) (-1020.228) (-1019.545) [-1018.095] -- 0:01:05
44500 -- (-1019.397) (-1017.962) [-1017.226] (-1017.880) * [-1018.782] (-1019.725) (-1018.938) (-1018.910) -- 0:01:04
45000 -- (-1018.582) (-1021.212) (-1019.352) [-1017.855] * (-1020.439) (-1019.515) [-1020.091] (-1019.544) -- 0:01:03
Average standard deviation of split frequencies: 0.028182
45500 -- [-1018.207] (-1021.845) (-1019.581) (-1019.145) * [-1020.130] (-1018.010) (-1020.471) (-1018.398) -- 0:01:02
46000 -- (-1016.792) [-1017.774] (-1019.259) (-1017.657) * (-1021.749) (-1019.053) (-1019.424) [-1021.589] -- 0:01:02
46500 -- (-1017.517) (-1018.882) [-1018.328] (-1017.474) * [-1019.814] (-1017.063) (-1018.552) (-1018.775) -- 0:01:01
47000 -- (-1017.555) [-1016.868] (-1017.190) (-1017.067) * (-1020.194) (-1018.068) [-1018.232] (-1017.352) -- 0:01:00
47500 -- (-1019.195) [-1017.492] (-1016.486) (-1023.067) * (-1022.137) (-1021.195) [-1019.165] (-1017.611) -- 0:01:00
48000 -- [-1019.811] (-1019.155) (-1017.840) (-1020.058) * (-1021.590) [-1022.662] (-1017.912) (-1021.204) -- 0:00:59
48500 -- (-1019.371) [-1017.475] (-1021.875) (-1021.631) * (-1025.062) (-1017.679) [-1019.434] (-1022.073) -- 0:00:58
49000 -- [-1018.571] (-1020.689) (-1022.692) (-1021.496) * [-1021.814] (-1017.758) (-1017.504) (-1021.122) -- 0:00:58
49500 -- (-1017.891) [-1018.768] (-1022.859) (-1022.935) * [-1017.560] (-1019.510) (-1018.362) (-1018.642) -- 0:00:57
50000 -- (-1017.933) (-1016.650) (-1019.017) [-1018.087] * (-1017.667) (-1019.509) [-1018.534] (-1017.328) -- 0:00:57
Average standard deviation of split frequencies: 0.025464
50500 -- (-1018.161) [-1018.366] (-1020.626) (-1017.801) * [-1017.788] (-1017.959) (-1022.089) (-1019.678) -- 0:01:15
51000 -- (-1020.558) (-1020.677) (-1019.972) [-1017.919] * (-1018.624) (-1017.590) (-1018.386) [-1017.081] -- 0:01:14
51500 -- [-1019.304] (-1025.379) (-1019.796) (-1022.564) * (-1017.502) (-1017.161) [-1019.322] (-1017.254) -- 0:01:13
52000 -- (-1019.831) (-1020.670) (-1020.107) [-1020.615] * (-1018.641) [-1017.721] (-1019.294) (-1017.697) -- 0:01:12
52500 -- (-1017.856) [-1020.406] (-1021.131) (-1024.544) * (-1018.051) (-1018.561) (-1022.131) [-1017.433] -- 0:01:12
53000 -- [-1017.181] (-1020.204) (-1019.534) (-1023.425) * (-1019.458) [-1017.510] (-1023.325) (-1019.524) -- 0:01:11
53500 -- (-1021.353) (-1023.883) (-1018.413) [-1019.112] * (-1017.623) [-1024.351] (-1025.098) (-1016.723) -- 0:01:10
54000 -- (-1022.701) [-1020.352] (-1022.712) (-1017.172) * (-1017.802) [-1021.749] (-1018.478) (-1017.172) -- 0:01:10
54500 -- (-1019.350) (-1019.319) [-1019.341] (-1020.834) * (-1017.828) (-1022.252) [-1018.173] (-1017.531) -- 0:01:09
55000 -- [-1020.402] (-1019.117) (-1017.725) (-1021.499) * (-1018.831) (-1018.497) (-1019.160) [-1019.184] -- 0:01:08
Average standard deviation of split frequencies: 0.029241
55500 -- (-1018.312) [-1020.022] (-1017.292) (-1020.029) * (-1018.057) [-1020.085] (-1021.613) (-1022.112) -- 0:01:08
56000 -- [-1019.175] (-1023.998) (-1019.864) (-1019.002) * [-1018.696] (-1020.056) (-1019.106) (-1018.902) -- 0:01:07
56500 -- (-1017.296) (-1017.054) [-1018.752] (-1017.610) * (-1019.195) (-1016.871) [-1018.405] (-1017.928) -- 0:01:06
57000 -- [-1018.757] (-1018.264) (-1019.142) (-1016.794) * (-1017.525) [-1017.394] (-1018.454) (-1020.741) -- 0:01:06
57500 -- (-1019.432) (-1018.618) (-1022.569) [-1017.382] * (-1017.383) (-1017.705) [-1018.279] (-1018.780) -- 0:01:05
58000 -- [-1018.618] (-1018.805) (-1020.013) (-1021.910) * [-1017.757] (-1017.647) (-1019.515) (-1018.899) -- 0:01:04
58500 -- (-1018.028) (-1017.636) (-1021.275) [-1020.513] * (-1017.714) [-1017.391] (-1022.796) (-1019.595) -- 0:01:04
59000 -- (-1017.216) (-1018.123) (-1020.934) [-1017.119] * (-1019.846) [-1018.571] (-1021.575) (-1017.674) -- 0:01:03
59500 -- [-1017.280] (-1017.744) (-1019.895) (-1018.464) * (-1019.405) (-1018.574) (-1019.591) [-1019.024] -- 0:01:03
60000 -- (-1021.870) [-1018.600] (-1018.305) (-1020.001) * [-1017.972] (-1018.903) (-1021.695) (-1017.375) -- 0:01:02
Average standard deviation of split frequencies: 0.029139
60500 -- (-1021.796) (-1017.434) [-1017.391] (-1021.158) * (-1017.216) [-1018.646] (-1021.775) (-1023.457) -- 0:01:02
61000 -- (-1020.823) (-1017.925) (-1022.344) [-1018.810] * (-1023.263) (-1019.082) [-1020.881] (-1027.098) -- 0:01:01
61500 -- (-1018.495) (-1018.774) (-1021.596) [-1016.843] * (-1016.954) [-1018.580] (-1021.960) (-1018.876) -- 0:01:01
62000 -- [-1020.285] (-1017.311) (-1023.037) (-1018.894) * (-1019.713) [-1018.493] (-1022.489) (-1018.998) -- 0:01:00
62500 -- [-1017.637] (-1017.496) (-1020.330) (-1023.357) * [-1017.615] (-1018.242) (-1018.749) (-1018.675) -- 0:01:00
63000 -- [-1018.212] (-1017.495) (-1018.217) (-1018.353) * (-1019.960) (-1019.386) (-1018.747) [-1017.311] -- 0:00:59
63500 -- [-1018.419] (-1017.319) (-1018.762) (-1018.734) * [-1018.349] (-1019.339) (-1020.098) (-1017.825) -- 0:00:58
64000 -- [-1018.692] (-1017.841) (-1022.706) (-1016.842) * (-1018.975) (-1019.043) (-1021.770) [-1018.142] -- 0:00:58
64500 -- (-1021.880) (-1018.258) (-1020.356) [-1018.428] * (-1020.692) (-1023.628) [-1022.415] (-1021.127) -- 0:00:58
65000 -- [-1017.919] (-1017.862) (-1019.534) (-1016.653) * (-1023.746) (-1021.296) [-1018.834] (-1018.262) -- 0:00:57
Average standard deviation of split frequencies: 0.026189
65500 -- [-1016.963] (-1018.862) (-1021.240) (-1018.292) * (-1017.798) [-1017.813] (-1019.896) (-1017.005) -- 0:00:57
66000 -- [-1018.011] (-1019.543) (-1017.276) (-1019.316) * (-1019.022) [-1018.043] (-1020.617) (-1018.551) -- 0:01:10
66500 -- (-1017.899) (-1019.315) [-1019.936] (-1020.975) * (-1018.182) (-1017.223) [-1018.385] (-1017.575) -- 0:01:10
67000 -- [-1018.164] (-1021.397) (-1017.489) (-1018.919) * [-1018.266] (-1018.727) (-1019.722) (-1018.017) -- 0:01:09
67500 -- (-1017.641) [-1017.740] (-1016.578) (-1019.993) * (-1018.193) (-1018.414) [-1019.162] (-1018.008) -- 0:01:09
68000 -- (-1017.495) (-1018.185) (-1017.840) [-1019.980] * (-1017.882) (-1019.504) (-1017.084) [-1018.092] -- 0:01:08
68500 -- [-1017.185] (-1018.274) (-1023.227) (-1017.713) * (-1017.162) (-1026.063) (-1018.397) [-1019.745] -- 0:01:07
69000 -- (-1021.490) [-1018.772] (-1021.379) (-1019.037) * (-1016.883) (-1022.039) [-1018.003] (-1018.158) -- 0:01:07
69500 -- (-1019.103) [-1019.314] (-1021.364) (-1019.661) * (-1018.747) (-1021.970) (-1017.819) [-1018.000] -- 0:01:06
70000 -- (-1018.616) (-1020.452) [-1022.011] (-1024.997) * (-1018.099) (-1017.305) [-1017.360] (-1018.472) -- 0:01:06
Average standard deviation of split frequencies: 0.025413
70500 -- (-1018.133) (-1021.723) [-1022.902] (-1022.800) * (-1019.084) (-1017.107) [-1017.814] (-1017.484) -- 0:01:05
71000 -- (-1017.254) [-1018.097] (-1022.108) (-1019.106) * (-1018.830) [-1017.866] (-1021.363) (-1017.226) -- 0:01:05
71500 -- (-1017.652) (-1019.266) (-1019.536) [-1020.793] * [-1017.264] (-1020.434) (-1018.260) (-1017.107) -- 0:01:04
72000 -- (-1018.230) (-1020.968) [-1019.853] (-1018.250) * [-1018.233] (-1018.778) (-1017.389) (-1018.279) -- 0:01:04
72500 -- [-1019.234] (-1023.292) (-1020.939) (-1018.762) * (-1016.776) (-1017.451) [-1018.375] (-1018.531) -- 0:01:03
73000 -- [-1018.388] (-1019.663) (-1019.683) (-1018.926) * [-1018.972] (-1018.379) (-1017.278) (-1021.137) -- 0:01:03
73500 -- [-1017.189] (-1022.566) (-1017.776) (-1016.644) * (-1019.483) (-1017.497) [-1017.888] (-1018.307) -- 0:01:03
74000 -- (-1020.747) (-1018.347) (-1018.341) [-1017.898] * (-1021.079) (-1018.714) (-1021.842) [-1019.097] -- 0:01:02
74500 -- (-1018.603) [-1017.637] (-1019.447) (-1017.235) * (-1024.571) [-1017.958] (-1020.487) (-1017.561) -- 0:01:02
75000 -- (-1019.834) [-1018.303] (-1022.235) (-1017.611) * (-1026.010) [-1018.640] (-1021.470) (-1018.077) -- 0:01:01
Average standard deviation of split frequencies: 0.026583
75500 -- (-1020.027) (-1021.750) [-1019.400] (-1020.002) * (-1022.655) (-1021.853) [-1017.395] (-1016.727) -- 0:01:01
76000 -- (-1020.840) (-1023.488) [-1024.249] (-1018.280) * (-1020.670) (-1021.439) (-1016.992) [-1017.567] -- 0:01:00
76500 -- (-1020.096) (-1017.793) (-1022.040) [-1017.696] * [-1019.264] (-1020.412) (-1019.494) (-1016.884) -- 0:01:00
77000 -- (-1018.339) [-1020.450] (-1018.196) (-1019.212) * [-1021.871] (-1017.420) (-1018.956) (-1019.428) -- 0:00:59
77500 -- (-1019.936) (-1018.957) (-1019.027) [-1021.357] * (-1021.247) (-1019.178) [-1020.311] (-1019.301) -- 0:00:59
78000 -- [-1020.180] (-1018.764) (-1018.014) (-1018.983) * (-1021.443) [-1019.295] (-1018.130) (-1020.481) -- 0:00:59
78500 -- [-1018.962] (-1019.409) (-1017.294) (-1018.100) * (-1022.924) (-1017.392) (-1017.249) [-1020.735] -- 0:00:58
79000 -- (-1018.163) (-1017.772) [-1016.530] (-1018.969) * (-1021.662) (-1020.532) [-1019.606] (-1018.793) -- 0:00:58
79500 -- (-1018.275) (-1017.671) [-1016.963] (-1020.040) * [-1022.499] (-1022.876) (-1017.080) (-1018.185) -- 0:00:57
80000 -- [-1018.169] (-1017.539) (-1019.327) (-1018.637) * (-1018.875) (-1023.579) (-1017.943) [-1020.075] -- 0:00:57
Average standard deviation of split frequencies: 0.022499
80500 -- (-1017.308) (-1018.337) (-1020.989) [-1018.532] * [-1018.714] (-1020.276) (-1018.391) (-1021.715) -- 0:00:57
81000 -- (-1021.287) (-1019.178) (-1019.922) [-1018.215] * (-1017.793) [-1021.309] (-1018.380) (-1020.931) -- 0:00:56
81500 -- (-1021.561) [-1018.067] (-1021.842) (-1019.422) * (-1018.513) [-1018.808] (-1017.298) (-1017.099) -- 0:00:56
82000 -- (-1018.513) (-1017.589) (-1018.035) [-1017.154] * (-1021.814) (-1019.567) [-1018.804] (-1017.089) -- 0:00:55
82500 -- (-1018.587) [-1021.438] (-1020.491) (-1025.593) * [-1019.502] (-1018.421) (-1020.908) (-1017.392) -- 0:01:06
83000 -- [-1019.175] (-1017.275) (-1019.377) (-1018.565) * (-1017.814) [-1018.023] (-1022.703) (-1020.195) -- 0:01:06
83500 -- (-1017.724) (-1018.362) [-1021.007] (-1018.584) * (-1018.549) [-1021.372] (-1019.308) (-1020.538) -- 0:01:05
84000 -- (-1018.698) (-1020.809) [-1021.085] (-1019.144) * [-1019.376] (-1022.406) (-1018.701) (-1018.747) -- 0:01:05
84500 -- (-1018.923) [-1019.450] (-1020.514) (-1021.608) * [-1020.781] (-1020.601) (-1018.079) (-1018.893) -- 0:01:05
85000 -- (-1017.913) (-1018.299) (-1019.956) [-1019.487] * (-1023.509) [-1017.164] (-1017.030) (-1020.222) -- 0:01:04
Average standard deviation of split frequencies: 0.019838
85500 -- [-1019.664] (-1021.276) (-1019.583) (-1017.689) * [-1025.031] (-1018.211) (-1017.197) (-1018.169) -- 0:01:04
86000 -- (-1023.553) [-1017.650] (-1020.133) (-1020.272) * (-1020.444) (-1018.943) [-1017.892] (-1022.013) -- 0:01:03
86500 -- [-1019.013] (-1018.415) (-1017.825) (-1020.044) * (-1018.026) (-1016.917) [-1017.574] (-1018.175) -- 0:01:03
87000 -- (-1020.823) (-1017.854) (-1018.413) [-1018.946] * (-1019.874) [-1016.975] (-1017.629) (-1022.643) -- 0:01:02
87500 -- (-1018.762) [-1017.652] (-1021.174) (-1018.112) * [-1019.022] (-1023.420) (-1016.973) (-1020.004) -- 0:01:02
88000 -- (-1017.345) (-1017.048) (-1020.591) [-1018.995] * [-1018.485] (-1022.928) (-1018.435) (-1018.939) -- 0:01:02
88500 -- [-1017.740] (-1017.083) (-1018.352) (-1020.832) * [-1020.937] (-1019.657) (-1020.211) (-1018.204) -- 0:01:01
89000 -- [-1021.721] (-1018.409) (-1019.505) (-1018.630) * (-1019.096) [-1020.349] (-1019.319) (-1019.509) -- 0:01:01
89500 -- (-1022.698) (-1016.753) [-1017.453] (-1018.592) * (-1017.828) (-1020.350) (-1018.861) [-1017.993] -- 0:01:01
90000 -- (-1019.809) [-1017.385] (-1017.642) (-1018.065) * (-1018.133) [-1019.820] (-1021.884) (-1019.918) -- 0:01:00
Average standard deviation of split frequencies: 0.017787
90500 -- (-1017.699) (-1018.698) (-1026.379) [-1017.412] * [-1018.527] (-1020.551) (-1023.872) (-1019.379) -- 0:01:00
91000 -- (-1022.855) [-1018.993] (-1019.526) (-1018.839) * (-1017.880) (-1018.629) [-1016.891] (-1019.370) -- 0:00:59
91500 -- [-1020.890] (-1019.200) (-1018.649) (-1018.435) * (-1018.780) (-1020.557) [-1016.836] (-1019.982) -- 0:00:59
92000 -- (-1019.329) (-1017.503) (-1020.348) [-1019.796] * (-1017.995) [-1020.001] (-1017.311) (-1020.761) -- 0:00:59
92500 -- (-1022.257) [-1022.424] (-1020.177) (-1020.331) * [-1017.428] (-1020.755) (-1018.526) (-1022.740) -- 0:00:58
93000 -- (-1019.223) (-1020.238) [-1018.334] (-1018.226) * (-1020.209) (-1019.976) (-1020.263) [-1017.061] -- 0:00:58
93500 -- (-1019.326) (-1020.277) (-1020.609) [-1019.550] * (-1019.369) (-1018.613) (-1017.686) [-1017.060] -- 0:00:58
94000 -- (-1018.344) (-1021.283) (-1022.830) [-1016.979] * (-1022.089) (-1022.665) [-1018.693] (-1017.728) -- 0:00:57
94500 -- (-1019.127) (-1019.842) (-1018.187) [-1018.096] * (-1018.647) (-1018.679) (-1018.910) [-1017.480] -- 0:00:57
95000 -- (-1020.885) (-1017.725) [-1017.017] (-1017.837) * (-1019.656) [-1017.551] (-1018.471) (-1017.730) -- 0:00:57
Average standard deviation of split frequencies: 0.016641
95500 -- [-1019.334] (-1019.229) (-1019.062) (-1018.647) * [-1017.518] (-1018.512) (-1019.701) (-1016.678) -- 0:00:56
96000 -- [-1020.267] (-1017.315) (-1018.481) (-1020.131) * (-1018.758) (-1017.923) [-1020.056] (-1018.416) -- 0:00:56
96500 -- (-1018.748) (-1021.640) [-1018.896] (-1018.323) * [-1017.504] (-1018.086) (-1019.353) (-1017.477) -- 0:00:56
97000 -- (-1018.495) (-1020.123) [-1022.434] (-1017.763) * (-1018.568) [-1017.527] (-1024.275) (-1022.488) -- 0:00:55
97500 -- (-1019.706) [-1021.369] (-1022.170) (-1019.095) * (-1019.577) [-1020.619] (-1019.093) (-1020.743) -- 0:00:55
98000 -- (-1019.196) [-1017.832] (-1020.173) (-1019.255) * [-1016.746] (-1024.326) (-1020.049) (-1018.639) -- 0:00:55
98500 -- [-1018.139] (-1018.715) (-1024.046) (-1017.589) * (-1017.556) (-1023.877) [-1017.982] (-1018.072) -- 0:00:54
99000 -- (-1018.677) (-1018.620) (-1021.325) [-1020.214] * (-1017.557) (-1020.279) [-1021.399] (-1017.358) -- 0:00:54
99500 -- (-1018.507) (-1018.356) (-1019.223) [-1019.596] * [-1017.410] (-1024.604) (-1018.267) (-1020.426) -- 0:01:03
100000 -- (-1019.581) (-1017.270) [-1018.773] (-1020.670) * (-1017.504) (-1018.852) [-1019.808] (-1019.245) -- 0:01:02
Average standard deviation of split frequencies: 0.016910
100500 -- (-1019.096) (-1018.333) [-1020.019] (-1019.349) * [-1018.492] (-1018.427) (-1018.486) (-1018.514) -- 0:01:02
101000 -- [-1018.334] (-1017.623) (-1023.101) (-1023.383) * [-1018.469] (-1022.116) (-1023.125) (-1018.151) -- 0:01:02
101500 -- (-1018.708) (-1019.705) [-1023.896] (-1020.689) * [-1025.652] (-1020.495) (-1024.942) (-1019.256) -- 0:01:01
102000 -- (-1017.215) (-1019.476) (-1018.658) [-1020.540] * [-1019.039] (-1021.321) (-1020.207) (-1017.889) -- 0:01:01
102500 -- (-1021.535) (-1019.722) (-1018.645) [-1019.149] * (-1018.654) [-1019.182] (-1020.016) (-1019.044) -- 0:01:01
103000 -- (-1021.910) [-1018.548] (-1018.319) (-1019.141) * (-1019.397) [-1018.164] (-1018.927) (-1017.405) -- 0:01:00
103500 -- (-1019.529) (-1018.547) (-1019.583) [-1017.923] * (-1022.562) (-1019.774) (-1019.414) [-1021.449] -- 0:01:00
104000 -- (-1017.046) (-1019.878) [-1018.348] (-1019.377) * (-1021.705) [-1021.012] (-1018.031) (-1020.477) -- 0:01:00
104500 -- [-1017.889] (-1018.872) (-1017.706) (-1018.486) * (-1021.222) (-1018.963) [-1016.795] (-1020.854) -- 0:00:59
105000 -- [-1018.003] (-1018.604) (-1017.930) (-1018.454) * (-1020.519) (-1018.622) [-1017.400] (-1016.751) -- 0:00:59
Average standard deviation of split frequencies: 0.018234
105500 -- (-1018.701) (-1020.874) [-1020.478] (-1018.601) * [-1019.332] (-1018.774) (-1017.645) (-1018.265) -- 0:00:59
106000 -- (-1018.130) (-1019.309) [-1019.490] (-1017.897) * [-1020.816] (-1021.303) (-1024.825) (-1017.354) -- 0:00:59
106500 -- (-1016.759) (-1020.350) [-1018.942] (-1016.970) * (-1018.014) (-1019.857) (-1019.110) [-1016.883] -- 0:00:58
107000 -- [-1016.717] (-1018.826) (-1019.709) (-1020.192) * (-1017.783) (-1021.194) [-1018.281] (-1017.615) -- 0:00:58
107500 -- (-1016.717) [-1018.377] (-1020.330) (-1020.271) * (-1016.699) [-1020.108] (-1020.544) (-1017.832) -- 0:00:58
108000 -- (-1019.602) (-1019.890) (-1017.303) [-1018.738] * [-1018.048] (-1023.602) (-1020.575) (-1018.176) -- 0:00:57
108500 -- (-1020.992) (-1021.058) [-1017.325] (-1017.392) * (-1018.505) [-1016.913] (-1018.757) (-1018.880) -- 0:00:57
109000 -- (-1018.270) (-1019.752) (-1019.297) [-1017.463] * (-1022.623) (-1017.842) [-1018.397] (-1018.014) -- 0:00:57
109500 -- (-1017.474) (-1018.631) [-1019.674] (-1018.441) * (-1020.052) (-1017.580) [-1018.471] (-1017.815) -- 0:00:56
110000 -- (-1018.711) [-1018.098] (-1017.947) (-1020.829) * [-1019.246] (-1021.612) (-1018.254) (-1018.556) -- 0:00:56
Average standard deviation of split frequencies: 0.017465
110500 -- (-1018.001) [-1017.928] (-1018.924) (-1019.780) * (-1019.233) (-1020.762) [-1017.323] (-1019.210) -- 0:00:56
111000 -- [-1018.583] (-1020.240) (-1018.959) (-1020.197) * [-1018.998] (-1019.348) (-1016.785) (-1018.518) -- 0:00:56
111500 -- (-1017.840) (-1026.816) [-1017.591] (-1019.082) * (-1016.983) (-1018.651) [-1017.701] (-1021.356) -- 0:00:55
112000 -- (-1016.942) (-1021.006) (-1017.447) [-1021.420] * (-1017.832) (-1020.113) (-1017.145) [-1019.157] -- 0:00:55
112500 -- (-1017.649) (-1022.608) [-1017.470] (-1020.034) * (-1019.802) (-1025.000) [-1021.450] (-1017.602) -- 0:00:55
113000 -- (-1019.979) (-1020.505) [-1020.014] (-1025.653) * (-1020.864) [-1024.839] (-1020.385) (-1019.993) -- 0:00:54
113500 -- [-1017.931] (-1021.964) (-1019.312) (-1018.807) * [-1019.172] (-1018.831) (-1019.470) (-1018.378) -- 0:00:54
114000 -- [-1025.240] (-1020.576) (-1019.769) (-1017.499) * (-1020.141) (-1021.034) [-1019.266] (-1018.322) -- 0:00:54
114500 -- [-1019.888] (-1020.047) (-1021.431) (-1018.619) * (-1019.154) (-1020.334) (-1019.771) [-1017.435] -- 0:00:54
115000 -- (-1017.482) (-1018.784) (-1020.970) [-1017.677] * (-1024.489) [-1018.700] (-1018.100) (-1019.880) -- 0:00:53
Average standard deviation of split frequencies: 0.018180
115500 -- [-1019.733] (-1018.291) (-1020.560) (-1018.192) * (-1019.490) (-1018.394) [-1018.225] (-1017.123) -- 0:01:01
116000 -- (-1024.972) (-1018.654) (-1019.460) [-1020.647] * (-1020.834) (-1018.442) (-1017.263) [-1020.857] -- 0:01:00
116500 -- [-1021.251] (-1019.400) (-1016.676) (-1023.709) * (-1021.509) (-1018.306) [-1017.837] (-1019.172) -- 0:01:00
117000 -- [-1020.858] (-1023.494) (-1017.071) (-1020.858) * (-1019.894) (-1019.637) (-1016.947) [-1018.534] -- 0:01:00
117500 -- (-1020.818) (-1021.562) (-1017.748) [-1017.643] * [-1021.755] (-1018.943) (-1019.128) (-1020.284) -- 0:01:00
118000 -- (-1021.378) [-1019.834] (-1017.424) (-1020.635) * (-1022.702) (-1019.296) (-1018.823) [-1019.561] -- 0:00:59
118500 -- [-1018.982] (-1018.998) (-1018.060) (-1020.031) * (-1018.324) (-1020.862) [-1018.855] (-1020.659) -- 0:00:59
119000 -- (-1016.860) (-1021.763) (-1018.911) [-1019.236] * (-1019.073) (-1017.112) [-1018.028] (-1020.280) -- 0:00:59
119500 -- (-1023.118) (-1017.905) [-1017.596] (-1020.451) * (-1023.188) [-1018.898] (-1017.790) (-1018.006) -- 0:00:58
120000 -- [-1021.344] (-1018.436) (-1017.941) (-1020.266) * (-1018.834) (-1017.594) (-1020.560) [-1017.534] -- 0:00:58
Average standard deviation of split frequencies: 0.016712
120500 -- [-1019.427] (-1019.784) (-1020.847) (-1020.955) * (-1017.548) (-1018.114) (-1021.762) [-1019.968] -- 0:00:58
121000 -- (-1018.571) [-1017.643] (-1019.796) (-1020.240) * [-1017.617] (-1017.936) (-1021.013) (-1018.681) -- 0:00:58
121500 -- (-1016.946) [-1018.564] (-1019.731) (-1021.628) * [-1018.204] (-1018.327) (-1019.033) (-1018.294) -- 0:00:57
122000 -- [-1016.827] (-1018.564) (-1017.420) (-1022.875) * [-1018.847] (-1020.308) (-1020.051) (-1018.475) -- 0:00:57
122500 -- (-1021.380) (-1017.194) [-1017.193] (-1021.735) * (-1018.635) (-1019.945) [-1020.488] (-1019.011) -- 0:00:57
123000 -- (-1019.674) (-1016.892) [-1017.812] (-1020.320) * (-1019.544) (-1018.796) [-1022.400] (-1021.403) -- 0:00:57
123500 -- (-1020.281) [-1017.891] (-1019.084) (-1022.937) * (-1021.082) [-1016.943] (-1017.631) (-1019.319) -- 0:00:56
124000 -- (-1017.881) [-1017.436] (-1020.277) (-1019.205) * (-1019.095) (-1019.615) [-1018.298] (-1018.655) -- 0:00:56
124500 -- (-1017.529) [-1017.305] (-1019.953) (-1022.107) * (-1017.553) [-1018.368] (-1017.221) (-1024.915) -- 0:00:56
125000 -- (-1017.674) [-1017.046] (-1021.231) (-1020.845) * (-1019.891) [-1018.055] (-1018.589) (-1023.340) -- 0:00:56
Average standard deviation of split frequencies: 0.016934
125500 -- (-1017.869) (-1019.743) (-1018.067) [-1020.829] * [-1018.517] (-1018.897) (-1019.591) (-1021.319) -- 0:00:55
126000 -- (-1020.171) [-1019.980] (-1017.971) (-1021.962) * (-1017.776) [-1020.893] (-1020.950) (-1017.641) -- 0:00:55
126500 -- (-1021.178) (-1020.464) (-1018.936) [-1018.381] * (-1018.644) [-1018.694] (-1019.646) (-1017.522) -- 0:00:55
127000 -- [-1022.126] (-1019.194) (-1018.497) (-1019.290) * [-1018.482] (-1017.333) (-1017.674) (-1017.839) -- 0:00:54
127500 -- (-1023.042) (-1020.961) (-1022.288) [-1019.388] * (-1019.535) (-1019.183) [-1017.097] (-1017.341) -- 0:00:54
128000 -- (-1019.519) [-1019.925] (-1025.095) (-1017.761) * (-1020.230) [-1019.544] (-1020.196) (-1018.242) -- 0:00:54
128500 -- (-1018.504) (-1018.603) [-1017.748] (-1019.078) * (-1021.461) (-1023.872) [-1018.894] (-1017.983) -- 0:00:54
129000 -- (-1018.225) (-1019.121) (-1018.082) [-1021.645] * (-1018.457) [-1019.484] (-1023.006) (-1017.183) -- 0:00:54
129500 -- (-1017.336) [-1018.903] (-1020.429) (-1019.318) * (-1018.942) [-1017.059] (-1020.417) (-1016.959) -- 0:00:53
130000 -- (-1019.059) (-1017.279) [-1018.444] (-1020.527) * (-1019.854) (-1017.806) (-1025.366) [-1016.893] -- 0:00:53
Average standard deviation of split frequencies: 0.017849
130500 -- (-1019.886) (-1018.439) [-1018.302] (-1019.565) * (-1017.183) (-1016.653) [-1022.157] (-1016.894) -- 0:00:53
131000 -- (-1018.288) (-1022.528) [-1020.223] (-1018.683) * (-1017.436) (-1020.238) [-1017.429] (-1018.050) -- 0:00:53
131500 -- (-1017.950) [-1018.050] (-1019.065) (-1018.242) * (-1020.496) (-1020.517) (-1018.423) [-1016.892] -- 0:00:52
132000 -- (-1026.256) [-1020.722] (-1023.459) (-1021.193) * [-1021.081] (-1017.469) (-1020.163) (-1017.173) -- 0:00:59
132500 -- (-1017.718) [-1021.047] (-1020.629) (-1020.853) * (-1018.812) (-1018.596) [-1018.458] (-1018.201) -- 0:00:58
133000 -- (-1017.327) [-1022.318] (-1017.826) (-1022.885) * [-1020.904] (-1016.736) (-1017.372) (-1022.245) -- 0:00:58
133500 -- [-1017.742] (-1021.015) (-1017.983) (-1019.721) * (-1018.694) [-1017.013] (-1017.072) (-1018.600) -- 0:00:58
134000 -- (-1018.611) (-1021.431) [-1018.060] (-1018.895) * (-1018.987) (-1018.587) (-1017.711) [-1019.583] -- 0:00:58
134500 -- (-1018.091) (-1021.562) (-1017.848) [-1018.492] * (-1017.119) (-1017.993) [-1017.588] (-1018.685) -- 0:00:57
135000 -- (-1018.210) [-1017.613] (-1018.245) (-1019.438) * (-1017.094) [-1017.785] (-1020.370) (-1018.826) -- 0:00:57
Average standard deviation of split frequencies: 0.019064
135500 -- [-1017.776] (-1020.271) (-1018.416) (-1020.375) * [-1016.755] (-1020.112) (-1019.455) (-1019.247) -- 0:00:57
136000 -- (-1019.553) [-1017.438] (-1020.807) (-1022.068) * (-1017.482) (-1019.898) [-1018.754] (-1019.591) -- 0:00:57
136500 -- (-1021.477) [-1017.276] (-1018.785) (-1021.396) * (-1019.503) (-1017.630) [-1021.207] (-1022.852) -- 0:00:56
137000 -- (-1020.358) [-1017.372] (-1022.445) (-1020.199) * (-1018.900) (-1018.021) [-1021.023] (-1018.422) -- 0:00:56
137500 -- [-1018.053] (-1019.588) (-1018.102) (-1021.360) * (-1019.666) [-1020.879] (-1018.733) (-1018.397) -- 0:00:56
138000 -- [-1019.165] (-1020.269) (-1018.316) (-1017.537) * (-1019.303) (-1022.071) [-1021.611] (-1017.791) -- 0:00:56
138500 -- (-1019.747) (-1020.158) [-1018.372] (-1018.015) * [-1019.196] (-1022.599) (-1022.186) (-1017.147) -- 0:00:55
139000 -- (-1019.462) (-1019.432) (-1021.568) [-1017.556] * (-1017.815) [-1019.734] (-1018.051) (-1019.078) -- 0:00:55
139500 -- (-1022.906) [-1017.953] (-1019.807) (-1021.178) * [-1022.538] (-1025.785) (-1023.369) (-1018.871) -- 0:00:55
140000 -- (-1021.540) [-1017.837] (-1021.635) (-1020.727) * (-1019.145) (-1024.133) [-1020.240] (-1017.225) -- 0:00:55
Average standard deviation of split frequencies: 0.023459
140500 -- (-1019.282) (-1020.067) [-1017.217] (-1019.657) * (-1022.125) (-1019.398) [-1017.718] (-1017.168) -- 0:00:55
141000 -- (-1021.784) [-1019.524] (-1017.876) (-1018.918) * (-1020.120) (-1023.837) (-1022.260) [-1018.702] -- 0:00:54
141500 -- (-1020.842) (-1019.928) [-1021.155] (-1019.659) * (-1018.549) (-1022.180) (-1021.110) [-1018.057] -- 0:00:54
142000 -- (-1019.076) (-1021.064) (-1021.495) [-1018.438] * (-1019.260) [-1017.540] (-1019.807) (-1018.163) -- 0:00:54
142500 -- (-1022.475) [-1019.189] (-1020.257) (-1018.717) * (-1021.387) (-1019.405) [-1021.315] (-1020.381) -- 0:00:54
143000 -- (-1023.875) [-1019.385] (-1018.523) (-1017.466) * (-1020.497) (-1020.215) (-1018.785) [-1019.975] -- 0:00:53
143500 -- (-1020.593) (-1020.301) (-1019.836) [-1018.829] * (-1017.182) [-1020.249] (-1023.579) (-1019.125) -- 0:00:53
144000 -- (-1019.032) [-1018.984] (-1019.307) (-1018.089) * (-1016.990) [-1018.240] (-1021.033) (-1018.953) -- 0:00:53
144500 -- [-1017.845] (-1017.443) (-1019.127) (-1021.879) * (-1018.222) [-1018.214] (-1020.246) (-1017.618) -- 0:00:53
145000 -- [-1017.847] (-1017.195) (-1020.538) (-1018.862) * (-1019.581) (-1017.378) (-1021.387) [-1019.224] -- 0:00:53
Average standard deviation of split frequencies: 0.021149
145500 -- (-1019.505) (-1019.407) [-1020.569] (-1019.747) * (-1016.951) [-1017.702] (-1024.738) (-1018.743) -- 0:00:52
146000 -- [-1018.585] (-1017.421) (-1016.763) (-1019.668) * (-1017.527) (-1021.699) [-1017.085] (-1022.033) -- 0:00:52
146500 -- (-1016.769) [-1019.315] (-1016.867) (-1020.256) * (-1017.298) (-1020.632) (-1017.605) [-1019.773] -- 0:00:52
147000 -- (-1017.063) [-1018.552] (-1023.253) (-1018.421) * (-1017.512) (-1019.825) (-1018.496) [-1017.471] -- 0:00:52
147500 -- (-1017.136) [-1019.640] (-1020.979) (-1018.363) * (-1016.803) (-1019.826) (-1019.434) [-1016.852] -- 0:00:52
148000 -- (-1017.784) [-1017.599] (-1017.746) (-1020.089) * (-1017.139) [-1018.106] (-1017.749) (-1016.873) -- 0:00:51
148500 -- (-1019.052) (-1017.652) (-1018.855) [-1021.850] * (-1017.488) (-1018.283) [-1017.980] (-1018.499) -- 0:00:57
149000 -- (-1019.454) [-1017.104] (-1018.500) (-1019.209) * (-1017.458) (-1020.742) (-1020.718) [-1018.539] -- 0:00:57
149500 -- (-1018.653) [-1016.920] (-1019.783) (-1022.280) * (-1017.895) [-1017.479] (-1019.957) (-1018.849) -- 0:00:56
150000 -- [-1017.766] (-1019.005) (-1022.740) (-1017.540) * [-1018.192] (-1018.227) (-1017.799) (-1021.760) -- 0:00:56
Average standard deviation of split frequencies: 0.020963
150500 -- [-1017.775] (-1018.131) (-1017.254) (-1022.010) * (-1022.678) (-1020.005) (-1018.264) [-1019.107] -- 0:00:56
151000 -- (-1018.803) (-1018.091) [-1018.924] (-1018.340) * (-1019.449) [-1017.446] (-1017.028) (-1018.065) -- 0:00:56
151500 -- (-1018.237) (-1017.196) [-1020.374] (-1020.814) * [-1020.892] (-1017.286) (-1017.428) (-1017.848) -- 0:00:56
152000 -- (-1017.344) (-1018.006) [-1019.857] (-1018.484) * (-1019.107) (-1018.563) (-1017.718) [-1019.004] -- 0:00:55
152500 -- [-1017.838] (-1020.271) (-1017.792) (-1019.138) * [-1019.887] (-1017.629) (-1017.107) (-1020.071) -- 0:00:55
153000 -- [-1017.334] (-1019.411) (-1019.175) (-1019.049) * (-1019.163) [-1017.775] (-1023.483) (-1021.421) -- 0:00:55
153500 -- (-1021.284) [-1019.015] (-1022.721) (-1020.883) * (-1020.526) [-1018.028] (-1018.107) (-1022.605) -- 0:00:55
154000 -- (-1017.535) (-1023.217) (-1025.319) [-1017.479] * (-1018.251) (-1019.652) (-1017.022) [-1018.872] -- 0:00:54
154500 -- (-1019.113) (-1021.960) (-1027.660) [-1017.548] * (-1020.104) [-1018.592] (-1017.923) (-1018.636) -- 0:00:54
155000 -- (-1018.909) (-1020.044) [-1019.195] (-1018.433) * (-1020.511) [-1016.845] (-1018.466) (-1019.248) -- 0:00:54
Average standard deviation of split frequencies: 0.022266
155500 -- (-1022.801) (-1021.291) [-1020.712] (-1017.898) * [-1020.055] (-1017.433) (-1016.756) (-1019.580) -- 0:00:54
156000 -- [-1018.799] (-1021.289) (-1020.454) (-1019.876) * [-1019.546] (-1018.186) (-1018.316) (-1019.696) -- 0:00:54
156500 -- (-1019.008) [-1019.854] (-1018.124) (-1020.364) * (-1021.206) (-1018.858) [-1018.011] (-1017.836) -- 0:00:53
157000 -- [-1020.006] (-1017.239) (-1018.896) (-1018.393) * [-1019.695] (-1022.238) (-1018.245) (-1017.870) -- 0:00:53
157500 -- [-1018.882] (-1019.683) (-1021.813) (-1019.578) * [-1017.453] (-1021.867) (-1016.766) (-1017.580) -- 0:00:53
158000 -- (-1019.591) (-1019.648) (-1020.863) [-1017.898] * (-1019.526) (-1021.272) (-1020.355) [-1017.041] -- 0:00:53
158500 -- [-1019.123] (-1021.843) (-1021.222) (-1017.546) * (-1021.940) [-1017.117] (-1019.049) (-1017.005) -- 0:00:53
159000 -- (-1020.926) (-1020.554) [-1018.588] (-1018.317) * (-1021.694) (-1017.187) (-1017.532) [-1017.222] -- 0:00:52
159500 -- (-1017.410) (-1020.553) [-1018.078] (-1017.720) * (-1019.087) (-1018.577) (-1017.162) [-1017.464] -- 0:00:52
160000 -- (-1020.163) [-1020.989] (-1017.979) (-1019.039) * [-1020.650] (-1021.129) (-1017.478) (-1018.083) -- 0:00:52
Average standard deviation of split frequencies: 0.022657
160500 -- (-1017.849) [-1016.917] (-1020.168) (-1018.492) * [-1023.421] (-1017.623) (-1017.573) (-1018.300) -- 0:00:52
161000 -- (-1018.088) (-1018.777) (-1019.426) [-1017.865] * (-1020.557) [-1020.343] (-1019.500) (-1019.920) -- 0:00:52
161500 -- [-1017.864] (-1019.274) (-1019.764) (-1017.780) * (-1020.804) (-1021.184) [-1017.848] (-1018.063) -- 0:00:51
162000 -- (-1021.906) [-1021.173] (-1021.419) (-1017.100) * [-1017.310] (-1019.370) (-1018.725) (-1020.762) -- 0:00:51
162500 -- (-1020.800) (-1018.301) [-1023.199] (-1019.102) * (-1019.013) (-1019.215) (-1019.298) [-1017.031] -- 0:00:51
163000 -- (-1023.507) (-1018.967) (-1022.659) [-1021.456] * [-1018.808] (-1018.277) (-1018.795) (-1017.814) -- 0:00:51
163500 -- (-1019.759) (-1019.441) (-1018.661) [-1019.410] * (-1020.199) (-1018.147) [-1023.587] (-1019.079) -- 0:00:51
164000 -- (-1019.473) [-1019.195] (-1022.946) (-1018.566) * (-1020.057) (-1018.119) (-1022.554) [-1019.044] -- 0:00:50
164500 -- [-1021.452] (-1017.491) (-1019.140) (-1019.253) * [-1020.125] (-1020.543) (-1019.585) (-1018.062) -- 0:00:50
165000 -- [-1020.398] (-1018.517) (-1017.699) (-1022.731) * (-1017.554) [-1020.389] (-1018.932) (-1018.058) -- 0:00:55
Average standard deviation of split frequencies: 0.021224
165500 -- [-1018.862] (-1020.155) (-1017.511) (-1018.728) * (-1017.489) (-1017.536) (-1018.585) [-1021.841] -- 0:00:55
166000 -- (-1017.316) [-1018.946] (-1017.640) (-1022.973) * [-1017.969] (-1021.054) (-1017.592) (-1020.983) -- 0:00:55
166500 -- (-1016.879) (-1018.245) [-1018.104] (-1021.772) * (-1018.047) (-1022.943) [-1017.537] (-1019.782) -- 0:00:55
167000 -- [-1017.421] (-1017.554) (-1018.341) (-1017.758) * (-1017.500) (-1026.082) (-1019.774) [-1017.463] -- 0:00:54
167500 -- (-1019.636) (-1018.384) (-1018.943) [-1017.353] * [-1017.476] (-1017.068) (-1019.007) (-1019.338) -- 0:00:54
168000 -- (-1021.254) (-1020.489) (-1021.934) [-1018.612] * (-1017.725) [-1017.801] (-1021.091) (-1020.108) -- 0:00:54
168500 -- (-1019.484) (-1022.176) (-1020.233) [-1018.061] * [-1020.543] (-1018.539) (-1020.496) (-1026.737) -- 0:00:54
169000 -- [-1018.209] (-1020.257) (-1017.682) (-1024.060) * (-1018.740) [-1017.594] (-1024.433) (-1019.889) -- 0:00:54
169500 -- (-1021.088) (-1018.982) [-1018.267] (-1019.137) * (-1018.057) (-1017.917) (-1019.632) [-1019.133] -- 0:00:53
170000 -- (-1022.167) (-1018.513) (-1019.090) [-1017.359] * (-1020.523) (-1017.427) (-1018.182) [-1018.887] -- 0:00:53
Average standard deviation of split frequencies: 0.020256
170500 -- (-1020.523) [-1017.791] (-1018.584) (-1018.068) * [-1022.378] (-1019.241) (-1017.588) (-1018.910) -- 0:00:53
171000 -- (-1019.237) (-1017.622) [-1018.929] (-1018.705) * (-1019.363) [-1018.843] (-1024.433) (-1019.953) -- 0:00:53
171500 -- (-1021.849) (-1021.486) (-1020.670) [-1018.405] * [-1018.082] (-1019.952) (-1017.492) (-1018.560) -- 0:00:53
172000 -- (-1019.856) [-1018.176] (-1020.094) (-1019.152) * [-1020.295] (-1021.227) (-1017.491) (-1019.290) -- 0:00:52
172500 -- (-1021.063) (-1018.380) [-1020.573] (-1021.382) * (-1019.031) (-1019.933) [-1016.967] (-1017.546) -- 0:00:52
173000 -- [-1016.527] (-1018.799) (-1019.531) (-1018.089) * (-1019.062) (-1018.696) [-1016.806] (-1020.241) -- 0:00:52
173500 -- (-1016.549) (-1022.430) (-1022.110) [-1018.723] * [-1017.561] (-1018.270) (-1018.852) (-1020.533) -- 0:00:52
174000 -- (-1019.902) (-1017.610) [-1018.429] (-1017.733) * (-1017.910) (-1019.182) (-1022.656) [-1019.365] -- 0:00:52
174500 -- (-1019.520) (-1018.787) [-1020.895] (-1017.928) * [-1017.601] (-1017.120) (-1022.594) (-1016.838) -- 0:00:52
175000 -- (-1017.315) (-1020.877) [-1018.987] (-1017.874) * (-1018.542) (-1017.001) (-1021.181) [-1018.520] -- 0:00:51
Average standard deviation of split frequencies: 0.020981
175500 -- [-1017.879] (-1018.191) (-1018.411) (-1017.871) * (-1017.598) [-1016.823] (-1022.347) (-1020.841) -- 0:00:51
176000 -- (-1018.472) [-1018.220] (-1017.273) (-1019.455) * (-1017.519) (-1017.958) (-1018.424) [-1017.738] -- 0:00:51
176500 -- (-1017.782) [-1017.959] (-1017.193) (-1021.974) * (-1017.259) [-1019.494] (-1018.245) (-1019.087) -- 0:00:51
177000 -- (-1019.077) (-1019.433) [-1017.784] (-1021.742) * (-1017.259) (-1020.500) [-1023.626] (-1022.358) -- 0:00:51
177500 -- (-1019.423) (-1019.119) (-1017.494) [-1017.547] * (-1018.659) (-1017.533) (-1023.593) [-1019.925] -- 0:00:50
178000 -- (-1019.992) (-1017.555) [-1018.340] (-1017.937) * [-1016.548] (-1017.365) (-1018.100) (-1020.503) -- 0:00:50
178500 -- (-1019.728) (-1018.337) [-1019.190] (-1020.453) * [-1016.867] (-1016.991) (-1019.631) (-1019.190) -- 0:00:50
179000 -- [-1018.342] (-1018.784) (-1018.374) (-1022.526) * (-1020.824) (-1017.002) (-1020.661) [-1016.843] -- 0:00:50
179500 -- (-1018.299) (-1020.024) (-1018.962) [-1017.498] * (-1020.824) [-1017.747] (-1020.560) (-1018.880) -- 0:00:50
180000 -- (-1018.606) [-1019.581] (-1019.392) (-1016.921) * [-1018.940] (-1018.210) (-1017.185) (-1018.761) -- 0:00:50
Average standard deviation of split frequencies: 0.021698
180500 -- (-1018.203) (-1018.579) (-1020.992) [-1017.504] * (-1021.349) [-1018.399] (-1018.560) (-1018.574) -- 0:00:49
181000 -- (-1016.956) (-1017.445) (-1018.724) [-1017.702] * (-1021.232) (-1018.807) [-1017.722] (-1019.308) -- 0:00:49
181500 -- (-1017.303) [-1017.385] (-1022.911) (-1017.203) * [-1023.012] (-1018.238) (-1017.515) (-1017.594) -- 0:00:54
182000 -- (-1017.647) [-1017.385] (-1018.865) (-1019.453) * (-1018.661) (-1018.411) (-1021.785) [-1017.606] -- 0:00:53
182500 -- (-1017.376) [-1020.673] (-1022.098) (-1018.088) * (-1020.726) (-1017.187) (-1018.216) [-1018.890] -- 0:00:53
183000 -- (-1018.180) (-1016.940) [-1019.997] (-1021.540) * (-1017.754) [-1019.394] (-1016.820) (-1019.018) -- 0:00:53
183500 -- [-1019.263] (-1018.239) (-1018.910) (-1018.001) * [-1017.655] (-1021.609) (-1016.732) (-1020.310) -- 0:00:53
184000 -- [-1019.905] (-1021.425) (-1020.101) (-1019.446) * [-1017.093] (-1020.846) (-1019.022) (-1018.921) -- 0:00:53
184500 -- (-1019.218) (-1019.300) [-1017.773] (-1017.872) * (-1018.178) (-1019.833) (-1019.625) [-1018.080] -- 0:00:53
185000 -- (-1021.715) (-1019.741) [-1017.432] (-1021.129) * (-1019.401) [-1022.305] (-1018.753) (-1020.498) -- 0:00:52
Average standard deviation of split frequencies: 0.021076
185500 -- (-1018.354) [-1017.510] (-1017.451) (-1019.342) * (-1018.629) (-1017.752) (-1017.341) [-1016.887] -- 0:00:52
186000 -- [-1017.944] (-1023.068) (-1017.801) (-1016.887) * (-1018.389) (-1017.542) [-1017.643] (-1019.071) -- 0:00:52
186500 -- [-1017.943] (-1020.629) (-1017.502) (-1018.082) * (-1020.031) (-1018.459) (-1019.020) [-1018.839] -- 0:00:52
187000 -- (-1018.706) [-1020.346] (-1019.463) (-1017.135) * (-1017.726) [-1020.175] (-1019.675) (-1018.190) -- 0:00:52
187500 -- [-1019.945] (-1018.225) (-1017.602) (-1019.069) * [-1017.182] (-1020.437) (-1022.401) (-1023.615) -- 0:00:52
188000 -- (-1019.161) (-1019.469) [-1017.391] (-1019.544) * (-1018.315) (-1018.222) [-1021.407] (-1023.079) -- 0:00:51
188500 -- (-1017.797) (-1021.882) (-1018.331) [-1019.905] * [-1018.815] (-1018.196) (-1018.992) (-1021.496) -- 0:00:51
189000 -- [-1017.553] (-1021.176) (-1017.356) (-1019.695) * (-1019.312) (-1020.211) (-1020.128) [-1017.605] -- 0:00:51
189500 -- (-1017.824) (-1019.329) [-1019.408] (-1019.789) * (-1017.429) (-1020.038) [-1017.113] (-1019.978) -- 0:00:51
190000 -- (-1018.626) [-1018.539] (-1024.151) (-1018.446) * (-1017.578) [-1017.162] (-1017.159) (-1019.782) -- 0:00:51
Average standard deviation of split frequencies: 0.021601
190500 -- (-1017.701) (-1018.291) [-1021.375] (-1021.525) * [-1017.703] (-1017.211) (-1017.345) (-1019.526) -- 0:00:50
191000 -- (-1017.361) [-1017.870] (-1019.748) (-1021.514) * (-1020.036) (-1017.349) (-1020.119) [-1019.160] -- 0:00:50
191500 -- (-1018.848) (-1019.604) [-1019.751] (-1020.737) * (-1019.804) [-1019.409] (-1022.569) (-1018.439) -- 0:00:50
192000 -- (-1018.507) (-1016.733) [-1017.521] (-1020.525) * (-1018.869) (-1020.335) (-1021.630) [-1018.364] -- 0:00:50
192500 -- (-1017.858) (-1018.332) [-1017.707] (-1021.471) * (-1019.313) (-1018.028) (-1019.839) [-1018.598] -- 0:00:50
193000 -- (-1019.629) (-1017.900) [-1017.393] (-1020.756) * [-1022.352] (-1021.211) (-1018.194) (-1020.022) -- 0:00:50
193500 -- (-1017.385) (-1018.035) [-1018.993] (-1018.439) * (-1017.143) (-1018.279) [-1019.110] (-1017.543) -- 0:00:50
194000 -- [-1016.859] (-1017.261) (-1018.589) (-1020.011) * (-1020.324) [-1019.955] (-1020.206) (-1019.833) -- 0:00:49
194500 -- (-1016.859) (-1019.709) (-1019.269) [-1018.914] * (-1018.691) (-1017.615) [-1017.913] (-1025.223) -- 0:00:49
195000 -- (-1017.663) (-1018.426) (-1020.969) [-1017.722] * (-1017.899) [-1017.707] (-1019.144) (-1022.404) -- 0:00:49
Average standard deviation of split frequencies: 0.019508
195500 -- (-1021.001) (-1017.680) (-1020.429) [-1016.694] * (-1018.525) [-1020.089] (-1020.794) (-1018.056) -- 0:00:49
196000 -- (-1020.542) (-1019.763) (-1024.358) [-1017.605] * (-1018.856) (-1020.218) [-1017.426] (-1017.125) -- 0:00:49
196500 -- (-1020.354) (-1018.214) (-1019.838) [-1019.101] * (-1016.921) (-1020.177) (-1021.299) [-1017.337] -- 0:00:49
197000 -- (-1018.886) (-1018.577) [-1021.025] (-1017.959) * [-1018.167] (-1022.094) (-1019.315) (-1019.497) -- 0:00:48
197500 -- (-1018.819) (-1020.719) (-1020.614) [-1020.346] * [-1016.970] (-1017.743) (-1017.165) (-1020.082) -- 0:00:48
198000 -- (-1018.072) (-1021.024) [-1018.606] (-1020.346) * (-1016.761) (-1022.037) [-1021.719] (-1020.879) -- 0:00:52
198500 -- (-1021.079) [-1021.812] (-1020.307) (-1020.805) * (-1018.701) (-1019.152) (-1021.212) [-1018.606] -- 0:00:52
199000 -- (-1022.141) [-1018.678] (-1019.962) (-1019.262) * (-1017.724) [-1019.029] (-1020.895) (-1018.562) -- 0:00:52
199500 -- [-1017.807] (-1019.585) (-1019.203) (-1020.593) * (-1020.714) (-1021.001) (-1017.612) [-1017.032] -- 0:00:52
200000 -- (-1017.605) (-1018.140) (-1018.392) [-1019.282] * (-1019.184) [-1019.283] (-1019.102) (-1019.026) -- 0:00:51
Average standard deviation of split frequencies: 0.020882
200500 -- (-1022.318) (-1020.167) [-1018.547] (-1018.826) * (-1018.625) [-1019.312] (-1017.820) (-1018.639) -- 0:00:51
201000 -- (-1018.232) (-1017.115) [-1021.197] (-1021.958) * (-1018.218) (-1018.285) (-1017.402) [-1019.857] -- 0:00:51
201500 -- [-1018.589] (-1018.841) (-1022.553) (-1018.024) * (-1017.667) (-1021.074) (-1016.949) [-1017.839] -- 0:00:51
202000 -- [-1018.548] (-1018.860) (-1017.393) (-1018.664) * (-1020.481) (-1017.859) [-1019.832] (-1020.175) -- 0:00:51
202500 -- (-1019.044) [-1016.916] (-1019.478) (-1020.133) * (-1017.711) [-1021.677] (-1018.730) (-1019.097) -- 0:00:51
203000 -- [-1018.481] (-1017.578) (-1020.793) (-1025.027) * (-1016.974) (-1019.462) (-1020.956) [-1017.386] -- 0:00:51
203500 -- (-1018.917) (-1020.790) (-1024.809) [-1017.246] * (-1017.088) [-1018.439] (-1018.296) (-1018.913) -- 0:00:50
204000 -- [-1018.493] (-1024.706) (-1020.309) (-1018.790) * (-1019.236) (-1018.842) [-1018.231] (-1018.928) -- 0:00:50
204500 -- (-1017.507) (-1018.602) (-1021.179) [-1017.434] * (-1019.748) [-1017.171] (-1019.016) (-1019.082) -- 0:00:50
205000 -- [-1017.904] (-1017.697) (-1017.642) (-1017.805) * (-1019.961) [-1017.060] (-1020.898) (-1021.524) -- 0:00:50
Average standard deviation of split frequencies: 0.021994
205500 -- (-1020.692) [-1017.827] (-1019.528) (-1017.311) * (-1019.072) (-1017.160) [-1019.976] (-1017.390) -- 0:00:50
206000 -- (-1019.967) (-1018.720) [-1020.903] (-1016.669) * (-1017.550) (-1017.375) (-1021.727) [-1019.939] -- 0:00:50
206500 -- [-1019.383] (-1018.598) (-1021.430) (-1019.260) * (-1018.272) (-1021.022) (-1020.994) [-1018.858] -- 0:00:49
207000 -- (-1018.401) (-1019.280) (-1018.583) [-1018.624] * (-1017.693) [-1017.304] (-1020.108) (-1018.365) -- 0:00:49
207500 -- (-1021.496) (-1018.737) (-1018.785) [-1018.616] * (-1018.330) (-1018.770) [-1018.819] (-1019.816) -- 0:00:49
208000 -- (-1022.382) [-1018.408] (-1019.800) (-1017.931) * (-1019.245) [-1018.538] (-1020.632) (-1018.150) -- 0:00:49
208500 -- (-1021.252) [-1021.724] (-1018.380) (-1022.471) * (-1017.227) (-1018.758) (-1018.472) [-1018.093] -- 0:00:49
209000 -- (-1020.733) (-1020.987) [-1017.672] (-1016.825) * (-1018.921) [-1017.563] (-1019.942) (-1017.324) -- 0:00:49
209500 -- (-1024.981) (-1018.534) (-1016.659) [-1016.820] * (-1016.672) (-1017.907) [-1018.451] (-1017.324) -- 0:00:49
210000 -- (-1020.577) (-1018.902) [-1018.754] (-1017.766) * [-1018.545] (-1018.062) (-1022.805) (-1019.240) -- 0:00:48
Average standard deviation of split frequencies: 0.020636
210500 -- [-1020.959] (-1019.953) (-1019.125) (-1017.081) * [-1019.558] (-1018.838) (-1027.684) (-1024.241) -- 0:00:48
211000 -- [-1019.401] (-1018.343) (-1018.768) (-1018.875) * (-1021.477) [-1020.063] (-1021.696) (-1019.832) -- 0:00:48
211500 -- (-1020.062) [-1020.189] (-1019.215) (-1017.294) * [-1020.396] (-1021.179) (-1021.932) (-1018.549) -- 0:00:48
212000 -- [-1019.862] (-1019.995) (-1019.811) (-1019.429) * (-1023.640) (-1020.132) [-1017.034] (-1018.495) -- 0:00:48
212500 -- (-1018.818) (-1023.262) [-1020.840] (-1018.832) * (-1020.689) [-1019.515] (-1020.602) (-1019.283) -- 0:00:48
213000 -- [-1018.842] (-1023.772) (-1020.706) (-1018.941) * [-1020.290] (-1018.736) (-1016.764) (-1018.916) -- 0:00:48
213500 -- (-1020.037) (-1020.363) [-1023.863] (-1019.437) * (-1018.075) (-1018.903) [-1017.508] (-1018.159) -- 0:00:51
214000 -- (-1018.385) (-1022.312) [-1017.517] (-1022.993) * (-1022.087) [-1018.294] (-1017.572) (-1018.620) -- 0:00:51
214500 -- (-1017.237) (-1017.811) (-1017.748) [-1021.431] * [-1017.664] (-1017.843) (-1022.156) (-1018.337) -- 0:00:51
215000 -- [-1017.746] (-1017.658) (-1016.835) (-1021.632) * (-1020.091) (-1024.186) (-1018.049) [-1018.098] -- 0:00:51
Average standard deviation of split frequencies: 0.020127
215500 -- [-1018.349] (-1017.551) (-1016.859) (-1019.537) * (-1019.134) (-1017.347) (-1017.491) [-1017.234] -- 0:00:50
216000 -- (-1018.647) (-1017.484) [-1018.285] (-1018.717) * (-1019.592) [-1019.684] (-1019.965) (-1020.586) -- 0:00:50
216500 -- [-1021.811] (-1017.128) (-1018.812) (-1024.946) * [-1018.105] (-1024.129) (-1019.386) (-1016.957) -- 0:00:50
217000 -- (-1019.885) [-1020.218] (-1018.593) (-1022.575) * (-1018.812) (-1025.562) (-1017.871) [-1017.277] -- 0:00:50
217500 -- (-1022.599) [-1018.725] (-1020.454) (-1019.666) * [-1017.442] (-1022.160) (-1018.477) (-1019.539) -- 0:00:50
218000 -- (-1018.919) [-1017.913] (-1021.174) (-1020.818) * [-1020.384] (-1018.945) (-1016.676) (-1020.003) -- 0:00:50
218500 -- (-1021.530) [-1017.348] (-1019.582) (-1018.845) * [-1017.482] (-1017.688) (-1016.975) (-1021.031) -- 0:00:50
219000 -- (-1019.998) (-1018.400) (-1018.405) [-1018.569] * [-1020.016] (-1018.031) (-1021.278) (-1025.333) -- 0:00:49
219500 -- (-1020.135) (-1019.721) [-1019.030] (-1019.458) * (-1019.200) [-1018.057] (-1017.162) (-1024.719) -- 0:00:49
220000 -- (-1020.019) [-1021.040] (-1018.174) (-1018.008) * [-1019.089] (-1020.223) (-1018.202) (-1020.282) -- 0:00:49
Average standard deviation of split frequencies: 0.019701
220500 -- (-1021.338) (-1019.749) [-1018.868] (-1017.855) * (-1020.914) [-1018.556] (-1017.790) (-1018.922) -- 0:00:49
221000 -- (-1020.576) (-1017.580) (-1018.940) [-1022.307] * (-1023.273) (-1018.378) (-1018.081) [-1017.223] -- 0:00:49
221500 -- (-1018.155) [-1017.009] (-1017.713) (-1020.295) * (-1018.884) [-1019.450] (-1019.999) (-1020.448) -- 0:00:49
222000 -- [-1019.067] (-1018.128) (-1017.470) (-1020.640) * (-1020.649) [-1018.337] (-1020.046) (-1016.859) -- 0:00:49
222500 -- [-1017.608] (-1018.197) (-1017.283) (-1018.934) * (-1017.157) (-1019.451) (-1019.521) [-1017.915] -- 0:00:48
223000 -- (-1016.979) (-1017.268) (-1019.430) [-1018.877] * [-1017.786] (-1017.379) (-1019.238) (-1018.004) -- 0:00:48
223500 -- [-1017.908] (-1018.138) (-1017.452) (-1019.300) * (-1016.678) (-1017.812) (-1021.771) [-1017.470] -- 0:00:48
224000 -- [-1017.433] (-1021.313) (-1018.431) (-1020.538) * (-1017.932) [-1018.682] (-1019.136) (-1019.307) -- 0:00:48
224500 -- [-1018.238] (-1017.593) (-1017.698) (-1021.311) * [-1017.401] (-1017.040) (-1019.140) (-1019.421) -- 0:00:48
225000 -- (-1019.017) (-1017.482) [-1017.168] (-1018.753) * (-1018.252) (-1016.667) [-1017.323] (-1018.196) -- 0:00:48
Average standard deviation of split frequencies: 0.019005
225500 -- (-1017.994) [-1017.816] (-1017.788) (-1017.360) * [-1018.953] (-1016.877) (-1016.947) (-1020.011) -- 0:00:48
226000 -- (-1017.319) (-1018.662) (-1018.487) [-1018.408] * [-1023.675] (-1017.037) (-1017.198) (-1020.625) -- 0:00:47
226500 -- (-1018.861) (-1018.291) [-1017.653] (-1024.046) * (-1020.764) [-1017.086] (-1018.618) (-1021.594) -- 0:00:47
227000 -- (-1018.666) [-1018.121] (-1017.466) (-1023.316) * [-1019.956] (-1019.347) (-1019.585) (-1023.412) -- 0:00:47
227500 -- [-1018.666] (-1019.388) (-1020.765) (-1022.490) * [-1019.443] (-1018.083) (-1020.534) (-1020.891) -- 0:00:47
228000 -- (-1017.495) (-1019.994) (-1018.606) [-1020.307] * (-1018.800) (-1018.658) (-1020.606) [-1019.854] -- 0:00:47
228500 -- (-1019.234) (-1022.094) [-1018.327] (-1021.620) * [-1019.617] (-1018.151) (-1018.758) (-1018.357) -- 0:00:47
229000 -- [-1019.138] (-1021.078) (-1020.349) (-1020.008) * [-1018.207] (-1021.200) (-1020.801) (-1018.164) -- 0:00:47
229500 -- (-1020.081) (-1017.812) [-1018.896] (-1022.006) * (-1017.978) (-1018.395) [-1021.138] (-1017.723) -- 0:00:50
230000 -- (-1021.741) (-1016.716) (-1020.313) [-1021.420] * [-1021.561] (-1016.889) (-1018.180) (-1018.417) -- 0:00:50
Average standard deviation of split frequencies: 0.019982
230500 -- (-1018.435) (-1019.438) [-1019.255] (-1021.227) * (-1020.850) [-1017.183] (-1020.901) (-1018.718) -- 0:00:50
231000 -- (-1023.754) (-1016.703) [-1017.227] (-1021.569) * (-1019.367) [-1019.024] (-1018.176) (-1021.307) -- 0:00:49
231500 -- (-1019.898) (-1020.128) [-1017.430] (-1019.428) * [-1018.735] (-1022.657) (-1018.851) (-1017.897) -- 0:00:49
232000 -- (-1020.020) [-1019.884] (-1020.159) (-1017.958) * [-1017.071] (-1020.666) (-1016.904) (-1020.372) -- 0:00:49
232500 -- (-1019.497) (-1016.708) (-1017.134) [-1017.728] * (-1016.890) [-1019.480] (-1016.977) (-1020.339) -- 0:00:49
233000 -- [-1019.497] (-1019.127) (-1018.173) (-1017.057) * (-1017.713) (-1017.745) [-1018.331] (-1018.842) -- 0:00:49
233500 -- (-1018.463) [-1016.922] (-1017.665) (-1017.534) * [-1019.259] (-1019.258) (-1017.637) (-1018.058) -- 0:00:49
234000 -- (-1018.301) (-1016.667) [-1019.299] (-1019.888) * (-1018.638) (-1019.553) (-1017.318) [-1017.769] -- 0:00:49
234500 -- [-1018.232] (-1017.859) (-1017.817) (-1021.503) * (-1018.568) [-1017.450] (-1019.174) (-1017.877) -- 0:00:48
235000 -- [-1017.262] (-1019.218) (-1019.021) (-1018.254) * [-1020.120] (-1017.433) (-1017.538) (-1018.515) -- 0:00:48
Average standard deviation of split frequencies: 0.017755
235500 -- (-1017.292) [-1018.468] (-1019.727) (-1020.550) * (-1018.513) (-1017.082) (-1023.788) [-1017.343] -- 0:00:48
236000 -- (-1020.291) (-1019.829) [-1018.495] (-1021.906) * (-1019.169) [-1020.768] (-1021.089) (-1017.867) -- 0:00:48
236500 -- (-1017.758) (-1018.843) [-1019.658] (-1018.582) * (-1018.824) (-1020.014) [-1019.482] (-1018.076) -- 0:00:48
237000 -- (-1017.717) (-1018.767) (-1021.822) [-1019.219] * [-1016.870] (-1019.165) (-1025.440) (-1017.605) -- 0:00:48
237500 -- [-1020.871] (-1022.851) (-1018.281) (-1020.171) * (-1016.866) [-1019.817] (-1020.570) (-1020.643) -- 0:00:48
238000 -- (-1020.421) (-1018.869) [-1017.197] (-1024.776) * (-1017.229) (-1017.041) [-1019.053] (-1020.114) -- 0:00:48
238500 -- [-1018.387] (-1017.956) (-1023.213) (-1018.975) * (-1019.811) (-1016.980) [-1018.612] (-1017.936) -- 0:00:47
239000 -- [-1018.188] (-1019.903) (-1020.528) (-1017.978) * (-1017.100) (-1018.550) (-1017.959) [-1017.409] -- 0:00:47
239500 -- (-1018.874) (-1017.960) (-1019.164) [-1019.488] * (-1017.668) (-1018.621) [-1017.228] (-1017.363) -- 0:00:47
240000 -- (-1019.497) (-1017.777) (-1018.726) [-1017.332] * (-1017.726) (-1017.350) (-1018.548) [-1017.727] -- 0:00:47
Average standard deviation of split frequencies: 0.016976
240500 -- (-1018.290) (-1017.112) [-1017.880] (-1017.847) * [-1019.482] (-1021.607) (-1022.206) (-1018.405) -- 0:00:47
241000 -- (-1017.706) (-1017.239) [-1019.428] (-1022.006) * (-1018.444) (-1023.097) [-1021.736] (-1018.571) -- 0:00:47
241500 -- (-1017.144) [-1017.263] (-1018.806) (-1019.725) * (-1019.296) [-1020.649] (-1018.109) (-1023.469) -- 0:00:47
242000 -- (-1017.073) (-1017.686) [-1020.335] (-1020.787) * [-1020.167] (-1021.843) (-1020.104) (-1020.037) -- 0:00:46
242500 -- (-1019.347) (-1019.306) (-1019.424) [-1017.148] * (-1018.569) [-1018.701] (-1018.622) (-1021.415) -- 0:00:46
243000 -- (-1017.917) [-1019.210] (-1018.511) (-1018.019) * (-1018.900) (-1018.433) (-1020.957) [-1019.728] -- 0:00:46
243500 -- (-1017.907) (-1018.054) [-1017.915] (-1017.875) * [-1023.635] (-1020.043) (-1018.980) (-1021.029) -- 0:00:46
244000 -- (-1018.689) (-1018.187) (-1018.831) [-1017.838] * (-1017.953) (-1017.468) (-1020.265) [-1019.054] -- 0:00:46
244500 -- [-1017.055] (-1020.175) (-1017.830) (-1019.202) * (-1017.258) (-1017.206) [-1019.147] (-1018.957) -- 0:00:46
245000 -- [-1016.872] (-1019.097) (-1018.356) (-1018.936) * (-1017.614) [-1016.970] (-1018.239) (-1022.549) -- 0:00:46
Average standard deviation of split frequencies: 0.015756
245500 -- (-1017.944) (-1026.087) (-1017.750) [-1019.145] * (-1018.014) (-1017.168) [-1024.196] (-1027.795) -- 0:00:49
246000 -- (-1019.555) (-1021.906) [-1018.084] (-1021.149) * [-1017.763] (-1017.492) (-1020.019) (-1023.011) -- 0:00:49
246500 -- (-1018.130) [-1018.628] (-1017.458) (-1019.301) * [-1019.877] (-1017.486) (-1020.575) (-1022.996) -- 0:00:48
247000 -- (-1018.055) (-1020.353) (-1017.196) [-1017.937] * (-1030.529) (-1019.010) (-1020.462) [-1021.916] -- 0:00:48
247500 -- (-1018.608) (-1019.182) [-1019.838] (-1020.405) * [-1025.983] (-1020.244) (-1017.939) (-1021.913) -- 0:00:48
248000 -- [-1019.458] (-1017.173) (-1019.587) (-1022.184) * (-1026.080) [-1017.292] (-1019.431) (-1019.644) -- 0:00:48
248500 -- [-1018.713] (-1020.362) (-1020.756) (-1019.044) * (-1022.627) [-1018.132] (-1018.198) (-1020.447) -- 0:00:48
249000 -- (-1018.906) [-1017.579] (-1025.746) (-1017.275) * (-1022.817) [-1017.726] (-1020.647) (-1021.683) -- 0:00:48
249500 -- [-1021.813] (-1017.226) (-1024.957) (-1018.784) * (-1018.386) (-1016.949) (-1022.765) [-1023.994] -- 0:00:48
250000 -- [-1018.800] (-1017.340) (-1029.749) (-1019.535) * (-1018.927) (-1017.928) [-1021.471] (-1018.729) -- 0:00:48
Average standard deviation of split frequencies: 0.014160
250500 -- (-1018.429) [-1017.869] (-1021.645) (-1019.321) * [-1020.118] (-1017.557) (-1021.462) (-1018.127) -- 0:00:47
251000 -- [-1017.843] (-1018.026) (-1019.064) (-1019.595) * (-1019.408) [-1018.649] (-1021.087) (-1021.470) -- 0:00:47
251500 -- (-1017.518) (-1019.950) [-1017.881] (-1019.287) * (-1021.757) [-1020.715] (-1019.242) (-1022.655) -- 0:00:47
252000 -- [-1016.759] (-1018.965) (-1018.502) (-1022.459) * (-1021.332) (-1021.255) (-1019.073) [-1019.017] -- 0:00:47
252500 -- (-1018.145) [-1018.162] (-1018.146) (-1019.640) * [-1018.867] (-1020.740) (-1021.050) (-1018.755) -- 0:00:47
253000 -- (-1019.745) (-1018.765) [-1018.260] (-1019.440) * [-1018.178] (-1019.536) (-1018.686) (-1019.714) -- 0:00:47
253500 -- (-1018.488) (-1018.944) (-1021.161) [-1019.303] * [-1017.905] (-1018.326) (-1025.360) (-1020.688) -- 0:00:47
254000 -- [-1018.187] (-1019.583) (-1019.060) (-1019.459) * (-1019.156) (-1017.771) [-1019.248] (-1020.745) -- 0:00:46
254500 -- (-1018.271) [-1017.341] (-1019.871) (-1021.092) * (-1021.515) (-1020.611) (-1017.547) [-1019.201] -- 0:00:46
255000 -- (-1019.915) (-1017.409) [-1020.477] (-1018.727) * (-1018.744) [-1018.474] (-1017.560) (-1021.349) -- 0:00:46
Average standard deviation of split frequencies: 0.012782
255500 -- (-1025.916) (-1016.659) (-1020.385) [-1018.995] * (-1017.635) [-1025.573] (-1020.263) (-1017.807) -- 0:00:46
256000 -- (-1022.779) (-1018.170) [-1018.501] (-1016.956) * (-1017.047) [-1018.330] (-1021.533) (-1019.206) -- 0:00:46
256500 -- (-1018.611) [-1019.676] (-1018.030) (-1016.966) * (-1018.400) (-1019.700) [-1019.988] (-1018.967) -- 0:00:46
257000 -- (-1019.288) (-1021.061) (-1019.232) [-1018.361] * [-1018.662] (-1018.513) (-1022.311) (-1024.687) -- 0:00:46
257500 -- (-1016.979) (-1021.635) [-1019.198] (-1017.812) * [-1017.806] (-1017.716) (-1019.567) (-1022.103) -- 0:00:46
258000 -- [-1020.003] (-1017.573) (-1022.672) (-1018.844) * (-1018.611) (-1017.992) [-1018.655] (-1021.545) -- 0:00:46
258500 -- (-1017.641) [-1022.930] (-1018.844) (-1017.366) * (-1018.190) (-1016.583) [-1020.263] (-1017.471) -- 0:00:45
259000 -- (-1021.621) [-1018.296] (-1017.203) (-1017.856) * (-1018.716) [-1017.310] (-1020.710) (-1019.971) -- 0:00:45
259500 -- (-1021.910) (-1020.121) (-1020.112) [-1019.326] * [-1022.101] (-1017.150) (-1020.385) (-1021.501) -- 0:00:45
260000 -- (-1026.084) [-1018.998] (-1018.823) (-1017.862) * [-1019.253] (-1023.441) (-1018.842) (-1021.805) -- 0:00:45
Average standard deviation of split frequencies: 0.013404
260500 -- (-1021.434) [-1018.671] (-1018.276) (-1017.660) * (-1017.862) (-1021.651) [-1019.499] (-1021.884) -- 0:00:45
261000 -- (-1019.346) (-1018.736) [-1016.973] (-1017.748) * [-1018.627] (-1019.113) (-1019.490) (-1017.954) -- 0:00:45
261500 -- [-1019.699] (-1021.882) (-1019.179) (-1016.939) * (-1020.489) (-1018.728) (-1020.597) [-1018.001] -- 0:00:45
262000 -- (-1019.679) (-1022.657) [-1016.887] (-1017.854) * (-1017.839) (-1018.271) (-1019.317) [-1017.892] -- 0:00:47
262500 -- (-1020.831) (-1018.061) [-1019.763] (-1017.214) * (-1020.185) (-1017.521) [-1020.550] (-1017.815) -- 0:00:47
263000 -- (-1019.219) (-1018.343) (-1020.609) [-1016.887] * (-1020.839) [-1018.911] (-1021.947) (-1017.306) -- 0:00:47
263500 -- (-1019.121) (-1021.098) (-1022.968) [-1017.543] * (-1026.725) (-1018.422) (-1023.674) [-1017.403] -- 0:00:47
264000 -- (-1018.258) (-1018.304) (-1024.759) [-1017.759] * (-1024.556) [-1017.703] (-1020.372) (-1017.390) -- 0:00:47
264500 -- [-1021.329] (-1025.470) (-1017.007) (-1018.458) * (-1025.021) [-1017.154] (-1021.077) (-1019.520) -- 0:00:47
265000 -- (-1019.534) (-1022.401) [-1017.773] (-1026.193) * (-1017.389) (-1021.155) (-1018.195) [-1018.679] -- 0:00:47
Average standard deviation of split frequencies: 0.013865
265500 -- (-1018.969) (-1019.609) (-1020.709) [-1017.481] * (-1020.948) (-1017.989) [-1017.785] (-1023.966) -- 0:00:47
266000 -- [-1020.472] (-1024.006) (-1024.632) (-1017.421) * (-1021.873) (-1017.454) [-1017.693] (-1019.232) -- 0:00:46
266500 -- [-1022.656] (-1020.321) (-1018.536) (-1017.398) * (-1025.151) (-1017.307) (-1020.402) [-1017.410] -- 0:00:46
267000 -- (-1020.480) [-1018.570] (-1020.276) (-1018.345) * (-1020.634) (-1018.874) [-1023.528] (-1017.644) -- 0:00:46
267500 -- (-1019.671) (-1017.263) (-1024.395) [-1019.182] * [-1016.985] (-1017.886) (-1025.534) (-1021.575) -- 0:00:46
268000 -- (-1020.760) (-1019.355) (-1019.720) [-1017.494] * (-1019.629) (-1019.540) (-1019.381) [-1018.148] -- 0:00:46
268500 -- (-1021.035) (-1017.872) (-1020.731) [-1018.538] * (-1018.076) (-1017.188) [-1020.120] (-1017.521) -- 0:00:46
269000 -- (-1018.227) (-1018.621) (-1019.585) [-1020.068] * (-1018.759) [-1020.236] (-1018.870) (-1017.756) -- 0:00:46
269500 -- [-1018.743] (-1018.694) (-1017.591) (-1017.830) * [-1017.350] (-1020.165) (-1021.950) (-1018.197) -- 0:00:46
270000 -- (-1018.009) (-1021.688) (-1020.184) [-1019.471] * [-1019.648] (-1020.244) (-1018.680) (-1018.852) -- 0:00:45
Average standard deviation of split frequencies: 0.013318
270500 -- (-1020.632) (-1018.636) [-1024.793] (-1019.290) * (-1019.340) (-1020.222) (-1019.687) [-1017.109] -- 0:00:45
271000 -- [-1019.007] (-1021.090) (-1018.712) (-1019.501) * (-1017.878) (-1019.374) (-1017.974) [-1017.397] -- 0:00:45
271500 -- [-1019.978] (-1017.935) (-1018.571) (-1018.259) * (-1018.257) [-1019.505] (-1017.012) (-1018.699) -- 0:00:45
272000 -- (-1018.483) (-1017.256) [-1019.935] (-1020.122) * (-1019.785) [-1018.200] (-1020.258) (-1020.975) -- 0:00:45
272500 -- (-1018.682) (-1018.248) [-1018.464] (-1020.794) * (-1020.591) (-1019.093) (-1020.851) [-1016.919] -- 0:00:45
273000 -- [-1019.290] (-1020.167) (-1019.428) (-1019.116) * (-1019.287) (-1017.780) [-1017.186] (-1017.162) -- 0:00:45
273500 -- [-1020.793] (-1017.122) (-1018.251) (-1019.026) * (-1018.946) (-1017.470) (-1017.043) [-1019.706] -- 0:00:45
274000 -- (-1020.810) (-1017.794) (-1019.232) [-1017.815] * (-1017.662) (-1019.032) (-1017.786) [-1017.830] -- 0:00:45
274500 -- (-1017.414) (-1017.666) (-1018.265) [-1018.386] * (-1018.180) [-1020.075] (-1018.403) (-1017.412) -- 0:00:44
275000 -- (-1019.439) [-1018.006] (-1019.237) (-1017.535) * (-1019.392) (-1019.443) [-1018.436] (-1020.565) -- 0:00:44
Average standard deviation of split frequencies: 0.013262
275500 -- [-1017.539] (-1019.174) (-1019.408) (-1018.312) * (-1018.433) [-1019.216] (-1019.233) (-1023.676) -- 0:00:44
276000 -- [-1017.627] (-1019.043) (-1024.454) (-1016.663) * (-1019.643) (-1019.640) [-1023.144] (-1021.888) -- 0:00:44
276500 -- (-1018.634) [-1018.229] (-1023.072) (-1022.550) * [-1021.106] (-1020.006) (-1017.936) (-1019.705) -- 0:00:44
277000 -- [-1018.850] (-1018.843) (-1020.853) (-1018.203) * (-1018.955) (-1020.692) [-1018.719] (-1021.674) -- 0:00:44
277500 -- (-1021.632) [-1018.576] (-1019.489) (-1016.975) * (-1018.968) (-1019.722) (-1023.264) [-1019.540] -- 0:00:44
278000 -- [-1020.381] (-1017.741) (-1017.525) (-1019.701) * [-1019.333] (-1018.609) (-1019.254) (-1020.287) -- 0:00:44
278500 -- [-1021.282] (-1020.006) (-1017.833) (-1020.067) * (-1018.186) (-1019.777) [-1019.577] (-1017.684) -- 0:00:46
279000 -- (-1020.886) [-1019.642] (-1018.169) (-1017.518) * [-1017.465] (-1018.892) (-1020.067) (-1017.497) -- 0:00:46
279500 -- (-1019.006) (-1023.503) (-1017.128) [-1018.073] * (-1021.697) (-1019.305) [-1016.957] (-1016.991) -- 0:00:46
280000 -- (-1019.836) (-1020.556) [-1019.032] (-1019.705) * [-1018.008] (-1018.066) (-1020.034) (-1021.653) -- 0:00:46
Average standard deviation of split frequencies: 0.012745
280500 -- (-1019.081) [-1018.360] (-1019.564) (-1018.279) * (-1020.830) (-1021.576) (-1019.227) [-1022.493] -- 0:00:46
281000 -- (-1019.658) (-1019.271) (-1017.714) [-1020.458] * (-1019.931) [-1018.300] (-1017.800) (-1019.224) -- 0:00:46
281500 -- (-1018.542) (-1027.036) [-1017.453] (-1016.862) * [-1020.074] (-1018.363) (-1018.342) (-1018.630) -- 0:00:45
282000 -- [-1019.070] (-1026.263) (-1018.862) (-1021.726) * (-1026.656) [-1018.671] (-1019.315) (-1021.945) -- 0:00:45
282500 -- (-1018.313) (-1019.929) [-1019.031] (-1024.231) * (-1020.498) [-1022.525] (-1018.485) (-1019.832) -- 0:00:45
283000 -- (-1019.295) [-1018.658] (-1020.343) (-1022.468) * (-1020.444) [-1018.329] (-1018.703) (-1027.637) -- 0:00:45
283500 -- (-1019.757) [-1018.440] (-1017.054) (-1018.051) * (-1020.377) (-1018.887) (-1018.415) [-1019.601] -- 0:00:45
284000 -- (-1018.365) (-1017.173) (-1016.858) [-1018.113] * (-1019.582) (-1018.781) [-1019.376] (-1016.810) -- 0:00:45
284500 -- (-1017.070) (-1020.117) [-1018.131] (-1020.633) * (-1019.242) [-1020.954] (-1018.865) (-1019.145) -- 0:00:45
285000 -- (-1017.055) [-1018.122] (-1018.779) (-1022.728) * [-1017.512] (-1018.045) (-1019.087) (-1018.742) -- 0:00:45
Average standard deviation of split frequencies: 0.012604
285500 -- (-1018.559) (-1018.499) (-1017.876) [-1017.809] * (-1020.126) (-1021.916) (-1021.864) [-1018.546] -- 0:00:45
286000 -- [-1017.567] (-1018.483) (-1022.914) (-1018.236) * (-1021.406) (-1022.450) [-1019.037] (-1018.081) -- 0:00:44
286500 -- [-1019.494] (-1020.049) (-1017.012) (-1018.143) * (-1020.840) (-1026.454) [-1018.863] (-1023.032) -- 0:00:44
287000 -- [-1018.326] (-1017.120) (-1018.480) (-1017.691) * (-1022.001) [-1019.362] (-1017.097) (-1016.985) -- 0:00:44
287500 -- (-1020.728) (-1020.804) (-1018.979) [-1019.186] * (-1017.595) (-1018.485) [-1019.614] (-1019.189) -- 0:00:44
288000 -- [-1021.575] (-1025.627) (-1020.470) (-1018.896) * [-1018.537] (-1021.431) (-1018.923) (-1018.485) -- 0:00:44
288500 -- (-1023.312) (-1020.349) (-1017.980) [-1019.754] * (-1020.815) [-1017.903] (-1023.292) (-1017.997) -- 0:00:44
289000 -- (-1021.724) (-1017.314) (-1016.880) [-1018.298] * (-1018.530) (-1017.751) (-1023.412) [-1019.785] -- 0:00:44
289500 -- [-1019.666] (-1019.106) (-1021.006) (-1017.999) * (-1021.065) [-1017.783] (-1019.525) (-1018.016) -- 0:00:44
290000 -- (-1018.770) [-1020.639] (-1019.473) (-1018.088) * (-1017.799) (-1020.307) (-1023.613) [-1018.472] -- 0:00:44
Average standard deviation of split frequencies: 0.011639
290500 -- (-1017.760) (-1018.192) [-1017.620] (-1017.880) * [-1018.882] (-1018.340) (-1021.087) (-1016.905) -- 0:00:43
291000 -- [-1017.156] (-1017.563) (-1017.506) (-1018.992) * [-1018.904] (-1018.979) (-1020.455) (-1017.972) -- 0:00:43
291500 -- (-1018.816) (-1018.180) (-1020.300) [-1020.944] * [-1021.237] (-1017.271) (-1019.819) (-1019.980) -- 0:00:43
292000 -- (-1020.539) [-1020.625] (-1020.569) (-1021.895) * (-1022.331) (-1017.168) (-1021.860) [-1023.705] -- 0:00:43
292500 -- (-1017.604) (-1019.459) [-1017.682] (-1018.986) * [-1021.703] (-1016.843) (-1020.156) (-1019.006) -- 0:00:43
293000 -- (-1020.586) (-1018.950) (-1020.033) [-1018.777] * [-1019.631] (-1017.959) (-1028.787) (-1020.433) -- 0:00:43
293500 -- [-1022.347] (-1021.345) (-1019.424) (-1018.887) * (-1019.273) [-1018.851] (-1018.981) (-1021.504) -- 0:00:43
294000 -- (-1020.005) (-1020.055) [-1020.009] (-1018.771) * [-1019.038] (-1018.129) (-1019.029) (-1024.021) -- 0:00:43
294500 -- (-1021.239) (-1020.495) (-1020.799) [-1019.106] * (-1019.174) [-1017.823] (-1018.620) (-1017.612) -- 0:00:45
295000 -- (-1019.752) [-1018.630] (-1017.428) (-1018.142) * [-1020.921] (-1016.863) (-1019.522) (-1017.599) -- 0:00:45
Average standard deviation of split frequencies: 0.013022
295500 -- (-1017.989) (-1017.962) (-1019.191) [-1019.781] * [-1022.421] (-1017.947) (-1019.005) (-1021.314) -- 0:00:45
296000 -- (-1018.777) (-1019.995) (-1016.685) [-1016.772] * [-1017.966] (-1017.556) (-1020.597) (-1021.699) -- 0:00:45
296500 -- (-1023.529) (-1020.496) [-1018.714] (-1017.015) * (-1017.112) [-1022.355] (-1019.513) (-1023.449) -- 0:00:45
297000 -- (-1017.733) (-1019.420) (-1020.461) [-1017.000] * (-1017.033) (-1020.067) (-1019.154) [-1016.789] -- 0:00:44
297500 -- (-1019.201) (-1021.823) (-1017.735) [-1018.546] * [-1017.491] (-1017.755) (-1017.646) (-1019.938) -- 0:00:44
298000 -- (-1018.262) (-1021.375) [-1021.023] (-1018.373) * (-1018.524) (-1017.487) (-1019.348) [-1019.046] -- 0:00:44
298500 -- [-1021.400] (-1018.235) (-1019.908) (-1018.438) * (-1020.575) (-1017.252) [-1017.652] (-1017.768) -- 0:00:44
299000 -- (-1017.138) (-1018.438) [-1018.016] (-1021.685) * (-1018.350) (-1020.586) [-1017.145] (-1017.579) -- 0:00:44
299500 -- (-1018.880) (-1017.869) (-1017.843) [-1020.524] * (-1022.339) [-1019.882] (-1018.291) (-1016.708) -- 0:00:44
300000 -- (-1016.984) (-1019.295) (-1019.671) [-1017.382] * (-1021.324) (-1020.551) (-1018.268) [-1016.661] -- 0:00:44
Average standard deviation of split frequencies: 0.013004
300500 -- (-1017.170) [-1019.370] (-1017.111) (-1023.011) * (-1020.496) (-1018.582) (-1020.246) [-1018.404] -- 0:00:44
301000 -- [-1017.250] (-1020.551) (-1018.188) (-1019.818) * [-1017.848] (-1018.650) (-1018.211) (-1019.014) -- 0:00:44
301500 -- [-1017.675] (-1021.252) (-1018.589) (-1019.526) * [-1018.923] (-1018.590) (-1018.728) (-1018.473) -- 0:00:44
302000 -- (-1019.052) [-1020.785] (-1019.224) (-1019.843) * (-1020.301) (-1017.466) (-1019.711) [-1018.603] -- 0:00:43
302500 -- (-1017.442) [-1020.981] (-1019.652) (-1017.861) * (-1019.467) (-1017.153) (-1019.526) [-1017.162] -- 0:00:43
303000 -- (-1020.017) [-1018.857] (-1021.881) (-1020.116) * (-1019.052) (-1021.397) (-1018.513) [-1017.250] -- 0:00:43
303500 -- (-1019.021) (-1018.268) (-1022.083) [-1019.125] * [-1017.628] (-1019.419) (-1016.904) (-1018.882) -- 0:00:43
304000 -- (-1019.026) (-1018.831) [-1018.018] (-1018.075) * (-1017.522) (-1017.100) (-1018.022) [-1019.058] -- 0:00:43
304500 -- (-1017.835) [-1019.343] (-1019.194) (-1017.454) * [-1018.096] (-1019.112) (-1017.611) (-1018.488) -- 0:00:43
305000 -- (-1017.406) (-1019.393) (-1016.886) [-1021.193] * (-1019.964) (-1021.904) [-1017.773] (-1018.083) -- 0:00:43
Average standard deviation of split frequencies: 0.013140
305500 -- (-1018.178) (-1017.075) (-1016.960) [-1019.216] * [-1017.423] (-1019.115) (-1019.050) (-1017.679) -- 0:00:43
306000 -- (-1021.440) [-1016.897] (-1016.819) (-1019.059) * [-1022.493] (-1018.401) (-1018.045) (-1018.416) -- 0:00:43
306500 -- [-1019.006] (-1020.600) (-1017.446) (-1018.118) * (-1021.374) [-1022.620] (-1026.271) (-1020.704) -- 0:00:42
307000 -- (-1020.821) [-1019.322] (-1017.233) (-1018.086) * (-1018.927) (-1021.863) [-1017.725] (-1019.436) -- 0:00:42
307500 -- (-1017.782) [-1018.900] (-1017.282) (-1018.049) * [-1020.818] (-1020.070) (-1017.951) (-1019.164) -- 0:00:42
308000 -- (-1018.385) (-1021.774) [-1017.545] (-1021.333) * (-1018.707) [-1016.515] (-1020.876) (-1017.312) -- 0:00:42
308500 -- (-1018.475) (-1021.833) (-1017.758) [-1019.894] * (-1018.163) (-1024.784) [-1018.084] (-1017.113) -- 0:00:42
309000 -- (-1020.175) [-1021.516] (-1018.769) (-1018.863) * (-1018.263) [-1021.304] (-1018.186) (-1017.996) -- 0:00:42
309500 -- (-1018.521) (-1019.572) (-1021.441) [-1018.672] * [-1020.358] (-1018.823) (-1020.386) (-1020.189) -- 0:00:42
310000 -- (-1019.659) [-1017.416] (-1019.220) (-1017.416) * (-1018.504) [-1018.924] (-1018.924) (-1018.914) -- 0:00:42
Average standard deviation of split frequencies: 0.013032
310500 -- (-1019.269) (-1017.355) [-1019.003] (-1017.983) * (-1018.391) (-1021.175) (-1022.696) [-1020.229] -- 0:00:42
311000 -- (-1022.899) [-1018.383] (-1019.682) (-1019.550) * (-1018.944) (-1017.384) [-1019.888] (-1020.907) -- 0:00:44
311500 -- (-1017.275) [-1018.161] (-1017.674) (-1020.229) * (-1017.505) [-1017.782] (-1019.172) (-1019.508) -- 0:00:44
312000 -- [-1022.652] (-1019.468) (-1018.849) (-1019.026) * (-1020.927) (-1019.689) [-1017.772] (-1018.423) -- 0:00:44
312500 -- (-1023.355) (-1021.181) (-1019.367) [-1018.730] * (-1020.928) [-1020.539] (-1019.268) (-1017.333) -- 0:00:44
313000 -- (-1021.369) (-1020.324) (-1017.506) [-1017.305] * (-1020.122) (-1020.278) (-1018.736) [-1017.951] -- 0:00:43
313500 -- (-1017.054) (-1022.908) [-1017.950] (-1018.327) * (-1019.959) [-1019.398] (-1018.693) (-1017.654) -- 0:00:43
314000 -- [-1017.449] (-1018.970) (-1017.961) (-1018.332) * [-1017.145] (-1019.667) (-1017.414) (-1018.523) -- 0:00:43
314500 -- (-1018.587) [-1018.836] (-1018.313) (-1017.104) * (-1020.748) (-1026.148) (-1017.869) [-1020.380] -- 0:00:43
315000 -- (-1021.033) (-1021.284) (-1019.196) [-1017.180] * [-1017.057] (-1021.897) (-1019.234) (-1023.177) -- 0:00:43
Average standard deviation of split frequencies: 0.013075
315500 -- (-1018.671) [-1021.194] (-1019.094) (-1018.922) * (-1019.854) (-1024.395) [-1018.601] (-1023.614) -- 0:00:43
316000 -- [-1020.074] (-1022.199) (-1017.145) (-1019.430) * [-1017.622] (-1021.112) (-1018.701) (-1018.699) -- 0:00:43
316500 -- (-1021.054) [-1019.570] (-1017.083) (-1021.091) * (-1020.294) (-1019.850) [-1018.568] (-1019.222) -- 0:00:43
317000 -- [-1022.271] (-1024.924) (-1016.961) (-1021.980) * [-1019.166] (-1020.819) (-1020.202) (-1018.743) -- 0:00:43
317500 -- (-1021.867) (-1024.502) (-1017.355) [-1019.367] * [-1017.450] (-1020.295) (-1022.763) (-1021.022) -- 0:00:42
318000 -- [-1019.141] (-1018.702) (-1021.388) (-1018.402) * (-1018.383) [-1020.083] (-1024.104) (-1020.156) -- 0:00:42
318500 -- (-1019.199) (-1017.333) (-1019.906) [-1017.017] * (-1020.468) [-1018.004] (-1018.360) (-1020.292) -- 0:00:42
319000 -- (-1017.656) (-1019.163) [-1017.169] (-1017.022) * (-1020.215) [-1020.302] (-1018.302) (-1018.423) -- 0:00:42
319500 -- (-1017.960) (-1017.442) [-1016.848] (-1017.485) * (-1019.812) (-1020.497) [-1017.939] (-1020.715) -- 0:00:42
320000 -- (-1017.173) (-1017.123) [-1021.581] (-1018.487) * (-1018.482) [-1017.444] (-1018.843) (-1021.557) -- 0:00:42
Average standard deviation of split frequencies: 0.014009
320500 -- (-1018.294) (-1018.354) [-1022.044] (-1018.419) * [-1016.561] (-1019.389) (-1020.367) (-1021.372) -- 0:00:42
321000 -- (-1017.806) (-1017.676) (-1021.685) [-1016.563] * (-1016.782) (-1018.563) (-1016.711) [-1018.682] -- 0:00:42
321500 -- (-1019.946) [-1017.510] (-1019.965) (-1018.961) * (-1016.843) (-1019.649) (-1017.401) [-1020.453] -- 0:00:42
322000 -- (-1019.327) (-1017.178) [-1019.524] (-1020.399) * (-1018.139) [-1019.041] (-1016.931) (-1018.860) -- 0:00:42
322500 -- (-1019.887) [-1017.291] (-1022.031) (-1018.908) * (-1019.037) (-1016.906) [-1016.900] (-1017.374) -- 0:00:42
323000 -- (-1017.966) (-1020.659) (-1020.667) [-1018.409] * (-1019.440) [-1016.713] (-1019.253) (-1016.913) -- 0:00:41
323500 -- (-1019.175) (-1020.355) (-1019.523) [-1019.115] * (-1020.058) (-1017.414) (-1018.564) [-1020.749] -- 0:00:41
324000 -- [-1019.006] (-1021.246) (-1018.116) (-1022.576) * (-1019.597) (-1017.739) (-1018.424) [-1017.367] -- 0:00:41
324500 -- (-1017.167) (-1018.927) [-1019.203] (-1019.107) * (-1021.357) (-1016.936) [-1019.671] (-1017.500) -- 0:00:41
325000 -- (-1018.168) (-1021.941) [-1022.184] (-1018.372) * (-1019.673) (-1018.014) (-1020.762) [-1017.178] -- 0:00:41
Average standard deviation of split frequencies: 0.012844
325500 -- (-1018.157) (-1022.193) [-1021.600] (-1019.418) * [-1017.967] (-1018.904) (-1020.816) (-1017.775) -- 0:00:41
326000 -- (-1019.667) (-1019.948) [-1017.194] (-1019.122) * (-1018.063) (-1021.492) [-1017.632] (-1019.921) -- 0:00:41
326500 -- (-1018.185) [-1019.620] (-1022.754) (-1020.094) * (-1022.260) [-1018.567] (-1024.772) (-1019.678) -- 0:00:41
327000 -- (-1018.731) (-1022.042) (-1018.114) [-1018.561] * (-1020.690) (-1018.465) (-1020.664) [-1019.253] -- 0:00:41
327500 -- (-1017.347) (-1016.916) (-1022.988) [-1018.709] * (-1018.524) (-1018.880) [-1018.510] (-1022.095) -- 0:00:43
328000 -- [-1018.389] (-1018.962) (-1024.461) (-1017.938) * (-1018.421) [-1018.970] (-1021.490) (-1018.682) -- 0:00:43
328500 -- (-1018.699) (-1020.717) [-1017.755] (-1022.190) * (-1020.688) [-1020.418] (-1018.543) (-1018.297) -- 0:00:42
329000 -- (-1020.125) (-1018.425) [-1017.449] (-1018.225) * (-1021.008) (-1021.773) [-1018.587] (-1022.799) -- 0:00:42
329500 -- (-1017.631) (-1018.452) (-1017.472) [-1018.271] * (-1021.021) [-1020.781] (-1019.043) (-1018.967) -- 0:00:42
330000 -- (-1017.591) (-1017.225) [-1018.093] (-1018.908) * (-1019.671) (-1020.076) [-1018.152] (-1020.908) -- 0:00:42
Average standard deviation of split frequencies: 0.012663
330500 -- (-1018.527) (-1022.381) (-1023.490) [-1019.312] * [-1020.211] (-1020.114) (-1017.369) (-1021.491) -- 0:00:42
331000 -- [-1018.744] (-1019.468) (-1020.404) (-1019.554) * (-1020.031) (-1019.454) (-1017.146) [-1018.847] -- 0:00:42
331500 -- (-1018.366) (-1018.270) (-1017.211) [-1019.927] * (-1022.094) (-1019.955) [-1017.885] (-1019.006) -- 0:00:42
332000 -- (-1018.169) (-1022.208) (-1018.244) [-1018.652] * [-1020.375] (-1020.419) (-1019.362) (-1020.576) -- 0:00:42
332500 -- (-1023.114) (-1018.180) (-1017.913) [-1017.178] * (-1018.146) (-1018.209) (-1019.913) [-1019.339] -- 0:00:42
333000 -- (-1020.637) (-1018.015) [-1018.571] (-1019.143) * (-1018.328) (-1018.110) (-1019.804) [-1019.793] -- 0:00:42
333500 -- (-1019.007) [-1018.640] (-1018.480) (-1020.674) * (-1016.925) (-1017.237) (-1022.509) [-1017.908] -- 0:00:41
334000 -- (-1020.142) (-1023.976) (-1017.821) [-1021.991] * (-1017.636) (-1021.835) (-1020.897) [-1017.448] -- 0:00:41
334500 -- [-1018.341] (-1016.901) (-1021.541) (-1019.298) * (-1019.370) (-1020.010) [-1017.261] (-1017.138) -- 0:00:41
335000 -- (-1018.322) [-1017.703] (-1023.002) (-1017.701) * (-1016.805) (-1021.316) [-1018.841] (-1017.219) -- 0:00:41
Average standard deviation of split frequencies: 0.012379
335500 -- (-1021.639) [-1017.319] (-1022.114) (-1018.690) * (-1018.897) [-1018.737] (-1020.286) (-1017.193) -- 0:00:41
336000 -- (-1019.584) (-1019.604) (-1020.947) [-1020.739] * (-1020.744) [-1019.064] (-1021.513) (-1018.261) -- 0:00:41
336500 -- [-1018.269] (-1018.271) (-1018.838) (-1017.024) * (-1018.460) [-1019.175] (-1020.254) (-1017.793) -- 0:00:41
337000 -- (-1017.555) (-1018.102) [-1017.996] (-1019.470) * (-1018.083) (-1018.938) [-1018.549] (-1018.293) -- 0:00:41
337500 -- [-1019.850] (-1022.453) (-1016.948) (-1022.099) * (-1017.628) (-1018.312) [-1018.791] (-1018.174) -- 0:00:41
338000 -- (-1018.128) [-1016.872] (-1021.404) (-1019.684) * (-1021.115) [-1016.830] (-1020.631) (-1018.233) -- 0:00:41
338500 -- [-1023.766] (-1021.524) (-1019.656) (-1017.280) * (-1017.248) (-1021.742) (-1018.095) [-1019.471] -- 0:00:41
339000 -- (-1023.752) (-1019.618) (-1017.952) [-1017.531] * (-1018.406) (-1019.346) [-1017.106] (-1019.110) -- 0:00:40
339500 -- (-1025.160) [-1018.233] (-1020.070) (-1019.172) * (-1018.380) (-1024.568) [-1017.624] (-1018.875) -- 0:00:40
340000 -- (-1018.853) (-1022.110) [-1019.143] (-1019.701) * (-1017.588) [-1018.393] (-1018.493) (-1020.686) -- 0:00:40
Average standard deviation of split frequencies: 0.012454
340500 -- [-1017.883] (-1019.643) (-1020.078) (-1017.250) * [-1017.480] (-1020.539) (-1017.583) (-1021.580) -- 0:00:40
341000 -- (-1020.627) (-1019.228) [-1020.917] (-1017.205) * (-1018.016) (-1020.619) (-1017.402) [-1020.473] -- 0:00:40
341500 -- (-1021.908) [-1019.295] (-1022.509) (-1019.550) * [-1018.512] (-1020.824) (-1018.127) (-1018.886) -- 0:00:40
342000 -- [-1019.510] (-1017.283) (-1019.207) (-1018.483) * (-1018.524) (-1023.769) [-1017.092] (-1019.811) -- 0:00:40
342500 -- (-1018.396) (-1017.487) [-1019.846] (-1018.371) * (-1017.545) (-1019.010) (-1018.959) [-1017.869] -- 0:00:40
343000 -- (-1018.614) (-1017.102) (-1019.003) [-1017.434] * (-1019.636) (-1022.991) (-1018.946) [-1019.472] -- 0:00:40
343500 -- [-1018.890] (-1019.971) (-1017.753) (-1021.287) * (-1017.362) (-1019.641) [-1017.800] (-1016.748) -- 0:00:40
344000 -- (-1019.811) (-1019.169) [-1018.742] (-1017.104) * [-1017.444] (-1018.113) (-1022.863) (-1019.141) -- 0:00:41
344500 -- (-1019.227) (-1022.867) (-1017.766) [-1018.596] * (-1018.927) (-1017.386) (-1021.425) [-1018.151] -- 0:00:41
345000 -- (-1020.917) [-1017.923] (-1018.189) (-1018.480) * (-1018.358) (-1017.977) (-1020.218) [-1019.690] -- 0:00:41
Average standard deviation of split frequencies: 0.012422
345500 -- (-1019.446) (-1017.184) (-1019.616) [-1019.113] * (-1017.631) (-1017.998) [-1021.927] (-1019.299) -- 0:00:41
346000 -- (-1017.264) [-1017.146] (-1019.138) (-1023.864) * [-1018.723] (-1018.705) (-1018.476) (-1018.289) -- 0:00:41
346500 -- (-1017.500) (-1018.772) [-1017.657] (-1017.350) * [-1018.199] (-1019.192) (-1019.106) (-1020.228) -- 0:00:41
347000 -- (-1019.491) (-1017.951) (-1017.164) [-1018.154] * (-1020.060) (-1018.869) [-1019.785] (-1018.528) -- 0:00:41
347500 -- (-1023.165) (-1018.004) (-1019.625) [-1018.115] * (-1017.903) (-1019.495) (-1018.071) [-1017.375] -- 0:00:41
348000 -- (-1019.125) [-1018.315] (-1018.670) (-1018.187) * [-1018.076] (-1019.725) (-1018.064) (-1017.808) -- 0:00:41
348500 -- (-1020.717) (-1018.604) [-1020.029] (-1018.515) * (-1017.504) (-1019.871) [-1017.846] (-1018.984) -- 0:00:41
349000 -- (-1018.895) [-1017.609] (-1017.953) (-1017.298) * [-1017.389] (-1021.355) (-1019.743) (-1018.362) -- 0:00:41
349500 -- (-1018.969) (-1018.261) [-1017.944] (-1019.924) * (-1017.208) [-1020.086] (-1019.541) (-1019.243) -- 0:00:40
350000 -- [-1018.256] (-1019.156) (-1018.696) (-1020.028) * [-1020.731] (-1023.245) (-1018.671) (-1020.128) -- 0:00:40
Average standard deviation of split frequencies: 0.011931
350500 -- [-1018.501] (-1018.791) (-1018.267) (-1018.240) * [-1018.069] (-1017.553) (-1018.730) (-1020.025) -- 0:00:40
351000 -- (-1021.080) (-1019.656) (-1018.246) [-1017.467] * (-1018.984) (-1016.670) [-1017.611] (-1022.979) -- 0:00:40
351500 -- (-1018.117) [-1017.354] (-1019.044) (-1018.069) * [-1019.795] (-1017.685) (-1017.170) (-1022.682) -- 0:00:40
352000 -- [-1018.522] (-1018.793) (-1018.349) (-1021.601) * (-1021.341) [-1017.893] (-1016.812) (-1020.179) -- 0:00:40
352500 -- (-1019.484) [-1017.393] (-1018.274) (-1017.523) * [-1017.806] (-1017.625) (-1016.701) (-1018.007) -- 0:00:40
353000 -- (-1019.659) [-1018.051] (-1019.622) (-1017.363) * [-1017.991] (-1022.177) (-1018.605) (-1017.840) -- 0:00:40
353500 -- (-1023.977) (-1019.095) [-1019.521] (-1019.744) * (-1018.689) (-1022.692) [-1019.493] (-1016.774) -- 0:00:40
354000 -- (-1020.752) (-1019.486) (-1020.162) [-1019.381] * (-1021.040) (-1020.814) [-1016.580] (-1017.636) -- 0:00:40
354500 -- (-1020.044) (-1018.313) (-1021.011) [-1017.676] * (-1017.776) (-1020.082) (-1016.635) [-1017.634] -- 0:00:40
355000 -- [-1020.466] (-1019.831) (-1017.769) (-1018.339) * (-1017.752) (-1021.481) (-1020.076) [-1018.145] -- 0:00:39
Average standard deviation of split frequencies: 0.011090
355500 -- (-1018.238) (-1017.644) (-1017.759) [-1017.268] * (-1017.268) [-1021.565] (-1021.225) (-1018.438) -- 0:00:39
356000 -- (-1019.269) [-1019.929] (-1017.685) (-1017.296) * [-1019.022] (-1028.399) (-1019.168) (-1019.763) -- 0:00:39
356500 -- [-1020.663] (-1020.020) (-1018.174) (-1019.378) * [-1019.915] (-1018.567) (-1016.575) (-1019.232) -- 0:00:39
357000 -- (-1018.701) (-1017.579) [-1018.667] (-1020.375) * (-1022.432) (-1018.945) [-1016.735] (-1017.304) -- 0:00:39
357500 -- (-1018.931) (-1020.831) [-1018.790] (-1020.285) * (-1020.325) (-1018.199) (-1016.716) [-1019.014] -- 0:00:39
358000 -- [-1017.539] (-1019.257) (-1019.030) (-1021.375) * (-1021.250) [-1021.874] (-1017.261) (-1019.206) -- 0:00:39
358500 -- (-1020.127) [-1017.558] (-1025.352) (-1019.684) * (-1022.533) (-1018.576) (-1021.286) [-1017.409] -- 0:00:39
359000 -- (-1018.012) (-1018.154) (-1022.218) [-1018.716] * (-1021.829) [-1019.717] (-1018.043) (-1018.691) -- 0:00:39
359500 -- [-1018.576] (-1019.129) (-1020.106) (-1020.774) * (-1017.220) (-1021.789) (-1018.738) [-1021.081] -- 0:00:39
360000 -- (-1018.940) (-1018.788) (-1019.085) [-1017.433] * (-1019.073) [-1018.286] (-1018.232) (-1021.850) -- 0:00:40
Average standard deviation of split frequencies: 0.010456
360500 -- [-1018.277] (-1020.324) (-1019.979) (-1018.304) * (-1017.822) (-1018.332) [-1017.330] (-1017.602) -- 0:00:40
361000 -- [-1017.485] (-1018.013) (-1020.228) (-1017.702) * [-1016.819] (-1019.940) (-1018.011) (-1019.129) -- 0:00:40
361500 -- [-1017.903] (-1017.976) (-1018.363) (-1018.568) * [-1017.898] (-1018.349) (-1017.115) (-1021.735) -- 0:00:40
362000 -- (-1019.995) (-1017.817) (-1021.612) [-1021.812] * (-1019.687) [-1021.730] (-1017.013) (-1018.977) -- 0:00:40
362500 -- (-1018.457) (-1017.170) (-1019.294) [-1018.849] * (-1019.736) (-1019.955) [-1017.423] (-1019.988) -- 0:00:40
363000 -- [-1017.689] (-1017.815) (-1019.721) (-1017.293) * (-1018.658) (-1016.968) [-1017.587] (-1020.230) -- 0:00:40
363500 -- (-1018.917) (-1019.951) [-1020.670] (-1017.109) * (-1020.073) (-1016.898) [-1019.754] (-1018.983) -- 0:00:40
364000 -- [-1018.528] (-1016.951) (-1018.363) (-1021.325) * (-1017.384) (-1019.179) (-1021.811) [-1020.729] -- 0:00:40
364500 -- [-1017.562] (-1018.145) (-1016.853) (-1019.509) * (-1017.036) (-1019.754) [-1019.255] (-1017.496) -- 0:00:40
365000 -- [-1017.892] (-1017.757) (-1019.571) (-1017.790) * (-1016.922) [-1019.460] (-1024.199) (-1019.143) -- 0:00:40
Average standard deviation of split frequencies: 0.011213
365500 -- (-1017.942) [-1020.021] (-1019.734) (-1017.556) * (-1017.935) (-1017.541) [-1018.922] (-1019.754) -- 0:00:39
366000 -- (-1020.065) (-1020.199) [-1018.719] (-1020.873) * (-1017.430) (-1017.164) [-1018.397] (-1017.340) -- 0:00:39
366500 -- (-1018.905) [-1019.762] (-1025.556) (-1018.322) * (-1017.902) (-1018.461) (-1017.336) [-1017.109] -- 0:00:39
367000 -- (-1017.534) (-1019.078) [-1018.517] (-1017.276) * [-1018.496] (-1017.847) (-1018.415) (-1019.507) -- 0:00:39
367500 -- [-1017.475] (-1023.363) (-1020.725) (-1022.267) * (-1018.175) [-1018.137] (-1016.734) (-1018.644) -- 0:00:39
368000 -- (-1016.999) (-1021.313) [-1018.510] (-1019.008) * [-1020.321] (-1022.032) (-1018.131) (-1019.996) -- 0:00:39
368500 -- (-1016.817) (-1019.454) (-1017.980) [-1017.376] * (-1017.934) (-1017.258) (-1018.299) [-1017.596] -- 0:00:39
369000 -- (-1018.416) (-1017.042) [-1018.314] (-1017.699) * (-1019.307) [-1017.100] (-1017.945) (-1017.184) -- 0:00:39
369500 -- (-1017.585) (-1018.862) (-1017.803) [-1017.923] * (-1019.300) (-1018.311) [-1018.158] (-1019.344) -- 0:00:39
370000 -- (-1020.499) (-1019.033) (-1017.342) [-1018.407] * (-1022.212) (-1022.108) [-1024.358] (-1019.133) -- 0:00:39
Average standard deviation of split frequencies: 0.011596
370500 -- (-1018.850) (-1017.126) [-1017.817] (-1019.946) * (-1019.058) (-1025.200) (-1016.764) [-1019.359] -- 0:00:39
371000 -- (-1017.772) (-1020.569) [-1019.898] (-1017.499) * (-1021.497) (-1021.005) [-1016.707] (-1018.345) -- 0:00:38
371500 -- (-1018.004) (-1018.834) [-1019.389] (-1022.757) * (-1019.786) [-1019.335] (-1021.429) (-1018.368) -- 0:00:38
372000 -- (-1018.483) [-1018.256] (-1019.409) (-1017.434) * [-1017.924] (-1023.250) (-1021.254) (-1023.988) -- 0:00:38
372500 -- (-1020.105) (-1018.664) [-1017.997] (-1019.680) * (-1017.966) (-1020.759) [-1018.263] (-1019.803) -- 0:00:38
373000 -- (-1019.664) (-1018.786) [-1017.317] (-1019.780) * [-1019.674] (-1018.637) (-1017.919) (-1018.278) -- 0:00:38
373500 -- (-1022.932) (-1021.922) [-1019.943] (-1017.632) * (-1017.306) [-1020.262] (-1017.460) (-1018.379) -- 0:00:38
374000 -- (-1017.995) (-1019.110) (-1019.857) [-1017.840] * [-1019.789] (-1019.364) (-1017.560) (-1016.895) -- 0:00:38
374500 -- [-1020.128] (-1019.417) (-1021.134) (-1019.340) * (-1017.914) (-1018.976) [-1017.057] (-1018.016) -- 0:00:38
375000 -- [-1022.028] (-1019.577) (-1020.964) (-1019.494) * [-1020.311] (-1017.222) (-1020.139) (-1020.362) -- 0:00:40
Average standard deviation of split frequencies: 0.011652
375500 -- [-1019.017] (-1020.385) (-1021.535) (-1017.864) * [-1020.800] (-1017.231) (-1019.948) (-1017.954) -- 0:00:39
376000 -- (-1017.855) [-1023.613] (-1025.955) (-1018.269) * (-1017.638) (-1018.241) [-1019.717] (-1017.418) -- 0:00:39
376500 -- (-1019.534) [-1018.637] (-1017.844) (-1017.635) * (-1017.637) (-1022.393) (-1019.235) [-1019.744] -- 0:00:39
377000 -- [-1018.920] (-1018.320) (-1018.582) (-1019.340) * (-1019.291) [-1018.585] (-1016.969) (-1019.780) -- 0:00:39
377500 -- (-1017.740) (-1021.218) (-1021.395) [-1020.185] * (-1023.593) [-1017.449] (-1016.867) (-1021.846) -- 0:00:39
378000 -- [-1018.305] (-1019.828) (-1020.293) (-1018.044) * (-1020.653) (-1019.497) [-1018.780] (-1019.342) -- 0:00:39
378500 -- (-1019.694) (-1017.939) (-1017.622) [-1018.014] * (-1020.036) [-1021.410] (-1017.982) (-1017.292) -- 0:00:39
379000 -- (-1019.869) (-1016.770) [-1018.332] (-1017.648) * (-1018.458) (-1022.985) [-1017.040] (-1018.732) -- 0:00:39
379500 -- (-1016.922) (-1021.267) (-1019.787) [-1017.290] * [-1019.220] (-1018.555) (-1017.453) (-1018.158) -- 0:00:39
380000 -- (-1018.947) (-1020.443) [-1017.484] (-1016.758) * (-1018.752) (-1018.030) [-1017.382] (-1018.892) -- 0:00:39
Average standard deviation of split frequencies: 0.011582
380500 -- [-1018.453] (-1016.949) (-1017.505) (-1017.594) * (-1020.808) (-1018.363) (-1020.401) [-1018.965] -- 0:00:39
381000 -- (-1018.037) [-1017.708] (-1020.411) (-1020.252) * (-1018.083) (-1018.505) (-1020.046) [-1017.113] -- 0:00:38
381500 -- (-1020.122) (-1020.102) (-1021.347) [-1017.751] * (-1019.336) [-1017.938] (-1020.650) (-1016.976) -- 0:00:38
382000 -- (-1019.891) (-1021.752) (-1024.528) [-1020.581] * (-1019.094) (-1020.507) (-1018.434) [-1019.347] -- 0:00:38
382500 -- (-1020.073) (-1020.331) (-1019.437) [-1021.444] * [-1017.464] (-1018.052) (-1023.529) (-1019.707) -- 0:00:38
383000 -- (-1023.582) (-1023.829) [-1018.789] (-1020.423) * (-1017.689) [-1019.700] (-1019.003) (-1018.924) -- 0:00:38
383500 -- (-1021.007) [-1018.370] (-1020.052) (-1019.035) * (-1018.105) (-1020.190) (-1020.449) [-1016.985] -- 0:00:38
384000 -- (-1018.762) (-1017.527) (-1019.049) [-1018.859] * (-1020.928) [-1018.061] (-1020.432) (-1019.564) -- 0:00:38
384500 -- (-1016.882) (-1020.455) [-1017.466] (-1018.479) * (-1019.116) [-1022.411] (-1017.250) (-1022.633) -- 0:00:38
385000 -- (-1017.300) (-1019.148) (-1018.399) [-1020.018] * (-1020.597) [-1018.430] (-1019.026) (-1018.346) -- 0:00:38
Average standard deviation of split frequencies: 0.011279
385500 -- (-1019.223) [-1018.489] (-1024.388) (-1021.297) * [-1020.376] (-1019.827) (-1020.381) (-1019.846) -- 0:00:38
386000 -- [-1018.268] (-1019.795) (-1021.175) (-1018.098) * [-1017.291] (-1022.494) (-1018.210) (-1019.376) -- 0:00:38
386500 -- (-1018.480) [-1020.191] (-1027.088) (-1019.510) * (-1017.550) [-1020.098] (-1021.651) (-1018.631) -- 0:00:38
387000 -- (-1023.603) [-1018.414] (-1021.207) (-1019.674) * (-1020.866) [-1020.343] (-1018.092) (-1018.200) -- 0:00:38
387500 -- [-1019.980] (-1017.572) (-1019.761) (-1019.956) * [-1022.202] (-1019.691) (-1017.966) (-1022.576) -- 0:00:37
388000 -- [-1018.856] (-1021.288) (-1018.236) (-1018.428) * (-1028.979) (-1019.428) [-1018.730] (-1018.301) -- 0:00:37
388500 -- (-1017.373) (-1018.837) (-1020.370) [-1020.151] * (-1019.237) [-1018.547] (-1018.615) (-1017.641) -- 0:00:37
389000 -- (-1018.017) (-1017.606) (-1018.505) [-1017.862] * (-1020.539) (-1019.034) (-1019.936) [-1017.386] -- 0:00:37
389500 -- (-1016.759) [-1018.607] (-1021.274) (-1024.754) * (-1024.442) [-1019.713] (-1019.037) (-1018.532) -- 0:00:37
390000 -- (-1018.375) [-1021.496] (-1020.500) (-1019.889) * [-1023.191] (-1018.616) (-1016.757) (-1017.480) -- 0:00:37
Average standard deviation of split frequencies: 0.011073
390500 -- (-1017.822) [-1019.939] (-1019.718) (-1022.456) * [-1019.952] (-1019.900) (-1018.952) (-1022.425) -- 0:00:39
391000 -- [-1017.000] (-1018.356) (-1022.215) (-1020.435) * (-1017.134) [-1020.142] (-1018.234) (-1020.988) -- 0:00:38
391500 -- (-1017.638) (-1018.924) [-1020.155] (-1024.238) * [-1018.781] (-1017.072) (-1018.325) (-1017.105) -- 0:00:38
392000 -- (-1018.220) [-1019.065] (-1019.245) (-1021.221) * (-1020.214) [-1019.744] (-1018.290) (-1022.109) -- 0:00:38
392500 -- [-1017.423] (-1019.232) (-1019.648) (-1025.047) * (-1018.177) (-1021.002) (-1020.587) [-1018.014] -- 0:00:38
393000 -- (-1018.584) [-1017.418] (-1018.999) (-1019.195) * [-1017.195] (-1018.696) (-1018.650) (-1017.493) -- 0:00:38
393500 -- [-1018.138] (-1021.262) (-1020.272) (-1018.200) * (-1020.013) (-1017.045) (-1019.893) [-1019.360] -- 0:00:38
394000 -- (-1017.273) [-1022.873] (-1022.034) (-1021.439) * (-1017.610) (-1017.227) [-1021.138] (-1023.978) -- 0:00:38
394500 -- (-1018.358) (-1019.814) (-1018.639) [-1018.565] * [-1018.983] (-1017.366) (-1019.644) (-1017.837) -- 0:00:38
395000 -- (-1020.710) (-1018.021) [-1020.900] (-1018.839) * (-1020.291) (-1017.713) (-1019.897) [-1020.674] -- 0:00:38
Average standard deviation of split frequencies: 0.010434
395500 -- (-1022.733) (-1021.843) (-1017.751) [-1018.999] * (-1017.881) (-1017.839) (-1017.559) [-1017.628] -- 0:00:38
396000 -- (-1020.861) [-1018.122] (-1019.127) (-1018.860) * (-1019.211) [-1017.710] (-1022.420) (-1017.633) -- 0:00:38
396500 -- (-1019.468) (-1018.288) (-1019.839) [-1019.242] * (-1020.035) (-1017.710) (-1020.992) [-1017.687] -- 0:00:38
397000 -- [-1017.333] (-1022.768) (-1023.190) (-1017.613) * (-1019.564) (-1019.635) (-1018.827) [-1021.617] -- 0:00:37
397500 -- (-1019.826) (-1020.670) (-1021.330) [-1021.527] * (-1022.467) (-1019.160) [-1017.126] (-1022.311) -- 0:00:37
398000 -- (-1020.871) (-1026.180) [-1017.968] (-1018.279) * (-1017.482) [-1018.542] (-1017.538) (-1022.037) -- 0:00:37
398500 -- (-1016.941) (-1022.007) (-1019.360) [-1017.612] * (-1020.002) (-1017.300) [-1018.918] (-1020.575) -- 0:00:37
399000 -- (-1017.703) [-1018.877] (-1017.290) (-1020.206) * [-1017.447] (-1018.237) (-1018.163) (-1023.979) -- 0:00:37
399500 -- (-1021.224) [-1022.177] (-1020.651) (-1017.762) * [-1017.152] (-1019.067) (-1017.556) (-1017.375) -- 0:00:37
400000 -- (-1018.246) [-1017.682] (-1020.084) (-1018.580) * (-1020.335) (-1022.627) (-1017.429) [-1017.646] -- 0:00:37
Average standard deviation of split frequencies: 0.009689
400500 -- (-1019.129) (-1017.331) [-1016.859] (-1017.335) * (-1020.129) (-1019.158) (-1018.631) [-1016.509] -- 0:00:37
401000 -- (-1024.563) (-1022.008) [-1017.552] (-1017.302) * (-1018.855) [-1021.667] (-1019.584) (-1019.436) -- 0:00:37
401500 -- (-1025.614) [-1017.677] (-1019.399) (-1018.270) * (-1019.193) (-1017.569) (-1023.583) [-1018.823] -- 0:00:37
402000 -- (-1023.463) (-1023.601) [-1018.887] (-1018.325) * (-1019.386) (-1016.819) [-1019.813] (-1020.594) -- 0:00:37
402500 -- (-1018.315) (-1018.944) (-1018.943) [-1018.086] * [-1017.615] (-1019.537) (-1020.458) (-1017.275) -- 0:00:37
403000 -- (-1019.299) [-1016.756] (-1018.508) (-1018.703) * (-1018.840) (-1018.126) [-1017.479] (-1017.327) -- 0:00:37
403500 -- (-1019.054) (-1019.435) (-1018.914) [-1017.770] * (-1019.269) [-1020.390] (-1017.221) (-1020.021) -- 0:00:36
404000 -- (-1018.410) [-1019.042] (-1017.593) (-1018.031) * (-1018.994) [-1018.856] (-1017.866) (-1018.533) -- 0:00:36
404500 -- (-1017.541) (-1022.536) [-1018.569] (-1018.463) * (-1018.086) (-1023.328) [-1018.883] (-1023.321) -- 0:00:36
405000 -- (-1017.597) (-1021.144) (-1019.408) [-1019.864] * (-1018.298) (-1024.247) [-1017.459] (-1021.266) -- 0:00:36
Average standard deviation of split frequencies: 0.010723
405500 -- (-1017.125) (-1019.506) (-1021.179) [-1018.540] * (-1019.252) (-1019.207) (-1019.512) [-1021.331] -- 0:00:36
406000 -- (-1019.573) [-1019.234] (-1021.946) (-1019.717) * (-1018.045) [-1019.037] (-1019.731) (-1019.299) -- 0:00:36
406500 -- [-1018.042] (-1017.969) (-1018.409) (-1017.191) * (-1017.397) (-1018.811) (-1023.207) [-1018.972] -- 0:00:36
407000 -- (-1018.641) [-1017.358] (-1020.749) (-1021.301) * (-1017.382) (-1018.032) (-1022.256) [-1018.880] -- 0:00:37
407500 -- (-1018.292) [-1019.341] (-1023.028) (-1020.119) * (-1020.704) [-1019.016] (-1019.996) (-1017.844) -- 0:00:37
408000 -- (-1019.583) [-1019.155] (-1020.262) (-1020.724) * (-1019.492) [-1019.361] (-1020.300) (-1019.498) -- 0:00:37
408500 -- (-1019.767) (-1021.308) [-1020.769] (-1019.314) * (-1018.939) (-1019.948) (-1021.003) [-1018.840] -- 0:00:37
409000 -- (-1021.261) (-1020.159) [-1020.189] (-1018.310) * (-1018.170) [-1021.060] (-1021.069) (-1018.048) -- 0:00:37
409500 -- (-1021.364) (-1023.012) (-1019.232) [-1017.826] * (-1019.130) (-1020.013) (-1019.873) [-1019.446] -- 0:00:37
410000 -- [-1023.749] (-1024.142) (-1021.401) (-1020.332) * (-1018.948) (-1019.834) (-1021.038) [-1019.408] -- 0:00:37
Average standard deviation of split frequencies: 0.010331
410500 -- (-1017.964) (-1023.780) [-1017.991] (-1021.808) * (-1018.119) [-1020.398] (-1020.083) (-1020.379) -- 0:00:37
411000 -- (-1017.043) (-1021.961) (-1019.555) [-1018.973] * (-1016.617) [-1020.970] (-1020.763) (-1018.599) -- 0:00:37
411500 -- (-1020.293) (-1020.283) (-1017.199) [-1019.666] * (-1019.467) (-1019.084) (-1017.486) [-1017.548] -- 0:00:37
412000 -- (-1021.129) (-1019.652) [-1019.139] (-1017.643) * (-1019.972) [-1019.817] (-1017.442) (-1017.338) -- 0:00:37
412500 -- (-1019.955) [-1018.765] (-1018.407) (-1020.200) * (-1019.650) (-1018.347) (-1017.547) [-1017.681] -- 0:00:37
413000 -- (-1020.069) (-1019.123) (-1017.417) [-1019.526] * [-1018.670] (-1018.368) (-1017.925) (-1017.884) -- 0:00:36
413500 -- (-1023.269) (-1027.009) (-1020.752) [-1017.948] * (-1019.488) (-1021.631) [-1017.309] (-1017.545) -- 0:00:36
414000 -- (-1022.472) [-1017.597] (-1019.962) (-1019.185) * (-1021.862) (-1019.650) [-1017.272] (-1022.912) -- 0:00:36
414500 -- (-1018.584) (-1018.839) [-1019.026] (-1019.060) * (-1018.754) [-1019.320] (-1018.770) (-1017.387) -- 0:00:36
415000 -- (-1017.265) [-1021.268] (-1018.612) (-1017.643) * (-1018.541) (-1022.048) [-1017.593] (-1018.960) -- 0:00:36
Average standard deviation of split frequencies: 0.009999
415500 -- (-1017.700) (-1017.135) [-1018.651] (-1017.631) * [-1020.959] (-1019.298) (-1019.075) (-1017.940) -- 0:00:36
416000 -- [-1019.790] (-1017.625) (-1017.612) (-1016.953) * [-1019.928] (-1017.939) (-1017.502) (-1021.770) -- 0:00:36
416500 -- [-1019.428] (-1018.026) (-1020.244) (-1018.576) * (-1017.258) (-1017.976) [-1020.969] (-1021.140) -- 0:00:36
417000 -- [-1019.158] (-1017.548) (-1017.166) (-1017.877) * (-1019.766) [-1018.445] (-1018.253) (-1020.867) -- 0:00:36
417500 -- (-1017.039) (-1018.601) [-1019.855] (-1018.037) * (-1018.133) [-1017.577] (-1024.082) (-1019.926) -- 0:00:36
418000 -- (-1017.462) (-1018.610) (-1017.492) [-1018.648] * (-1018.765) [-1018.289] (-1018.779) (-1019.193) -- 0:00:36
418500 -- (-1016.999) [-1018.253] (-1019.756) (-1017.645) * (-1017.809) (-1017.981) (-1018.905) [-1016.727] -- 0:00:36
419000 -- [-1017.767] (-1018.280) (-1017.788) (-1017.429) * (-1017.582) (-1021.884) [-1020.561] (-1017.591) -- 0:00:36
419500 -- (-1018.900) (-1019.675) [-1019.491] (-1018.094) * (-1018.044) [-1021.489] (-1018.527) (-1017.651) -- 0:00:35
420000 -- (-1019.353) (-1022.866) [-1018.557] (-1019.035) * (-1019.155) (-1019.902) [-1018.664] (-1016.645) -- 0:00:35
Average standard deviation of split frequencies: 0.010151
420500 -- (-1018.132) (-1017.813) (-1020.703) [-1020.067] * [-1017.330] (-1021.089) (-1019.174) (-1017.535) -- 0:00:35
421000 -- [-1018.065] (-1022.686) (-1017.805) (-1017.080) * (-1019.090) (-1019.196) [-1018.575] (-1018.343) -- 0:00:35
421500 -- (-1018.612) [-1022.528] (-1019.121) (-1018.842) * (-1019.379) (-1017.315) (-1017.976) [-1020.712] -- 0:00:35
422000 -- (-1018.956) (-1020.816) (-1022.085) [-1017.665] * (-1019.012) [-1018.556] (-1018.587) (-1020.447) -- 0:00:35
422500 -- [-1018.985] (-1019.565) (-1019.698) (-1023.635) * (-1017.699) (-1019.226) (-1017.804) [-1018.436] -- 0:00:35
423000 -- (-1019.287) [-1022.946] (-1020.423) (-1017.375) * [-1017.923] (-1017.412) (-1017.172) (-1020.939) -- 0:00:35
423500 -- (-1020.730) (-1021.553) (-1018.009) [-1018.392] * (-1019.296) (-1018.377) [-1017.553] (-1019.195) -- 0:00:36
424000 -- (-1018.330) [-1021.730] (-1017.624) (-1017.799) * (-1017.249) [-1019.071] (-1019.816) (-1021.069) -- 0:00:36
424500 -- [-1017.629] (-1019.370) (-1018.281) (-1018.391) * [-1017.211] (-1019.762) (-1020.183) (-1022.046) -- 0:00:36
425000 -- (-1019.376) (-1019.278) [-1018.297] (-1016.756) * (-1019.003) (-1018.221) (-1022.294) [-1022.000] -- 0:00:36
Average standard deviation of split frequencies: 0.009439
425500 -- [-1019.064] (-1018.377) (-1019.159) (-1016.961) * (-1019.829) (-1019.701) [-1019.823] (-1019.744) -- 0:00:36
426000 -- (-1020.289) (-1018.312) [-1018.025] (-1020.503) * (-1025.754) (-1019.653) (-1022.939) [-1021.015] -- 0:00:36
426500 -- (-1017.830) (-1018.767) [-1022.210] (-1019.583) * (-1018.475) [-1018.874] (-1017.807) (-1018.997) -- 0:00:36
427000 -- [-1021.201] (-1023.308) (-1020.081) (-1017.950) * [-1019.311] (-1018.034) (-1019.547) (-1018.198) -- 0:00:36
427500 -- (-1025.494) [-1021.350] (-1020.130) (-1019.783) * (-1019.965) (-1017.508) [-1019.324] (-1018.219) -- 0:00:36
428000 -- (-1020.254) (-1017.131) [-1018.864] (-1020.420) * (-1018.633) (-1019.694) [-1022.571] (-1016.785) -- 0:00:36
428500 -- (-1021.926) [-1018.053] (-1018.111) (-1019.314) * (-1018.779) [-1019.864] (-1018.710) (-1017.141) -- 0:00:36
429000 -- (-1019.299) [-1019.310] (-1018.907) (-1018.399) * (-1018.284) (-1021.218) (-1019.395) [-1017.078] -- 0:00:35
429500 -- (-1018.774) (-1018.495) (-1019.593) [-1019.042] * (-1024.027) (-1020.522) [-1023.330] (-1019.177) -- 0:00:35
430000 -- [-1020.208] (-1017.033) (-1022.694) (-1019.105) * [-1021.638] (-1021.014) (-1021.281) (-1018.376) -- 0:00:35
Average standard deviation of split frequencies: 0.008757
430500 -- [-1019.925] (-1018.845) (-1022.030) (-1021.400) * [-1021.693] (-1020.943) (-1017.661) (-1021.602) -- 0:00:35
431000 -- (-1019.964) [-1019.413] (-1023.146) (-1018.206) * (-1018.674) (-1021.133) [-1017.818] (-1018.226) -- 0:00:35
431500 -- [-1018.341] (-1018.870) (-1021.225) (-1019.645) * [-1020.193] (-1019.146) (-1017.657) (-1017.678) -- 0:00:35
432000 -- [-1018.212] (-1018.402) (-1018.193) (-1017.671) * (-1017.281) (-1017.656) (-1018.508) [-1017.619] -- 0:00:35
432500 -- (-1021.912) (-1019.718) [-1021.699] (-1018.709) * [-1018.900] (-1020.978) (-1019.308) (-1018.329) -- 0:00:35
433000 -- [-1018.043] (-1019.091) (-1018.472) (-1016.750) * [-1017.010] (-1018.452) (-1020.271) (-1019.293) -- 0:00:35
433500 -- [-1019.866] (-1018.856) (-1017.315) (-1016.737) * [-1017.041] (-1019.216) (-1016.889) (-1020.423) -- 0:00:35
434000 -- [-1017.158] (-1018.999) (-1017.694) (-1017.999) * [-1017.221] (-1017.887) (-1017.518) (-1017.911) -- 0:00:35
434500 -- [-1017.158] (-1018.591) (-1019.619) (-1019.179) * (-1019.282) (-1017.752) [-1018.303] (-1018.856) -- 0:00:35
435000 -- (-1018.130) (-1018.477) [-1017.387] (-1019.049) * (-1018.554) (-1021.860) [-1018.020] (-1017.059) -- 0:00:35
Average standard deviation of split frequencies: 0.008920
435500 -- (-1021.847) (-1017.281) (-1018.908) [-1020.368] * (-1019.011) (-1017.906) [-1017.675] (-1018.236) -- 0:00:34
436000 -- (-1017.887) (-1018.583) [-1021.341] (-1019.201) * (-1017.178) (-1019.680) (-1022.665) [-1018.184] -- 0:00:34
436500 -- [-1022.381] (-1022.029) (-1019.660) (-1017.916) * (-1017.276) (-1018.162) (-1020.360) [-1019.369] -- 0:00:34
437000 -- (-1017.838) (-1023.240) [-1018.716] (-1020.127) * (-1018.043) (-1017.218) [-1017.879] (-1017.198) -- 0:00:34
437500 -- (-1017.586) (-1018.551) [-1018.500] (-1020.145) * [-1019.307] (-1017.454) (-1020.266) (-1018.006) -- 0:00:34
438000 -- [-1017.852] (-1017.419) (-1021.664) (-1018.486) * (-1017.760) [-1019.578] (-1019.599) (-1023.505) -- 0:00:34
438500 -- [-1018.123] (-1018.375) (-1021.064) (-1016.993) * [-1019.433] (-1017.831) (-1021.557) (-1021.034) -- 0:00:34
439000 -- (-1024.435) (-1017.689) (-1021.478) [-1016.915] * (-1018.593) (-1016.932) [-1018.748] (-1021.563) -- 0:00:34
439500 -- (-1025.446) [-1018.283] (-1018.394) (-1019.922) * (-1020.722) [-1017.511] (-1023.242) (-1018.092) -- 0:00:34
440000 -- (-1018.394) (-1017.442) (-1022.156) [-1018.273] * (-1020.620) (-1019.653) (-1018.737) [-1017.226] -- 0:00:34
Average standard deviation of split frequencies: 0.009293
440500 -- (-1020.104) [-1019.985] (-1018.937) (-1019.008) * (-1020.482) (-1016.845) (-1021.206) [-1019.150] -- 0:00:35
441000 -- (-1021.003) (-1024.141) [-1019.156] (-1020.960) * (-1018.688) [-1019.057] (-1022.480) (-1022.436) -- 0:00:35
441500 -- (-1019.651) (-1018.614) (-1019.203) [-1019.754] * (-1020.104) (-1019.169) [-1021.901] (-1019.744) -- 0:00:35
442000 -- (-1021.499) (-1019.507) (-1018.340) [-1017.777] * [-1019.968] (-1018.447) (-1018.342) (-1018.501) -- 0:00:35
442500 -- (-1021.067) (-1019.129) (-1019.162) [-1018.378] * (-1018.425) [-1018.497] (-1019.480) (-1017.628) -- 0:00:35
443000 -- (-1018.800) (-1023.536) (-1022.494) [-1017.797] * (-1018.447) (-1017.476) [-1020.285] (-1019.231) -- 0:00:35
443500 -- (-1018.119) [-1018.272] (-1021.500) (-1019.050) * [-1020.309] (-1018.574) (-1018.903) (-1020.984) -- 0:00:35
444000 -- (-1020.217) (-1019.607) (-1016.877) [-1017.555] * [-1019.472] (-1016.764) (-1019.099) (-1017.304) -- 0:00:35
444500 -- (-1019.923) [-1020.271] (-1018.555) (-1018.351) * (-1017.680) (-1016.658) (-1016.769) [-1017.617] -- 0:00:34
445000 -- (-1019.742) (-1018.085) [-1016.994] (-1018.124) * [-1017.699] (-1017.297) (-1018.469) (-1018.409) -- 0:00:34
Average standard deviation of split frequencies: 0.008984
445500 -- (-1021.071) (-1019.190) [-1019.440] (-1016.825) * (-1018.885) [-1018.864] (-1017.321) (-1018.358) -- 0:00:34
446000 -- (-1016.891) (-1018.551) [-1017.768] (-1018.516) * [-1019.860] (-1017.971) (-1018.234) (-1017.674) -- 0:00:34
446500 -- [-1018.912] (-1021.013) (-1017.450) (-1018.693) * (-1019.405) (-1020.292) (-1019.197) [-1020.575] -- 0:00:34
447000 -- (-1018.961) (-1018.015) (-1020.450) [-1018.533] * (-1021.541) (-1021.354) [-1017.792] (-1017.331) -- 0:00:34
447500 -- [-1018.431] (-1021.976) (-1019.365) (-1021.456) * (-1022.509) [-1020.460] (-1017.044) (-1017.054) -- 0:00:34
448000 -- (-1018.710) (-1022.260) (-1017.339) [-1022.591] * [-1020.488] (-1020.528) (-1021.892) (-1019.846) -- 0:00:34
448500 -- [-1019.166] (-1021.068) (-1020.224) (-1020.518) * [-1020.572] (-1025.786) (-1018.961) (-1021.826) -- 0:00:34
449000 -- (-1019.195) (-1019.772) (-1021.134) [-1021.092] * [-1018.544] (-1019.177) (-1017.043) (-1020.636) -- 0:00:34
449500 -- [-1018.584] (-1021.480) (-1019.029) (-1018.079) * (-1017.771) (-1021.501) [-1017.248] (-1017.879) -- 0:00:34
450000 -- (-1016.705) (-1023.498) (-1019.199) [-1017.338] * (-1018.980) (-1025.110) (-1017.606) [-1019.752] -- 0:00:34
Average standard deviation of split frequencies: 0.009106
450500 -- (-1020.806) (-1018.512) [-1021.171] (-1017.718) * (-1018.355) (-1023.823) [-1018.912] (-1017.229) -- 0:00:34
451000 -- [-1019.844] (-1018.778) (-1021.981) (-1017.871) * (-1018.265) (-1018.608) (-1018.828) [-1017.630] -- 0:00:34
451500 -- [-1017.581] (-1018.116) (-1019.492) (-1020.261) * (-1020.106) [-1017.074] (-1017.886) (-1018.122) -- 0:00:34
452000 -- (-1018.879) [-1017.899] (-1018.056) (-1020.051) * (-1020.216) (-1018.733) (-1017.945) [-1017.433] -- 0:00:33
452500 -- (-1017.047) (-1018.911) (-1018.534) [-1017.888] * [-1017.843] (-1018.590) (-1018.739) (-1017.345) -- 0:00:33
453000 -- (-1021.128) [-1024.937] (-1018.022) (-1021.788) * (-1021.277) [-1018.792] (-1018.854) (-1017.474) -- 0:00:33
453500 -- [-1020.509] (-1020.145) (-1020.506) (-1017.627) * [-1018.848] (-1019.255) (-1020.506) (-1021.993) -- 0:00:33
454000 -- [-1018.147] (-1020.765) (-1020.421) (-1018.310) * (-1018.457) (-1022.877) [-1018.647] (-1022.126) -- 0:00:33
454500 -- (-1023.814) (-1018.268) [-1020.449] (-1017.736) * (-1018.711) (-1019.914) (-1019.838) [-1023.928] -- 0:00:33
455000 -- (-1021.609) (-1018.074) (-1020.473) [-1017.693] * (-1019.297) (-1020.350) [-1016.671] (-1020.358) -- 0:00:33
Average standard deviation of split frequencies: 0.009365
455500 -- [-1019.329] (-1018.870) (-1020.184) (-1018.834) * (-1019.020) (-1018.632) [-1016.645] (-1020.555) -- 0:00:33
456000 -- (-1018.551) (-1018.543) (-1021.882) [-1021.954] * (-1017.623) (-1018.947) (-1023.296) [-1018.034] -- 0:00:33
456500 -- (-1018.765) [-1017.885] (-1024.050) (-1017.606) * (-1020.694) [-1019.159] (-1018.950) (-1018.400) -- 0:00:33
457000 -- (-1017.921) [-1017.830] (-1020.576) (-1019.096) * (-1017.554) [-1017.704] (-1019.903) (-1020.765) -- 0:00:34
457500 -- (-1017.524) (-1018.268) (-1017.025) [-1022.306] * (-1017.763) [-1018.819] (-1019.415) (-1017.948) -- 0:00:34
458000 -- (-1019.732) [-1017.397] (-1021.856) (-1018.408) * [-1017.776] (-1019.440) (-1017.445) (-1017.609) -- 0:00:34
458500 -- [-1017.782] (-1019.210) (-1022.921) (-1020.031) * (-1018.046) [-1017.780] (-1020.207) (-1018.332) -- 0:00:34
459000 -- (-1017.823) (-1020.103) [-1018.925] (-1018.074) * (-1017.971) (-1017.261) [-1016.937] (-1017.939) -- 0:00:34
459500 -- (-1018.363) [-1017.885] (-1019.870) (-1018.849) * [-1019.941] (-1019.799) (-1017.266) (-1019.427) -- 0:00:34
460000 -- (-1017.706) [-1022.938] (-1018.768) (-1017.128) * (-1017.771) (-1019.782) (-1018.204) [-1020.237] -- 0:00:34
Average standard deviation of split frequencies: 0.008969
460500 -- [-1018.337] (-1018.066) (-1018.430) (-1017.447) * [-1018.074] (-1018.355) (-1024.042) (-1019.162) -- 0:00:33
461000 -- (-1020.916) (-1017.968) [-1019.777] (-1019.044) * [-1020.009] (-1018.969) (-1020.570) (-1023.842) -- 0:00:33
461500 -- (-1018.373) [-1017.300] (-1019.981) (-1019.981) * (-1017.758) (-1021.372) [-1017.480] (-1021.135) -- 0:00:33
462000 -- (-1022.446) (-1017.137) [-1017.408] (-1018.677) * [-1018.522] (-1019.805) (-1017.823) (-1019.044) -- 0:00:33
462500 -- (-1023.143) (-1018.477) [-1017.497] (-1016.908) * (-1018.137) (-1020.261) [-1021.235] (-1019.439) -- 0:00:33
463000 -- (-1020.254) (-1018.301) (-1017.929) [-1017.860] * [-1019.264] (-1020.105) (-1021.505) (-1021.179) -- 0:00:33
463500 -- (-1020.246) [-1018.626] (-1018.923) (-1018.926) * (-1017.770) (-1024.875) [-1019.190] (-1020.205) -- 0:00:33
464000 -- (-1019.953) (-1017.799) [-1019.816] (-1018.277) * (-1020.222) [-1018.791] (-1022.596) (-1020.852) -- 0:00:33
464500 -- (-1022.401) (-1018.518) (-1018.995) [-1018.105] * (-1017.159) (-1018.852) [-1017.730] (-1018.868) -- 0:00:33
465000 -- (-1020.236) (-1019.638) [-1017.991] (-1018.142) * [-1019.069] (-1017.716) (-1017.266) (-1020.227) -- 0:00:33
Average standard deviation of split frequencies: 0.008628
465500 -- (-1019.586) [-1019.056] (-1023.337) (-1018.014) * (-1017.616) (-1018.017) [-1019.446] (-1019.037) -- 0:00:33
466000 -- (-1019.562) (-1028.114) (-1022.507) [-1019.213] * [-1017.664] (-1018.183) (-1018.853) (-1019.629) -- 0:00:33
466500 -- (-1018.802) (-1018.731) [-1017.821] (-1017.647) * (-1016.913) (-1019.322) [-1016.563] (-1017.751) -- 0:00:33
467000 -- [-1019.347] (-1019.634) (-1016.942) (-1023.601) * (-1016.826) (-1021.085) (-1017.323) [-1019.587] -- 0:00:33
467500 -- (-1017.868) (-1019.842) (-1017.312) [-1018.594] * (-1017.686) [-1018.731] (-1017.993) (-1016.842) -- 0:00:33
468000 -- (-1024.030) (-1016.941) [-1017.066] (-1019.466) * (-1021.388) (-1020.936) (-1018.373) [-1020.860] -- 0:00:32
468500 -- [-1024.007] (-1018.112) (-1018.479) (-1018.490) * (-1018.838) [-1018.926] (-1017.365) (-1020.306) -- 0:00:32
469000 -- (-1018.279) [-1023.283] (-1020.492) (-1021.554) * (-1025.451) (-1018.864) [-1020.280] (-1018.358) -- 0:00:32
469500 -- (-1021.365) (-1020.992) (-1021.308) [-1019.921] * (-1020.055) [-1019.710] (-1019.183) (-1018.977) -- 0:00:32
470000 -- (-1019.451) (-1019.959) (-1018.013) [-1019.419] * (-1020.000) [-1017.671] (-1019.122) (-1019.559) -- 0:00:32
Average standard deviation of split frequencies: 0.009368
470500 -- (-1020.839) (-1017.942) (-1018.909) [-1020.130] * (-1019.830) (-1018.275) [-1018.717] (-1021.664) -- 0:00:32
471000 -- (-1020.086) (-1016.891) [-1017.927] (-1019.563) * (-1019.757) (-1017.895) (-1018.947) [-1017.314] -- 0:00:32
471500 -- (-1019.396) (-1018.575) (-1017.990) [-1017.285] * (-1018.564) [-1018.172] (-1019.227) (-1017.315) -- 0:00:32
472000 -- (-1019.331) (-1016.838) (-1017.648) [-1018.220] * (-1018.810) (-1016.622) [-1023.306] (-1016.908) -- 0:00:32
472500 -- (-1019.039) [-1016.836] (-1018.712) (-1019.250) * (-1020.852) (-1024.366) [-1018.873] (-1017.008) -- 0:00:32
473000 -- (-1017.697) (-1019.555) (-1018.636) [-1019.317] * (-1017.145) (-1023.158) (-1018.449) [-1020.179] -- 0:00:32
473500 -- (-1018.021) (-1017.596) [-1017.755] (-1017.652) * (-1018.908) (-1018.419) (-1019.336) [-1018.782] -- 0:00:33
474000 -- [-1018.667] (-1020.554) (-1020.280) (-1018.078) * (-1017.591) (-1022.057) [-1019.280] (-1018.190) -- 0:00:33
474500 -- (-1020.116) [-1021.570] (-1018.232) (-1020.155) * (-1022.101) (-1026.261) [-1018.383] (-1017.287) -- 0:00:33
475000 -- (-1017.347) [-1019.777] (-1018.002) (-1019.619) * [-1017.814] (-1020.125) (-1017.111) (-1019.978) -- 0:00:33
Average standard deviation of split frequencies: 0.009780
475500 -- [-1017.724] (-1021.707) (-1016.930) (-1018.059) * (-1017.106) (-1018.111) [-1020.526] (-1018.269) -- 0:00:33
476000 -- [-1022.070] (-1018.814) (-1018.819) (-1019.482) * (-1017.217) (-1020.080) [-1020.702] (-1017.676) -- 0:00:33
476500 -- [-1018.616] (-1019.451) (-1017.662) (-1025.288) * (-1018.997) (-1019.261) [-1020.898] (-1020.367) -- 0:00:32
477000 -- (-1017.794) [-1020.288] (-1018.013) (-1021.501) * (-1024.211) (-1019.387) [-1023.112] (-1017.542) -- 0:00:32
477500 -- [-1017.984] (-1019.295) (-1018.625) (-1018.159) * (-1021.765) (-1022.282) (-1023.138) [-1020.322] -- 0:00:32
478000 -- [-1017.927] (-1019.130) (-1019.799) (-1018.872) * (-1019.863) (-1021.576) [-1017.575] (-1022.030) -- 0:00:32
478500 -- (-1017.741) [-1019.412] (-1020.626) (-1020.524) * [-1017.693] (-1021.716) (-1023.037) (-1019.440) -- 0:00:32
479000 -- [-1019.154] (-1017.090) (-1017.146) (-1018.627) * (-1019.455) (-1020.011) (-1022.432) [-1017.749] -- 0:00:32
479500 -- (-1019.061) (-1019.000) (-1017.354) [-1017.501] * (-1021.062) (-1021.266) (-1019.090) [-1018.289] -- 0:00:32
480000 -- [-1017.272] (-1020.100) (-1017.967) (-1017.898) * (-1021.925) [-1019.653] (-1022.471) (-1017.696) -- 0:00:32
Average standard deviation of split frequencies: 0.009991
480500 -- (-1017.136) (-1018.423) (-1016.865) [-1018.316] * (-1018.393) (-1018.787) [-1019.119] (-1020.027) -- 0:00:32
481000 -- (-1018.214) (-1022.243) (-1022.254) [-1017.365] * (-1021.163) (-1017.139) [-1016.806] (-1018.461) -- 0:00:32
481500 -- (-1018.588) (-1019.287) (-1021.463) [-1019.043] * (-1017.641) [-1018.009] (-1017.971) (-1019.678) -- 0:00:32
482000 -- (-1017.317) (-1025.775) [-1019.103] (-1019.627) * (-1018.427) (-1019.414) [-1020.240] (-1020.934) -- 0:00:32
482500 -- (-1017.864) (-1020.164) [-1020.186] (-1020.708) * (-1021.957) (-1021.880) [-1018.348] (-1019.074) -- 0:00:32
483000 -- (-1019.278) [-1022.107] (-1020.889) (-1020.144) * [-1018.194] (-1019.814) (-1018.790) (-1016.736) -- 0:00:32
483500 -- (-1019.244) (-1018.220) [-1017.825] (-1022.969) * (-1017.026) (-1020.371) [-1017.232] (-1020.988) -- 0:00:32
484000 -- (-1018.057) [-1018.722] (-1021.110) (-1017.814) * (-1021.711) (-1020.100) [-1017.460] (-1021.478) -- 0:00:31
484500 -- [-1023.704] (-1017.191) (-1018.265) (-1021.051) * (-1020.676) [-1017.125] (-1021.236) (-1019.735) -- 0:00:31
485000 -- [-1023.180] (-1017.238) (-1020.864) (-1017.622) * (-1019.722) [-1020.920] (-1019.158) (-1018.418) -- 0:00:31
Average standard deviation of split frequencies: 0.008972
485500 -- (-1020.683) (-1018.078) (-1022.274) [-1018.219] * (-1018.541) (-1018.933) [-1019.187] (-1019.361) -- 0:00:31
486000 -- [-1018.954] (-1019.532) (-1017.495) (-1017.566) * (-1018.679) (-1019.886) [-1018.130] (-1022.696) -- 0:00:31
486500 -- (-1018.411) (-1016.822) (-1020.138) [-1018.967] * (-1018.374) (-1019.517) (-1017.964) [-1022.488] -- 0:00:31
487000 -- (-1019.271) [-1018.032] (-1027.380) (-1018.273) * [-1017.253] (-1017.618) (-1020.002) (-1021.649) -- 0:00:31
487500 -- (-1019.920) [-1018.049] (-1022.953) (-1018.884) * (-1022.900) (-1019.991) (-1017.963) [-1022.485] -- 0:00:31
488000 -- (-1019.271) (-1024.113) [-1021.997] (-1020.054) * [-1018.566] (-1017.853) (-1017.715) (-1021.493) -- 0:00:31
488500 -- [-1017.777] (-1018.228) (-1019.112) (-1024.760) * (-1023.657) [-1017.177] (-1019.222) (-1017.795) -- 0:00:31
489000 -- (-1018.837) [-1017.230] (-1020.022) (-1024.308) * [-1018.529] (-1017.372) (-1017.741) (-1017.141) -- 0:00:31
489500 -- (-1023.141) [-1021.050] (-1018.298) (-1025.315) * (-1019.783) (-1018.101) (-1022.441) [-1017.498] -- 0:00:31
490000 -- (-1022.730) (-1022.110) [-1018.343] (-1018.480) * (-1025.428) (-1023.447) [-1019.361] (-1017.910) -- 0:00:32
Average standard deviation of split frequencies: 0.009127
490500 -- [-1021.290] (-1016.861) (-1020.913) (-1021.730) * (-1017.404) [-1017.768] (-1017.656) (-1022.027) -- 0:00:32
491000 -- [-1022.624] (-1023.938) (-1023.988) (-1021.584) * [-1018.484] (-1019.531) (-1018.055) (-1019.285) -- 0:00:32
491500 -- (-1017.935) (-1019.764) (-1019.261) [-1021.696] * [-1020.496] (-1019.366) (-1018.898) (-1019.106) -- 0:00:32
492000 -- (-1018.285) (-1020.799) [-1017.569] (-1020.058) * (-1020.419) [-1019.155] (-1019.725) (-1018.996) -- 0:00:32
492500 -- (-1017.563) (-1022.000) [-1021.517] (-1022.947) * (-1019.434) [-1020.145] (-1021.031) (-1019.137) -- 0:00:31
493000 -- (-1017.054) [-1019.022] (-1019.311) (-1020.274) * (-1022.193) (-1019.411) (-1016.884) [-1018.679] -- 0:00:31
493500 -- (-1017.140) (-1019.245) [-1016.931] (-1017.906) * (-1019.114) [-1022.321] (-1019.208) (-1017.902) -- 0:00:31
494000 -- [-1022.613] (-1027.312) (-1016.771) (-1018.744) * (-1017.516) (-1019.990) [-1019.666] (-1016.873) -- 0:00:31
494500 -- (-1020.569) (-1019.433) (-1019.390) [-1020.751] * (-1018.540) [-1019.910] (-1018.938) (-1017.086) -- 0:00:31
495000 -- (-1017.587) (-1018.527) (-1021.318) [-1020.927] * (-1017.758) [-1019.686] (-1018.245) (-1017.132) -- 0:00:31
Average standard deviation of split frequencies: 0.009267
495500 -- (-1019.356) [-1017.946] (-1019.054) (-1024.398) * [-1017.460] (-1017.104) (-1021.176) (-1017.050) -- 0:00:31
496000 -- (-1021.533) (-1021.469) [-1019.036] (-1021.849) * [-1019.137] (-1020.234) (-1018.129) (-1017.314) -- 0:00:31
496500 -- (-1020.778) (-1020.993) [-1018.930] (-1023.811) * [-1019.027] (-1025.986) (-1018.557) (-1017.577) -- 0:00:31
497000 -- [-1018.866] (-1020.577) (-1021.055) (-1022.082) * [-1017.883] (-1019.310) (-1026.413) (-1018.676) -- 0:00:31
497500 -- (-1018.456) [-1018.959] (-1016.766) (-1017.847) * (-1018.950) (-1017.941) [-1018.181] (-1018.964) -- 0:00:31
498000 -- [-1018.475] (-1019.871) (-1016.810) (-1017.206) * (-1020.350) [-1017.793] (-1020.913) (-1020.319) -- 0:00:31
498500 -- (-1020.303) [-1018.321] (-1020.785) (-1016.968) * [-1018.289] (-1020.332) (-1020.718) (-1021.406) -- 0:00:31
499000 -- [-1018.425] (-1019.041) (-1019.153) (-1021.896) * (-1018.290) (-1017.438) [-1017.798] (-1020.601) -- 0:00:31
499500 -- (-1023.409) [-1017.076] (-1021.760) (-1016.778) * (-1019.780) (-1018.834) [-1016.721] (-1021.832) -- 0:00:31
500000 -- (-1019.915) (-1018.573) [-1022.150] (-1020.312) * (-1016.690) [-1017.768] (-1019.457) (-1020.707) -- 0:00:31
Average standard deviation of split frequencies: 0.009239
500500 -- (-1021.951) (-1019.718) [-1019.555] (-1021.695) * [-1017.251] (-1018.270) (-1019.859) (-1018.081) -- 0:00:30
501000 -- (-1017.042) (-1020.611) [-1018.139] (-1021.177) * [-1016.681] (-1019.838) (-1018.911) (-1018.089) -- 0:00:30
501500 -- (-1017.153) (-1017.904) [-1018.595] (-1017.680) * (-1017.442) (-1019.191) (-1021.191) [-1017.392] -- 0:00:30
502000 -- [-1018.034] (-1017.846) (-1017.817) (-1018.691) * (-1017.863) (-1019.744) [-1019.149] (-1017.392) -- 0:00:30
502500 -- [-1020.073] (-1017.588) (-1018.221) (-1024.961) * (-1018.910) (-1018.546) [-1017.807] (-1018.379) -- 0:00:30
503000 -- (-1017.333) [-1017.166] (-1016.679) (-1021.500) * (-1018.542) [-1017.079] (-1017.295) (-1023.333) -- 0:00:30
503500 -- [-1017.898] (-1017.280) (-1019.710) (-1022.622) * [-1017.426] (-1022.362) (-1018.531) (-1020.790) -- 0:00:30
504000 -- [-1019.294] (-1018.051) (-1023.391) (-1018.169) * (-1018.824) (-1020.479) (-1023.529) [-1017.666] -- 0:00:30
504500 -- (-1018.106) (-1018.175) [-1026.366] (-1018.978) * (-1020.421) (-1020.010) [-1019.799] (-1017.334) -- 0:00:30
505000 -- (-1018.333) [-1020.375] (-1019.069) (-1018.865) * (-1019.221) (-1021.328) (-1019.016) [-1017.274] -- 0:00:30
Average standard deviation of split frequencies: 0.008850
505500 -- [-1018.711] (-1017.824) (-1020.939) (-1020.031) * (-1020.608) (-1019.351) (-1019.589) [-1018.569] -- 0:00:30
506000 -- [-1019.897] (-1018.809) (-1026.575) (-1017.469) * (-1019.618) (-1019.063) [-1017.524] (-1018.828) -- 0:00:31
506500 -- (-1017.941) (-1018.927) (-1017.890) [-1018.018] * (-1021.401) [-1018.831] (-1019.007) (-1018.197) -- 0:00:31
507000 -- (-1018.988) (-1018.903) [-1021.867] (-1018.754) * [-1021.918] (-1017.888) (-1020.357) (-1019.418) -- 0:00:31
507500 -- (-1017.840) (-1017.821) (-1017.161) [-1020.533] * (-1017.738) (-1017.012) (-1018.279) [-1017.314] -- 0:00:31
508000 -- (-1023.586) (-1018.944) [-1017.304] (-1016.906) * (-1016.967) (-1016.924) [-1018.023] (-1019.662) -- 0:00:30
508500 -- [-1018.812] (-1022.411) (-1018.143) (-1018.018) * (-1016.721) [-1017.000] (-1020.851) (-1018.367) -- 0:00:30
509000 -- (-1018.629) (-1020.107) [-1017.978] (-1022.230) * (-1020.414) (-1019.597) (-1018.362) [-1021.331] -- 0:00:30
509500 -- [-1018.121] (-1019.787) (-1017.939) (-1018.370) * (-1019.681) [-1018.940] (-1019.025) (-1019.274) -- 0:00:30
510000 -- [-1018.436] (-1021.055) (-1020.367) (-1018.058) * (-1019.237) (-1023.389) [-1016.867] (-1019.171) -- 0:00:30
Average standard deviation of split frequencies: 0.009231
510500 -- (-1020.319) (-1019.099) [-1017.749] (-1017.838) * [-1021.501] (-1021.534) (-1017.683) (-1018.609) -- 0:00:30
511000 -- (-1020.842) [-1019.576] (-1017.834) (-1018.257) * (-1017.710) (-1019.565) (-1017.104) [-1017.896] -- 0:00:30
511500 -- (-1018.311) [-1021.787] (-1020.039) (-1021.206) * [-1019.858] (-1019.201) (-1017.596) (-1018.241) -- 0:00:30
512000 -- (-1020.083) (-1018.949) [-1017.504] (-1018.293) * (-1019.802) (-1017.965) (-1024.601) [-1018.219] -- 0:00:30
512500 -- (-1019.340) (-1019.151) [-1019.609] (-1017.620) * (-1019.218) [-1017.481] (-1020.732) (-1017.201) -- 0:00:30
513000 -- (-1018.116) (-1024.746) (-1020.788) [-1020.414] * (-1017.607) [-1017.419] (-1019.654) (-1017.751) -- 0:00:30
513500 -- (-1018.087) (-1024.477) (-1017.768) [-1019.521] * [-1019.195] (-1018.552) (-1021.245) (-1017.483) -- 0:00:30
514000 -- [-1021.174] (-1016.794) (-1017.647) (-1018.247) * (-1019.772) (-1020.316) (-1019.960) [-1019.733] -- 0:00:30
514500 -- (-1022.624) (-1017.181) [-1019.712] (-1018.889) * (-1019.863) (-1022.055) (-1019.830) [-1018.982] -- 0:00:30
515000 -- (-1017.401) (-1017.119) (-1018.058) [-1019.538] * (-1019.120) [-1019.649] (-1020.216) (-1017.229) -- 0:00:30
Average standard deviation of split frequencies: 0.009421
515500 -- (-1017.478) (-1017.514) (-1018.603) [-1019.537] * (-1019.205) (-1017.033) (-1019.007) [-1016.889] -- 0:00:30
516000 -- [-1017.306] (-1018.797) (-1019.587) (-1019.899) * (-1017.713) [-1017.769] (-1021.456) (-1017.296) -- 0:00:30
516500 -- [-1018.282] (-1018.640) (-1019.048) (-1018.525) * [-1017.633] (-1017.245) (-1020.754) (-1018.629) -- 0:00:29
517000 -- [-1019.652] (-1017.871) (-1020.692) (-1019.068) * (-1016.800) [-1017.258] (-1020.617) (-1018.985) -- 0:00:29
517500 -- [-1017.832] (-1019.559) (-1019.742) (-1022.567) * [-1020.478] (-1020.313) (-1017.764) (-1017.980) -- 0:00:29
518000 -- (-1017.227) (-1017.980) (-1020.386) [-1018.374] * (-1022.217) (-1021.004) (-1017.840) [-1016.853] -- 0:00:29
518500 -- [-1017.327] (-1019.543) (-1016.859) (-1017.949) * (-1017.975) (-1019.821) (-1019.092) [-1018.564] -- 0:00:29
519000 -- (-1017.479) (-1017.583) [-1018.173] (-1023.190) * (-1017.517) (-1017.870) (-1024.178) [-1020.186] -- 0:00:29
519500 -- [-1018.147] (-1018.248) (-1022.318) (-1016.710) * (-1017.968) [-1022.223] (-1025.265) (-1019.324) -- 0:00:29
520000 -- [-1019.572] (-1017.701) (-1022.498) (-1016.553) * (-1020.197) [-1017.650] (-1017.796) (-1019.328) -- 0:00:29
Average standard deviation of split frequencies: 0.009903
520500 -- (-1019.398) (-1017.178) [-1019.276] (-1016.548) * (-1017.400) (-1016.956) (-1016.802) [-1018.035] -- 0:00:29
521000 -- [-1018.648] (-1018.987) (-1017.146) (-1018.326) * [-1017.402] (-1019.584) (-1019.907) (-1018.361) -- 0:00:29
521500 -- (-1018.201) [-1018.912] (-1019.787) (-1020.571) * (-1019.747) (-1019.287) [-1017.874] (-1017.904) -- 0:00:29
522000 -- (-1017.554) (-1018.384) (-1018.558) [-1019.346] * (-1018.118) (-1021.502) (-1018.108) [-1018.367] -- 0:00:29
522500 -- [-1019.010] (-1017.634) (-1018.065) (-1020.493) * (-1018.907) (-1023.455) (-1017.953) [-1018.086] -- 0:00:30
523000 -- (-1018.215) (-1016.461) (-1019.012) [-1016.541] * (-1017.380) (-1023.343) [-1019.562] (-1018.322) -- 0:00:30
523500 -- (-1017.613) (-1017.477) (-1019.505) [-1020.635] * (-1019.830) [-1024.116] (-1018.244) (-1020.206) -- 0:00:30
524000 -- (-1017.494) (-1019.262) [-1019.173] (-1020.565) * (-1021.280) (-1018.367) (-1019.042) [-1017.754] -- 0:00:29
524500 -- (-1021.257) (-1018.938) (-1017.574) [-1018.850] * (-1017.556) [-1017.672] (-1019.324) (-1017.466) -- 0:00:29
525000 -- (-1022.116) (-1022.358) [-1017.672] (-1021.692) * (-1017.166) (-1018.688) [-1019.540] (-1020.613) -- 0:00:29
Average standard deviation of split frequencies: 0.010418
525500 -- [-1018.506] (-1018.110) (-1016.898) (-1017.995) * (-1021.385) [-1020.728] (-1017.145) (-1021.127) -- 0:00:29
526000 -- (-1019.164) [-1019.353] (-1020.876) (-1018.177) * [-1016.803] (-1019.302) (-1018.287) (-1020.151) -- 0:00:29
526500 -- (-1018.813) [-1017.848] (-1018.471) (-1016.851) * (-1020.587) (-1020.428) (-1019.594) [-1017.472] -- 0:00:29
527000 -- (-1017.376) (-1018.469) [-1016.854] (-1019.647) * [-1018.319] (-1018.931) (-1019.808) (-1017.176) -- 0:00:29
527500 -- (-1018.773) (-1019.787) (-1019.379) [-1019.611] * [-1017.261] (-1022.566) (-1018.909) (-1019.041) -- 0:00:29
528000 -- (-1021.171) (-1020.286) (-1016.864) [-1020.374] * (-1018.357) (-1017.010) [-1018.234] (-1019.457) -- 0:00:29
528500 -- (-1018.632) [-1020.372] (-1021.283) (-1019.688) * [-1016.784] (-1020.888) (-1016.665) (-1018.111) -- 0:00:29
529000 -- (-1021.095) (-1019.926) [-1019.680] (-1018.362) * (-1023.380) (-1021.022) (-1018.525) [-1018.621] -- 0:00:29
529500 -- [-1019.998] (-1018.526) (-1018.041) (-1019.159) * (-1019.644) (-1020.282) [-1018.370] (-1019.859) -- 0:00:29
530000 -- (-1017.374) (-1020.447) (-1018.811) [-1020.799] * [-1018.284] (-1018.518) (-1017.952) (-1020.830) -- 0:00:29
Average standard deviation of split frequencies: 0.009772
530500 -- (-1017.432) (-1019.577) (-1017.161) [-1021.771] * (-1017.846) [-1019.686] (-1017.663) (-1019.840) -- 0:00:29
531000 -- (-1018.505) [-1020.917] (-1017.536) (-1017.336) * (-1018.303) [-1018.607] (-1018.614) (-1020.873) -- 0:00:29
531500 -- (-1017.743) [-1017.418] (-1021.344) (-1017.201) * [-1017.823] (-1019.719) (-1019.396) (-1020.174) -- 0:00:29
532000 -- [-1020.982] (-1017.138) (-1019.265) (-1017.692) * [-1016.938] (-1020.078) (-1018.313) (-1020.070) -- 0:00:29
532500 -- (-1016.915) (-1017.284) [-1017.527] (-1018.012) * [-1019.657] (-1022.440) (-1018.679) (-1018.872) -- 0:00:28
533000 -- (-1016.902) (-1019.822) (-1022.812) [-1018.679] * (-1018.822) (-1022.095) (-1018.460) [-1019.585] -- 0:00:28
533500 -- (-1022.622) (-1018.539) [-1019.876] (-1020.721) * (-1018.706) [-1018.952] (-1018.445) (-1019.337) -- 0:00:28
534000 -- (-1019.214) (-1021.256) [-1019.795] (-1019.946) * (-1021.602) (-1019.173) (-1019.550) [-1021.498] -- 0:00:28
534500 -- [-1017.689] (-1018.015) (-1018.500) (-1019.288) * (-1019.328) (-1017.092) [-1020.672] (-1017.138) -- 0:00:28
535000 -- (-1019.713) (-1018.578) (-1017.464) [-1019.511] * [-1016.948] (-1019.115) (-1018.754) (-1018.224) -- 0:00:28
Average standard deviation of split frequencies: 0.009323
535500 -- (-1018.123) (-1020.416) (-1017.188) [-1017.791] * [-1017.837] (-1023.415) (-1017.544) (-1017.770) -- 0:00:28
536000 -- (-1017.152) (-1018.800) (-1017.218) [-1016.651] * (-1018.867) [-1018.161] (-1017.605) (-1018.083) -- 0:00:28
536500 -- (-1016.925) (-1017.936) (-1020.214) [-1017.342] * (-1019.034) (-1019.809) (-1018.217) [-1017.789] -- 0:00:28
537000 -- [-1017.600] (-1017.132) (-1017.922) (-1017.219) * [-1017.437] (-1017.137) (-1018.711) (-1017.847) -- 0:00:28
537500 -- (-1018.173) (-1018.226) [-1021.313] (-1019.453) * (-1018.590) [-1017.463] (-1017.608) (-1017.602) -- 0:00:28
538000 -- (-1018.676) [-1018.298] (-1021.141) (-1017.637) * [-1018.290] (-1017.318) (-1016.665) (-1018.282) -- 0:00:28
538500 -- [-1021.323] (-1018.596) (-1018.870) (-1022.412) * (-1018.303) (-1019.564) [-1018.960] (-1017.868) -- 0:00:28
539000 -- [-1019.608] (-1018.273) (-1017.630) (-1020.057) * [-1018.610] (-1019.452) (-1017.389) (-1018.418) -- 0:00:29
539500 -- [-1018.408] (-1019.719) (-1018.998) (-1018.560) * [-1018.541] (-1019.715) (-1018.419) (-1018.156) -- 0:00:29
540000 -- (-1020.356) (-1020.389) [-1019.519] (-1019.513) * (-1018.368) (-1020.262) [-1018.311] (-1020.570) -- 0:00:28
Average standard deviation of split frequencies: 0.009940
540500 -- (-1022.759) (-1019.764) [-1018.189] (-1018.315) * (-1017.000) [-1019.758] (-1021.135) (-1022.250) -- 0:00:28
541000 -- [-1017.975] (-1018.045) (-1020.967) (-1022.255) * (-1017.603) (-1021.795) (-1020.200) [-1021.539] -- 0:00:28
541500 -- (-1018.042) (-1018.288) [-1019.479] (-1020.137) * [-1018.482] (-1020.068) (-1019.891) (-1017.167) -- 0:00:28
542000 -- (-1020.178) [-1017.505] (-1021.944) (-1019.059) * (-1018.852) [-1020.395] (-1020.724) (-1017.226) -- 0:00:28
542500 -- (-1026.304) [-1022.150] (-1020.356) (-1018.842) * (-1017.253) (-1019.032) (-1019.849) [-1020.753] -- 0:00:28
543000 -- (-1018.186) [-1019.720] (-1017.095) (-1017.060) * (-1017.128) (-1018.936) (-1017.448) [-1017.343] -- 0:00:28
543500 -- (-1018.865) [-1018.673] (-1018.204) (-1017.118) * (-1017.762) [-1018.331] (-1021.315) (-1020.329) -- 0:00:28
544000 -- (-1017.748) (-1021.849) [-1020.931] (-1019.871) * [-1017.771] (-1021.572) (-1021.421) (-1018.225) -- 0:00:28
544500 -- (-1017.480) [-1020.213] (-1017.788) (-1018.457) * [-1018.642] (-1018.828) (-1017.551) (-1017.501) -- 0:00:28
545000 -- (-1017.854) (-1022.467) (-1021.156) [-1018.526] * [-1018.376] (-1019.484) (-1022.380) (-1017.227) -- 0:00:28
Average standard deviation of split frequencies: 0.010476
545500 -- (-1026.595) (-1020.863) (-1018.674) [-1020.603] * [-1018.378] (-1017.678) (-1020.482) (-1018.380) -- 0:00:28
546000 -- (-1023.584) (-1019.082) [-1020.438] (-1020.266) * (-1017.799) (-1021.492) [-1018.863] (-1018.736) -- 0:00:28
546500 -- (-1018.602) (-1017.721) [-1018.309] (-1020.204) * [-1017.294] (-1019.198) (-1017.030) (-1018.426) -- 0:00:28
547000 -- [-1018.630] (-1022.961) (-1017.931) (-1019.591) * (-1019.236) (-1017.850) [-1017.078] (-1019.488) -- 0:00:28
547500 -- (-1018.437) [-1018.883] (-1016.843) (-1017.140) * (-1020.318) [-1022.218] (-1019.170) (-1018.395) -- 0:00:28
548000 -- (-1018.011) (-1017.346) (-1020.714) [-1018.702] * (-1020.807) (-1020.738) (-1019.761) [-1019.192] -- 0:00:28
548500 -- (-1019.122) [-1018.010] (-1018.915) (-1017.170) * (-1017.206) [-1017.229] (-1019.517) (-1018.728) -- 0:00:27
549000 -- (-1017.843) (-1018.499) (-1017.651) [-1017.343] * (-1020.712) [-1018.406] (-1018.591) (-1018.728) -- 0:00:27
549500 -- (-1019.301) (-1021.192) [-1016.865] (-1018.691) * (-1017.666) [-1020.635] (-1019.978) (-1018.342) -- 0:00:27
550000 -- [-1017.456] (-1018.673) (-1017.798) (-1021.304) * [-1017.726] (-1018.667) (-1017.543) (-1018.082) -- 0:00:27
Average standard deviation of split frequencies: 0.010059
550500 -- (-1025.842) [-1018.503] (-1017.943) (-1018.984) * [-1017.448] (-1017.694) (-1019.925) (-1018.226) -- 0:00:27
551000 -- [-1018.740] (-1018.823) (-1016.939) (-1018.134) * (-1017.775) [-1019.521] (-1020.795) (-1019.533) -- 0:00:27
551500 -- [-1021.780] (-1017.319) (-1016.836) (-1021.893) * (-1019.222) [-1020.672] (-1023.141) (-1019.010) -- 0:00:27
552000 -- (-1019.200) (-1019.623) [-1021.681] (-1022.202) * (-1018.238) (-1019.510) [-1017.506] (-1019.707) -- 0:00:27
552500 -- [-1021.106] (-1018.156) (-1020.858) (-1022.400) * (-1023.350) [-1019.964] (-1017.597) (-1024.382) -- 0:00:27
553000 -- [-1019.584] (-1019.773) (-1016.632) (-1018.880) * (-1022.897) (-1020.599) (-1020.759) [-1020.093] -- 0:00:27
553500 -- (-1017.509) (-1017.930) [-1017.762] (-1022.007) * [-1019.605] (-1021.410) (-1018.330) (-1018.020) -- 0:00:27
554000 -- (-1018.768) [-1021.115] (-1020.496) (-1018.857) * [-1019.788] (-1019.558) (-1016.702) (-1016.961) -- 0:00:27
554500 -- (-1018.817) (-1019.042) (-1018.000) [-1019.797] * [-1019.841] (-1016.944) (-1018.699) (-1017.916) -- 0:00:27
555000 -- (-1018.870) [-1021.605] (-1018.690) (-1019.466) * (-1018.545) [-1016.895] (-1019.870) (-1017.256) -- 0:00:28
Average standard deviation of split frequencies: 0.009485
555500 -- [-1020.062] (-1017.837) (-1021.065) (-1018.009) * (-1017.841) [-1016.831] (-1018.864) (-1017.936) -- 0:00:28
556000 -- (-1017.750) (-1016.809) (-1018.350) [-1020.767] * [-1018.658] (-1017.832) (-1017.594) (-1017.923) -- 0:00:27
556500 -- (-1016.546) [-1017.564] (-1025.392) (-1024.578) * (-1019.613) (-1018.012) (-1021.329) [-1017.978] -- 0:00:27
557000 -- (-1017.148) (-1019.157) [-1018.553] (-1019.777) * (-1019.571) [-1018.706] (-1019.795) (-1019.563) -- 0:00:27
557500 -- (-1019.480) (-1019.354) [-1020.155] (-1020.853) * (-1017.828) (-1020.701) [-1022.379] (-1019.624) -- 0:00:27
558000 -- (-1017.944) [-1019.957] (-1021.111) (-1021.274) * [-1016.936] (-1017.187) (-1019.933) (-1017.076) -- 0:00:27
558500 -- (-1030.413) (-1019.712) (-1023.285) [-1017.850] * [-1016.872] (-1016.767) (-1018.124) (-1018.603) -- 0:00:27
559000 -- (-1022.500) (-1022.000) [-1017.710] (-1019.316) * (-1016.563) [-1018.140] (-1020.953) (-1019.991) -- 0:00:27
559500 -- [-1017.858] (-1021.196) (-1017.942) (-1017.613) * (-1017.308) (-1018.178) [-1019.975] (-1021.343) -- 0:00:27
560000 -- (-1022.481) [-1020.091] (-1018.073) (-1019.456) * [-1017.544] (-1016.853) (-1018.643) (-1022.062) -- 0:00:27
Average standard deviation of split frequencies: 0.009459
560500 -- (-1017.957) (-1021.028) (-1019.340) [-1021.428] * (-1019.752) (-1017.362) (-1022.433) [-1018.443] -- 0:00:27
561000 -- (-1017.484) [-1019.472] (-1019.194) (-1019.292) * (-1017.767) [-1018.828] (-1018.216) (-1018.696) -- 0:00:27
561500 -- (-1016.635) (-1019.872) (-1019.458) [-1020.497] * (-1022.748) (-1018.222) [-1020.023] (-1020.948) -- 0:00:27
562000 -- [-1018.221] (-1017.018) (-1018.171) (-1019.743) * [-1017.328] (-1020.875) (-1022.011) (-1018.823) -- 0:00:27
562500 -- [-1016.954] (-1018.480) (-1020.277) (-1021.762) * [-1018.438] (-1020.480) (-1021.154) (-1017.842) -- 0:00:27
563000 -- (-1021.237) [-1018.857] (-1018.916) (-1021.323) * (-1020.882) [-1018.592] (-1019.514) (-1021.158) -- 0:00:27
563500 -- (-1018.860) (-1027.478) (-1018.677) [-1021.438] * (-1020.141) (-1021.091) (-1020.767) [-1018.367] -- 0:00:27
564000 -- (-1018.034) [-1018.170] (-1017.294) (-1018.056) * (-1018.614) (-1018.345) [-1019.573] (-1017.458) -- 0:00:27
564500 -- [-1018.785] (-1019.470) (-1025.841) (-1018.964) * (-1016.733) [-1017.885] (-1019.007) (-1018.531) -- 0:00:27
565000 -- (-1020.939) (-1019.497) [-1018.760] (-1019.072) * [-1016.954] (-1019.829) (-1019.659) (-1019.586) -- 0:00:26
Average standard deviation of split frequencies: 0.008966
565500 -- (-1018.765) (-1017.121) (-1022.737) [-1019.433] * (-1017.874) [-1018.681] (-1018.536) (-1017.072) -- 0:00:26
566000 -- (-1019.645) (-1019.605) [-1020.814] (-1016.514) * (-1019.010) [-1018.334] (-1016.932) (-1017.593) -- 0:00:26
566500 -- (-1020.976) [-1018.462] (-1018.197) (-1019.431) * (-1020.368) (-1018.832) [-1018.020] (-1018.117) -- 0:00:26
567000 -- (-1017.818) (-1021.998) (-1017.303) [-1017.238] * (-1018.902) [-1019.146] (-1020.712) (-1018.748) -- 0:00:26
567500 -- (-1022.386) [-1020.039] (-1017.337) (-1018.813) * [-1017.087] (-1020.967) (-1021.133) (-1019.221) -- 0:00:26
568000 -- (-1024.142) [-1017.526] (-1021.004) (-1019.116) * (-1018.087) (-1021.029) [-1018.334] (-1018.604) -- 0:00:26
568500 -- (-1018.413) (-1021.254) [-1018.423] (-1017.147) * (-1017.352) (-1018.319) [-1019.185] (-1019.334) -- 0:00:26
569000 -- (-1018.824) (-1023.160) (-1018.056) [-1020.924] * [-1017.684] (-1019.165) (-1022.597) (-1021.083) -- 0:00:26
569500 -- (-1021.183) (-1020.612) (-1019.012) [-1019.651] * (-1017.702) (-1017.497) (-1018.296) [-1022.419] -- 0:00:26
570000 -- (-1024.256) [-1019.498] (-1024.504) (-1022.110) * (-1019.107) (-1018.026) (-1020.011) [-1018.361] -- 0:00:26
Average standard deviation of split frequencies: 0.008880
570500 -- (-1021.595) [-1022.462] (-1017.435) (-1021.687) * (-1018.678) [-1019.919] (-1019.333) (-1018.511) -- 0:00:26
571000 -- (-1018.556) (-1019.139) (-1016.685) [-1020.284] * (-1017.386) (-1018.898) (-1017.274) [-1016.666] -- 0:00:27
571500 -- [-1018.767] (-1018.900) (-1017.629) (-1021.277) * [-1018.169] (-1019.033) (-1020.853) (-1017.765) -- 0:00:26
572000 -- [-1017.975] (-1023.075) (-1022.911) (-1020.299) * (-1018.371) (-1018.765) (-1019.364) [-1017.766] -- 0:00:26
572500 -- (-1016.821) [-1021.158] (-1022.424) (-1017.980) * (-1021.914) (-1021.333) (-1020.167) [-1018.447] -- 0:00:26
573000 -- (-1017.502) (-1017.262) (-1020.053) [-1019.015] * [-1021.301] (-1026.197) (-1019.733) (-1022.216) -- 0:00:26
573500 -- (-1017.557) (-1019.086) (-1020.201) [-1017.301] * [-1019.107] (-1023.277) (-1017.724) (-1019.406) -- 0:00:26
574000 -- (-1017.765) (-1019.354) [-1017.373] (-1017.318) * (-1019.825) (-1021.938) [-1018.316] (-1017.792) -- 0:00:26
574500 -- (-1019.706) (-1030.099) (-1017.094) [-1019.860] * [-1019.160] (-1019.875) (-1017.478) (-1017.979) -- 0:00:26
575000 -- (-1018.295) [-1018.624] (-1017.114) (-1020.855) * (-1023.541) (-1022.867) (-1017.411) [-1018.903] -- 0:00:26
Average standard deviation of split frequencies: 0.009207
575500 -- [-1017.355] (-1018.098) (-1017.651) (-1018.309) * (-1023.301) (-1019.448) (-1018.388) [-1019.700] -- 0:00:26
576000 -- [-1021.422] (-1022.255) (-1017.390) (-1018.264) * (-1019.085) [-1019.579] (-1018.318) (-1018.509) -- 0:00:26
576500 -- [-1017.458] (-1019.094) (-1022.357) (-1018.775) * [-1018.865] (-1017.379) (-1018.115) (-1020.446) -- 0:00:26
577000 -- (-1017.272) [-1022.410] (-1023.483) (-1017.409) * (-1018.057) (-1017.774) (-1022.387) [-1017.684] -- 0:00:26
577500 -- [-1018.721] (-1017.307) (-1020.944) (-1019.050) * (-1019.052) (-1018.100) [-1024.258] (-1022.442) -- 0:00:26
578000 -- (-1018.155) (-1018.031) (-1022.645) [-1018.211] * (-1020.113) (-1018.845) (-1017.490) [-1021.356] -- 0:00:26
578500 -- [-1018.697] (-1020.646) (-1020.243) (-1019.614) * (-1020.610) [-1016.743] (-1020.379) (-1020.012) -- 0:00:26
579000 -- (-1018.409) [-1020.009] (-1019.083) (-1019.341) * [-1021.055] (-1017.163) (-1020.782) (-1017.761) -- 0:00:26
579500 -- (-1018.535) (-1018.335) [-1017.239] (-1016.996) * [-1019.854] (-1017.655) (-1020.219) (-1019.833) -- 0:00:26
580000 -- (-1017.093) (-1019.532) [-1017.054] (-1022.252) * (-1023.069) (-1019.525) [-1019.157] (-1024.505) -- 0:00:26
Average standard deviation of split frequencies: 0.008335
580500 -- (-1017.442) (-1018.795) (-1024.539) [-1020.170] * [-1017.868] (-1022.400) (-1017.893) (-1018.583) -- 0:00:26
581000 -- (-1018.222) (-1018.737) [-1019.831] (-1017.599) * (-1021.325) (-1021.216) [-1017.605] (-1019.095) -- 0:00:25
581500 -- (-1017.780) [-1017.616] (-1018.492) (-1017.354) * [-1024.431] (-1019.857) (-1022.259) (-1020.383) -- 0:00:25
582000 -- [-1021.717] (-1026.014) (-1018.869) (-1017.473) * (-1018.810) (-1020.329) (-1018.023) [-1019.021] -- 0:00:25
582500 -- [-1018.146] (-1023.656) (-1020.151) (-1017.574) * [-1017.879] (-1019.716) (-1022.145) (-1017.924) -- 0:00:25
583000 -- (-1019.725) (-1018.617) [-1020.760] (-1017.645) * [-1017.087] (-1018.409) (-1018.501) (-1020.048) -- 0:00:25
583500 -- [-1016.674] (-1021.767) (-1022.668) (-1017.310) * (-1024.009) (-1017.873) (-1019.484) [-1017.945] -- 0:00:25
584000 -- (-1018.288) [-1020.358] (-1020.883) (-1018.990) * [-1021.773] (-1021.406) (-1019.895) (-1020.027) -- 0:00:25
584500 -- (-1022.349) [-1017.283] (-1020.093) (-1017.583) * [-1021.088] (-1020.599) (-1017.774) (-1017.943) -- 0:00:25
585000 -- (-1020.278) (-1017.727) (-1018.032) [-1016.890] * (-1021.329) [-1021.665] (-1018.122) (-1017.915) -- 0:00:25
Average standard deviation of split frequencies: 0.008346
585500 -- (-1018.794) (-1019.926) [-1018.920] (-1018.698) * (-1018.472) [-1018.220] (-1016.955) (-1019.793) -- 0:00:25
586000 -- (-1018.752) (-1018.663) [-1017.876] (-1020.506) * (-1018.016) (-1021.936) (-1016.947) [-1019.099] -- 0:00:25
586500 -- (-1021.308) [-1020.227] (-1021.121) (-1021.797) * [-1018.144] (-1018.494) (-1018.286) (-1018.101) -- 0:00:25
587000 -- (-1019.627) (-1025.947) [-1019.648] (-1019.729) * (-1017.275) (-1020.068) [-1018.199] (-1022.159) -- 0:00:25
587500 -- (-1020.034) [-1017.990] (-1019.337) (-1019.155) * [-1016.788] (-1019.983) (-1018.816) (-1022.123) -- 0:00:25
588000 -- (-1021.601) (-1019.191) (-1019.242) [-1017.957] * (-1019.795) (-1018.060) [-1022.446] (-1019.214) -- 0:00:25
588500 -- (-1025.932) (-1018.664) [-1019.524] (-1017.873) * (-1019.777) (-1018.390) [-1021.439] (-1017.374) -- 0:00:25
589000 -- (-1020.904) (-1020.508) (-1019.307) [-1018.717] * [-1018.238] (-1020.617) (-1021.769) (-1017.972) -- 0:00:25
589500 -- (-1020.295) [-1017.930] (-1021.385) (-1017.021) * (-1020.377) [-1020.548] (-1020.223) (-1018.873) -- 0:00:25
590000 -- (-1017.417) (-1018.576) (-1018.519) [-1017.401] * (-1018.087) [-1018.188] (-1017.543) (-1019.523) -- 0:00:25
Average standard deviation of split frequencies: 0.008779
590500 -- [-1017.589] (-1018.926) (-1016.999) (-1020.702) * (-1017.999) [-1017.182] (-1019.277) (-1018.575) -- 0:00:25
591000 -- (-1017.025) (-1018.117) (-1019.004) [-1019.454] * (-1018.047) [-1018.127] (-1019.880) (-1017.618) -- 0:00:25
591500 -- [-1017.638] (-1021.085) (-1019.776) (-1019.687) * (-1018.305) (-1018.754) (-1020.029) [-1017.784] -- 0:00:25
592000 -- (-1020.745) (-1019.858) (-1018.826) [-1017.327] * (-1019.092) [-1017.378] (-1019.343) (-1017.532) -- 0:00:25
592500 -- (-1019.307) (-1016.890) (-1021.619) [-1019.950] * (-1018.987) [-1018.897] (-1018.837) (-1016.969) -- 0:00:25
593000 -- (-1018.874) [-1017.344] (-1019.548) (-1017.015) * [-1017.312] (-1018.227) (-1018.033) (-1017.920) -- 0:00:25
593500 -- (-1018.823) (-1017.395) [-1018.929] (-1019.203) * (-1017.925) (-1020.790) [-1018.928] (-1017.855) -- 0:00:25
594000 -- (-1019.752) (-1017.776) [-1017.251] (-1017.588) * (-1022.854) [-1017.744] (-1023.495) (-1017.952) -- 0:00:25
594500 -- [-1019.012] (-1019.320) (-1016.664) (-1019.807) * (-1020.912) (-1017.462) (-1025.042) [-1018.330] -- 0:00:25
595000 -- [-1018.347] (-1019.847) (-1018.201) (-1019.023) * (-1023.796) (-1019.196) (-1020.419) [-1018.242] -- 0:00:25
Average standard deviation of split frequencies: 0.008747
595500 -- (-1019.540) (-1026.501) [-1019.837] (-1019.695) * (-1019.257) (-1018.963) [-1018.061] (-1016.908) -- 0:00:25
596000 -- [-1017.549] (-1018.409) (-1017.605) (-1019.143) * (-1021.667) (-1017.266) [-1017.286] (-1017.493) -- 0:00:25
596500 -- [-1019.295] (-1020.823) (-1017.500) (-1018.185) * [-1020.487] (-1017.178) (-1018.967) (-1017.480) -- 0:00:25
597000 -- (-1019.620) (-1023.139) [-1017.500] (-1018.395) * (-1019.178) [-1018.772] (-1019.621) (-1018.921) -- 0:00:24
597500 -- (-1023.812) [-1020.836] (-1017.729) (-1023.044) * (-1021.390) (-1018.386) (-1018.961) [-1016.993] -- 0:00:24
598000 -- (-1019.621) [-1020.174] (-1018.985) (-1019.634) * (-1018.754) [-1018.454] (-1019.374) (-1020.466) -- 0:00:24
598500 -- [-1019.956] (-1018.062) (-1019.420) (-1019.854) * (-1022.537) (-1019.961) (-1020.428) [-1022.087] -- 0:00:24
599000 -- (-1018.403) (-1019.105) [-1018.440] (-1018.761) * (-1018.320) (-1024.536) (-1018.369) [-1020.505] -- 0:00:24
599500 -- (-1021.214) (-1018.697) [-1020.899] (-1017.835) * (-1018.449) [-1021.736] (-1017.585) (-1017.870) -- 0:00:24
600000 -- (-1020.524) (-1016.997) (-1020.784) [-1022.577] * (-1018.439) (-1022.236) (-1018.420) [-1019.308] -- 0:00:24
Average standard deviation of split frequencies: 0.009565
600500 -- (-1019.058) [-1017.570] (-1021.226) (-1017.729) * [-1018.723] (-1017.790) (-1018.307) (-1017.705) -- 0:00:24
601000 -- (-1017.296) [-1017.046] (-1018.047) (-1018.379) * (-1021.321) (-1018.461) [-1019.834] (-1018.307) -- 0:00:24
601500 -- (-1020.536) [-1017.504] (-1020.895) (-1019.198) * (-1021.076) [-1019.222] (-1017.795) (-1018.876) -- 0:00:24
602000 -- (-1018.597) (-1020.133) (-1019.983) [-1017.282] * (-1021.188) [-1017.504] (-1017.318) (-1017.882) -- 0:00:24
602500 -- (-1019.299) [-1017.259] (-1019.443) (-1018.747) * (-1019.647) (-1019.017) (-1018.660) [-1019.043] -- 0:00:24
603000 -- (-1020.235) (-1017.968) (-1017.774) [-1017.572] * (-1019.853) (-1020.475) [-1018.488] (-1018.381) -- 0:00:24
603500 -- (-1021.935) (-1020.855) (-1019.232) [-1017.616] * (-1018.219) [-1018.357] (-1019.415) (-1019.084) -- 0:00:24
604000 -- (-1022.595) (-1017.762) (-1021.679) [-1019.280] * [-1016.856] (-1017.399) (-1020.822) (-1016.996) -- 0:00:24
604500 -- (-1021.646) (-1018.072) (-1017.229) [-1018.612] * (-1019.659) [-1019.349] (-1020.791) (-1017.916) -- 0:00:24
605000 -- (-1019.466) (-1018.931) [-1017.278] (-1017.810) * [-1019.209] (-1019.524) (-1018.888) (-1019.949) -- 0:00:24
Average standard deviation of split frequencies: 0.009821
605500 -- (-1020.449) (-1021.196) (-1018.026) [-1017.340] * (-1022.992) [-1018.177] (-1019.165) (-1017.443) -- 0:00:24
606000 -- (-1017.725) (-1017.457) [-1019.976] (-1018.168) * (-1019.078) (-1022.573) [-1018.750] (-1021.691) -- 0:00:24
606500 -- [-1018.785] (-1018.399) (-1025.333) (-1018.396) * [-1018.879] (-1021.452) (-1019.848) (-1020.506) -- 0:00:24
607000 -- (-1017.800) [-1017.431] (-1019.812) (-1021.260) * [-1017.385] (-1019.368) (-1018.709) (-1017.177) -- 0:00:24
607500 -- (-1018.763) [-1017.732] (-1018.156) (-1020.186) * (-1017.608) [-1020.714] (-1021.399) (-1017.259) -- 0:00:24
608000 -- [-1017.386] (-1018.999) (-1019.383) (-1019.490) * (-1018.074) (-1023.640) (-1019.631) [-1018.155] -- 0:00:24
608500 -- (-1019.203) (-1022.072) (-1018.084) [-1019.012] * [-1018.699] (-1018.432) (-1020.679) (-1019.500) -- 0:00:24
609000 -- (-1023.612) (-1018.937) (-1020.064) [-1020.956] * (-1017.963) [-1018.732] (-1021.850) (-1020.644) -- 0:00:24
609500 -- [-1024.116] (-1017.878) (-1018.362) (-1021.760) * [-1019.589] (-1019.299) (-1019.900) (-1016.873) -- 0:00:24
610000 -- [-1020.698] (-1019.059) (-1019.219) (-1021.388) * (-1017.769) (-1021.909) [-1022.488] (-1017.248) -- 0:00:24
Average standard deviation of split frequencies: 0.009601
610500 -- (-1017.085) [-1021.218] (-1017.973) (-1023.501) * [-1018.477] (-1018.812) (-1020.979) (-1017.213) -- 0:00:24
611000 -- (-1020.916) (-1019.385) (-1019.320) [-1020.350] * (-1020.477) (-1017.852) [-1017.968] (-1017.822) -- 0:00:24
611500 -- (-1018.431) (-1017.699) [-1018.445] (-1020.820) * (-1017.499) (-1017.847) (-1020.900) [-1017.709] -- 0:00:24
612000 -- (-1017.694) (-1017.746) [-1019.245] (-1022.179) * (-1020.787) [-1018.359] (-1022.081) (-1018.896) -- 0:00:24
612500 -- [-1018.415] (-1019.943) (-1018.803) (-1019.157) * (-1017.586) [-1017.774] (-1019.671) (-1018.418) -- 0:00:24
613000 -- (-1018.803) (-1018.100) [-1019.074] (-1021.427) * (-1017.511) (-1018.723) (-1025.417) [-1019.706] -- 0:00:23
613500 -- (-1018.131) [-1017.174] (-1023.593) (-1019.665) * [-1017.876] (-1020.091) (-1021.797) (-1025.214) -- 0:00:23
614000 -- (-1018.982) [-1018.063] (-1019.763) (-1020.883) * (-1019.845) (-1019.924) (-1022.087) [-1018.217] -- 0:00:23
614500 -- (-1018.138) [-1018.989] (-1017.588) (-1022.530) * (-1019.616) (-1018.857) [-1018.186] (-1017.488) -- 0:00:23
615000 -- (-1019.038) (-1019.613) [-1020.209] (-1023.211) * (-1019.036) (-1020.358) [-1017.390] (-1016.931) -- 0:00:23
Average standard deviation of split frequencies: 0.009996
615500 -- [-1018.707] (-1021.273) (-1019.876) (-1021.980) * [-1018.927] (-1021.705) (-1017.414) (-1018.847) -- 0:00:23
616000 -- (-1018.040) [-1016.955] (-1024.631) (-1019.827) * (-1017.290) [-1017.630] (-1018.879) (-1021.813) -- 0:00:23
616500 -- (-1018.578) (-1016.776) (-1017.040) [-1017.419] * (-1018.075) [-1017.513] (-1019.750) (-1019.630) -- 0:00:23
617000 -- (-1019.248) [-1020.565] (-1018.232) (-1017.489) * [-1019.154] (-1020.533) (-1020.060) (-1021.358) -- 0:00:23
617500 -- (-1024.657) (-1017.410) (-1021.358) [-1017.313] * (-1017.629) (-1017.082) (-1019.498) [-1019.877] -- 0:00:23
618000 -- (-1017.623) (-1017.805) (-1022.972) [-1020.457] * (-1021.164) (-1018.822) [-1018.530] (-1023.559) -- 0:00:23
618500 -- (-1017.569) (-1017.001) (-1020.031) [-1020.011] * (-1021.636) [-1018.437] (-1018.709) (-1018.409) -- 0:00:23
619000 -- (-1019.643) [-1017.878] (-1018.713) (-1017.737) * (-1017.966) [-1021.068] (-1017.196) (-1020.357) -- 0:00:23
619500 -- [-1020.239] (-1018.425) (-1017.853) (-1017.705) * (-1022.612) [-1017.787] (-1018.329) (-1019.715) -- 0:00:23
620000 -- (-1018.103) (-1017.628) (-1019.917) [-1017.135] * (-1019.721) (-1019.387) [-1017.959] (-1019.894) -- 0:00:23
Average standard deviation of split frequencies: 0.010158
620500 -- [-1018.645] (-1022.025) (-1020.268) (-1019.091) * (-1019.362) [-1020.631] (-1017.952) (-1018.870) -- 0:00:23
621000 -- [-1020.077] (-1020.644) (-1018.992) (-1021.576) * [-1020.504] (-1017.283) (-1018.355) (-1021.638) -- 0:00:23
621500 -- (-1017.530) [-1018.938] (-1024.644) (-1017.141) * (-1018.814) [-1020.509] (-1018.957) (-1019.203) -- 0:00:23
622000 -- (-1019.227) [-1021.064] (-1018.694) (-1021.682) * (-1019.460) (-1021.878) [-1018.126] (-1022.664) -- 0:00:23
622500 -- [-1021.250] (-1019.300) (-1021.340) (-1021.756) * [-1022.628] (-1020.720) (-1020.296) (-1019.586) -- 0:00:23
623000 -- (-1019.359) [-1018.101] (-1019.799) (-1021.380) * (-1024.417) [-1018.256] (-1021.689) (-1017.153) -- 0:00:23
623500 -- (-1020.672) [-1017.982] (-1021.687) (-1021.253) * [-1018.469] (-1018.641) (-1024.084) (-1017.832) -- 0:00:23
624000 -- (-1019.038) (-1018.040) [-1018.768] (-1020.143) * (-1016.785) (-1017.160) (-1016.931) [-1020.120] -- 0:00:23
624500 -- [-1017.080] (-1020.550) (-1017.820) (-1018.155) * (-1017.258) (-1017.938) [-1017.812] (-1019.174) -- 0:00:23
625000 -- (-1016.960) (-1022.152) [-1016.986] (-1020.791) * (-1017.258) [-1018.499] (-1018.005) (-1019.070) -- 0:00:23
Average standard deviation of split frequencies: 0.009931
625500 -- [-1017.214] (-1019.013) (-1018.971) (-1018.885) * (-1017.404) [-1018.682] (-1020.499) (-1019.340) -- 0:00:23
626000 -- (-1021.771) (-1017.118) [-1019.401] (-1018.062) * [-1018.079] (-1018.725) (-1019.081) (-1019.342) -- 0:00:23
626500 -- (-1021.029) [-1021.036] (-1018.742) (-1018.772) * (-1018.920) (-1018.131) (-1020.500) [-1018.159] -- 0:00:23
627000 -- (-1017.388) (-1018.664) [-1019.238] (-1020.116) * (-1023.979) (-1017.715) (-1024.600) [-1019.860] -- 0:00:23
627500 -- (-1019.394) (-1018.727) (-1019.684) [-1018.190] * (-1020.168) (-1019.206) [-1018.888] (-1023.616) -- 0:00:23
628000 -- [-1021.094] (-1020.565) (-1018.230) (-1021.292) * (-1016.858) (-1018.264) [-1016.616] (-1017.098) -- 0:00:23
628500 -- [-1017.961] (-1019.589) (-1018.777) (-1027.401) * (-1020.581) (-1020.514) [-1017.074] (-1020.604) -- 0:00:23
629000 -- (-1018.633) (-1017.216) (-1018.307) [-1017.860] * (-1018.112) [-1021.117] (-1017.054) (-1019.553) -- 0:00:23
629500 -- [-1017.098] (-1018.683) (-1019.225) (-1017.196) * (-1017.585) (-1017.559) (-1016.998) [-1018.139] -- 0:00:22
630000 -- [-1018.304] (-1020.997) (-1017.824) (-1020.701) * [-1017.577] (-1017.542) (-1017.041) (-1017.123) -- 0:00:22
Average standard deviation of split frequencies: 0.010371
630500 -- [-1020.054] (-1018.976) (-1022.088) (-1018.229) * (-1017.317) [-1017.548] (-1021.068) (-1018.633) -- 0:00:22
631000 -- [-1019.670] (-1018.741) (-1024.918) (-1017.280) * (-1020.105) (-1016.868) [-1019.584] (-1019.423) -- 0:00:22
631500 -- (-1019.978) (-1019.792) [-1021.419] (-1019.478) * [-1021.220] (-1017.756) (-1019.592) (-1021.417) -- 0:00:22
632000 -- [-1018.249] (-1018.050) (-1024.962) (-1020.524) * (-1018.890) (-1021.437) (-1020.565) [-1020.485] -- 0:00:22
632500 -- (-1017.633) (-1016.676) [-1017.646] (-1016.777) * (-1022.418) (-1018.859) [-1017.653] (-1017.791) -- 0:00:22
633000 -- [-1019.460] (-1016.827) (-1019.067) (-1017.555) * (-1023.844) [-1020.891] (-1017.550) (-1019.296) -- 0:00:22
633500 -- (-1018.392) (-1016.925) (-1017.688) [-1018.522] * (-1017.719) (-1024.048) [-1018.565] (-1018.688) -- 0:00:22
634000 -- (-1022.015) (-1018.015) [-1018.292] (-1019.871) * [-1022.294] (-1018.876) (-1019.684) (-1016.870) -- 0:00:22
634500 -- [-1020.162] (-1020.971) (-1019.119) (-1018.706) * [-1019.386] (-1018.548) (-1017.742) (-1018.878) -- 0:00:22
635000 -- (-1023.063) (-1019.014) [-1019.522] (-1020.476) * (-1017.052) (-1018.910) (-1018.350) [-1018.547] -- 0:00:22
Average standard deviation of split frequencies: 0.010229
635500 -- (-1020.041) (-1021.804) [-1018.541] (-1021.490) * [-1016.780] (-1019.164) (-1018.215) (-1020.484) -- 0:00:22
636000 -- (-1017.916) (-1022.500) [-1019.149] (-1020.036) * [-1017.759] (-1020.524) (-1017.913) (-1020.400) -- 0:00:22
636500 -- (-1020.448) (-1023.430) (-1017.445) [-1018.216] * [-1018.651] (-1017.584) (-1018.614) (-1021.781) -- 0:00:22
637000 -- (-1019.503) (-1021.197) (-1017.443) [-1021.094] * (-1018.175) (-1020.259) [-1018.488] (-1020.440) -- 0:00:22
637500 -- (-1022.872) (-1020.071) (-1019.631) [-1020.774] * (-1021.632) [-1021.335] (-1016.897) (-1018.358) -- 0:00:22
638000 -- (-1033.910) (-1021.062) (-1019.711) [-1020.457] * (-1020.232) (-1022.161) (-1019.976) [-1017.356] -- 0:00:22
638500 -- [-1017.623] (-1020.524) (-1016.943) (-1018.574) * [-1019.029] (-1020.103) (-1018.270) (-1019.142) -- 0:00:22
639000 -- (-1019.834) [-1019.970] (-1017.441) (-1016.795) * [-1018.571] (-1021.906) (-1019.073) (-1017.651) -- 0:00:22
639500 -- [-1020.058] (-1021.326) (-1019.274) (-1022.526) * (-1022.857) (-1020.746) [-1018.974] (-1020.837) -- 0:00:22
640000 -- [-1021.738] (-1018.245) (-1024.529) (-1021.668) * (-1020.497) (-1018.810) (-1020.855) [-1020.235] -- 0:00:22
Average standard deviation of split frequencies: 0.009811
640500 -- (-1020.308) [-1019.662] (-1018.768) (-1020.841) * (-1018.182) (-1018.075) [-1020.773] (-1018.445) -- 0:00:22
641000 -- (-1019.414) (-1019.329) (-1018.222) [-1018.076] * (-1017.905) (-1018.828) (-1018.853) [-1018.534] -- 0:00:22
641500 -- (-1019.172) (-1017.897) (-1020.890) [-1021.343] * (-1021.527) (-1018.395) [-1018.905] (-1017.996) -- 0:00:22
642000 -- (-1020.106) [-1018.349] (-1020.032) (-1017.153) * (-1017.307) (-1017.805) [-1017.139] (-1018.834) -- 0:00:22
642500 -- [-1020.097] (-1019.028) (-1021.086) (-1018.912) * [-1016.686] (-1021.196) (-1017.469) (-1017.580) -- 0:00:22
643000 -- (-1018.328) (-1018.022) [-1022.174] (-1020.702) * (-1017.451) (-1018.203) [-1020.248] (-1017.868) -- 0:00:22
643500 -- (-1019.641) (-1017.898) [-1017.706] (-1019.686) * (-1018.433) (-1024.430) [-1020.158] (-1019.432) -- 0:00:22
644000 -- (-1017.632) (-1019.447) [-1017.294] (-1019.042) * (-1017.846) [-1020.696] (-1019.695) (-1017.357) -- 0:00:22
644500 -- (-1017.534) (-1018.454) [-1017.456] (-1023.899) * (-1020.398) (-1018.763) (-1019.637) [-1018.847] -- 0:00:22
645000 -- [-1016.968] (-1016.989) (-1020.588) (-1018.619) * (-1017.836) (-1018.529) [-1020.095] (-1017.928) -- 0:00:22
Average standard deviation of split frequencies: 0.010119
645500 -- [-1018.484] (-1017.957) (-1019.087) (-1024.918) * (-1020.640) (-1024.191) (-1023.226) [-1020.065] -- 0:00:21
646000 -- (-1019.054) [-1017.472] (-1018.372) (-1025.535) * (-1017.347) (-1023.269) [-1018.633] (-1018.191) -- 0:00:21
646500 -- (-1018.519) (-1017.988) [-1017.702] (-1020.220) * (-1019.209) (-1018.026) (-1018.943) [-1016.888] -- 0:00:21
647000 -- (-1020.200) (-1018.562) (-1019.325) [-1020.696] * (-1020.692) (-1018.506) [-1017.549] (-1016.505) -- 0:00:21
647500 -- (-1019.635) (-1021.527) (-1018.905) [-1018.662] * (-1021.054) (-1017.531) (-1017.690) [-1016.926] -- 0:00:21
648000 -- (-1017.850) (-1019.113) (-1017.694) [-1017.484] * (-1022.510) (-1017.245) (-1018.697) [-1018.025] -- 0:00:21
648500 -- (-1018.500) [-1018.817] (-1019.921) (-1021.621) * (-1019.643) [-1017.439] (-1020.517) (-1018.893) -- 0:00:21
649000 -- (-1022.769) [-1018.444] (-1019.312) (-1017.835) * [-1019.894] (-1018.024) (-1019.241) (-1021.515) -- 0:00:21
649500 -- (-1018.339) [-1017.750] (-1019.145) (-1019.385) * (-1018.721) (-1017.805) (-1018.403) [-1017.603] -- 0:00:21
650000 -- (-1017.915) (-1017.459) (-1017.988) [-1017.419] * (-1019.181) [-1019.493] (-1017.294) (-1018.554) -- 0:00:21
Average standard deviation of split frequencies: 0.009418
650500 -- (-1020.666) [-1021.323] (-1017.462) (-1017.350) * [-1020.680] (-1019.951) (-1018.189) (-1018.192) -- 0:00:21
651000 -- (-1023.378) (-1019.451) [-1018.491] (-1017.227) * (-1017.711) (-1021.714) [-1018.462] (-1021.394) -- 0:00:21
651500 -- [-1018.871] (-1019.784) (-1020.046) (-1017.128) * (-1017.722) (-1017.983) (-1017.974) [-1019.275] -- 0:00:21
652000 -- (-1020.087) (-1023.821) (-1017.430) [-1017.103] * [-1018.354] (-1023.275) (-1018.423) (-1019.570) -- 0:00:21
652500 -- (-1021.876) (-1017.080) [-1018.801] (-1018.960) * (-1019.172) (-1021.905) (-1017.637) [-1017.197] -- 0:00:21
653000 -- (-1019.371) (-1017.177) (-1019.392) [-1018.906] * (-1022.594) (-1019.259) (-1023.309) [-1018.352] -- 0:00:21
653500 -- [-1019.654] (-1018.875) (-1019.472) (-1019.471) * [-1017.209] (-1021.813) (-1021.922) (-1017.396) -- 0:00:21
654000 -- [-1017.524] (-1018.715) (-1019.178) (-1021.894) * (-1017.605) (-1019.578) [-1018.769] (-1018.625) -- 0:00:21
654500 -- [-1016.911] (-1018.725) (-1021.493) (-1016.835) * [-1020.661] (-1019.250) (-1018.099) (-1019.576) -- 0:00:21
655000 -- (-1026.459) (-1023.083) (-1021.744) [-1018.412] * (-1018.326) (-1018.394) [-1019.489] (-1017.052) -- 0:00:21
Average standard deviation of split frequencies: 0.009438
655500 -- [-1019.342] (-1019.207) (-1020.319) (-1019.264) * (-1018.121) (-1017.661) [-1019.039] (-1020.396) -- 0:00:21
656000 -- (-1018.691) (-1019.640) [-1017.623] (-1017.691) * (-1019.996) (-1018.694) (-1017.788) [-1018.772] -- 0:00:21
656500 -- (-1017.995) (-1018.226) (-1019.247) [-1021.282] * (-1020.259) (-1022.605) (-1018.403) [-1017.820] -- 0:00:21
657000 -- (-1018.793) (-1024.814) (-1022.844) [-1020.971] * (-1018.907) (-1017.772) [-1018.853] (-1017.481) -- 0:00:21
657500 -- [-1018.548] (-1020.130) (-1019.591) (-1021.984) * (-1018.970) (-1017.564) [-1017.232] (-1018.007) -- 0:00:21
658000 -- (-1017.316) [-1017.938] (-1018.965) (-1022.400) * [-1018.396] (-1023.376) (-1019.383) (-1023.238) -- 0:00:21
658500 -- (-1020.873) (-1021.052) (-1020.688) [-1019.224] * (-1023.458) [-1022.053] (-1020.065) (-1018.502) -- 0:00:21
659000 -- [-1019.334] (-1017.565) (-1022.087) (-1022.088) * [-1019.368] (-1020.762) (-1017.462) (-1019.805) -- 0:00:21
659500 -- (-1019.958) (-1017.703) [-1020.670] (-1019.214) * (-1018.586) (-1017.947) (-1017.412) [-1017.497] -- 0:00:21
660000 -- (-1018.171) (-1019.107) (-1018.740) [-1018.234] * (-1017.706) (-1020.700) [-1018.081] (-1021.069) -- 0:00:21
Average standard deviation of split frequencies: 0.009514
660500 -- (-1017.998) [-1017.664] (-1019.068) (-1022.956) * (-1019.740) [-1018.446] (-1019.147) (-1018.200) -- 0:00:21
661000 -- [-1018.136] (-1022.247) (-1019.811) (-1020.012) * (-1022.667) (-1018.327) (-1020.063) [-1018.372] -- 0:00:21
661500 -- [-1017.800] (-1021.995) (-1022.452) (-1018.262) * (-1018.393) (-1020.403) [-1018.452] (-1017.477) -- 0:00:20
662000 -- (-1020.324) (-1020.148) [-1016.963] (-1020.024) * (-1018.847) [-1018.802] (-1019.517) (-1018.429) -- 0:00:20
662500 -- [-1018.662] (-1018.999) (-1018.202) (-1020.672) * (-1022.733) [-1018.725] (-1018.698) (-1020.547) -- 0:00:20
663000 -- (-1016.977) (-1020.720) [-1018.209] (-1019.946) * (-1018.686) [-1019.219] (-1023.288) (-1020.664) -- 0:00:20
663500 -- [-1018.330] (-1019.492) (-1017.195) (-1020.134) * [-1020.088] (-1018.561) (-1018.950) (-1024.806) -- 0:00:20
664000 -- [-1019.573] (-1023.249) (-1019.458) (-1018.638) * (-1019.293) (-1020.753) (-1019.951) [-1019.087] -- 0:00:20
664500 -- [-1018.957] (-1017.985) (-1019.288) (-1020.321) * (-1017.747) [-1020.338] (-1017.891) (-1017.403) -- 0:00:20
665000 -- (-1022.313) (-1016.857) [-1020.564] (-1021.068) * (-1019.722) (-1022.430) (-1017.547) [-1019.045] -- 0:00:20
Average standard deviation of split frequencies: 0.009644
665500 -- [-1020.425] (-1017.523) (-1017.067) (-1018.819) * (-1020.004) [-1017.696] (-1018.323) (-1019.157) -- 0:00:20
666000 -- (-1016.776) (-1022.611) (-1018.352) [-1017.041] * [-1017.219] (-1017.147) (-1016.921) (-1019.712) -- 0:00:20
666500 -- (-1016.809) [-1018.553] (-1019.553) (-1021.728) * [-1017.041] (-1017.874) (-1016.921) (-1021.957) -- 0:00:20
667000 -- (-1021.721) (-1018.659) [-1023.990] (-1018.832) * (-1019.522) (-1023.219) (-1016.922) [-1020.665] -- 0:00:20
667500 -- [-1020.591] (-1017.929) (-1019.019) (-1018.913) * [-1018.013] (-1022.412) (-1019.954) (-1018.894) -- 0:00:20
668000 -- [-1017.576] (-1020.017) (-1018.585) (-1018.249) * [-1018.605] (-1019.218) (-1021.090) (-1020.845) -- 0:00:20
668500 -- (-1020.039) [-1019.699] (-1018.585) (-1018.815) * (-1017.913) [-1025.054] (-1020.278) (-1018.134) -- 0:00:20
669000 -- (-1016.878) (-1017.596) [-1018.560] (-1016.785) * (-1020.175) [-1018.314] (-1021.732) (-1018.076) -- 0:00:20
669500 -- (-1017.368) (-1017.014) [-1018.591] (-1020.323) * (-1016.713) (-1017.987) (-1017.692) [-1020.034] -- 0:00:20
670000 -- (-1018.781) [-1017.372] (-1018.227) (-1021.764) * (-1017.794) (-1019.288) (-1017.642) [-1017.534] -- 0:00:20
Average standard deviation of split frequencies: 0.009044
670500 -- (-1019.941) (-1017.086) [-1018.156] (-1024.875) * [-1017.158] (-1018.553) (-1020.656) (-1019.564) -- 0:00:20
671000 -- (-1021.349) [-1017.302] (-1019.498) (-1017.243) * [-1022.300] (-1018.479) (-1021.049) (-1018.224) -- 0:00:20
671500 -- (-1018.934) (-1018.502) (-1019.354) [-1019.008] * [-1016.937] (-1018.309) (-1018.639) (-1020.283) -- 0:00:20
672000 -- (-1017.313) [-1017.163] (-1020.515) (-1020.421) * (-1016.937) [-1018.318] (-1019.749) (-1021.201) -- 0:00:20
672500 -- [-1023.803] (-1019.220) (-1018.310) (-1020.813) * [-1017.020] (-1018.348) (-1019.108) (-1020.909) -- 0:00:20
673000 -- (-1018.984) [-1019.186] (-1020.523) (-1019.497) * (-1016.552) (-1018.761) [-1018.662] (-1021.242) -- 0:00:20
673500 -- (-1017.339) (-1017.791) [-1017.126] (-1018.386) * (-1019.931) (-1018.357) [-1021.075] (-1019.683) -- 0:00:20
674000 -- [-1019.124] (-1018.733) (-1020.759) (-1019.146) * [-1024.363] (-1023.627) (-1017.684) (-1020.665) -- 0:00:20
674500 -- [-1020.293] (-1018.470) (-1025.644) (-1019.602) * (-1020.105) [-1019.710] (-1018.941) (-1017.974) -- 0:00:20
675000 -- (-1022.194) (-1019.110) (-1027.400) [-1019.219] * (-1022.553) (-1019.795) [-1018.175] (-1018.985) -- 0:00:20
Average standard deviation of split frequencies: 0.008833
675500 -- [-1019.271] (-1020.463) (-1018.376) (-1018.861) * (-1019.870) (-1020.192) [-1023.257] (-1019.847) -- 0:00:20
676000 -- (-1018.662) (-1017.841) [-1019.382] (-1019.959) * (-1018.477) (-1017.970) (-1021.287) [-1017.468] -- 0:00:20
676500 -- (-1017.579) [-1017.437] (-1018.213) (-1019.155) * (-1019.195) (-1017.911) (-1018.131) [-1019.954] -- 0:00:20
677000 -- (-1019.075) [-1017.407] (-1017.688) (-1021.900) * [-1019.859] (-1018.953) (-1018.135) (-1020.585) -- 0:00:20
677500 -- (-1018.256) [-1019.902] (-1021.351) (-1017.859) * (-1019.285) (-1017.499) (-1018.209) [-1019.339] -- 0:00:19
678000 -- [-1020.767] (-1018.831) (-1018.255) (-1024.912) * [-1019.132] (-1019.315) (-1030.384) (-1018.153) -- 0:00:19
678500 -- (-1023.389) [-1017.611] (-1018.374) (-1017.263) * (-1023.948) (-1017.675) [-1021.042] (-1023.528) -- 0:00:19
679000 -- (-1020.750) (-1017.877) [-1018.914] (-1020.971) * (-1020.088) [-1019.275] (-1018.093) (-1022.244) -- 0:00:19
679500 -- (-1020.553) (-1019.383) [-1017.202] (-1018.691) * [-1019.576] (-1021.825) (-1019.437) (-1018.478) -- 0:00:19
680000 -- [-1016.877] (-1020.557) (-1018.165) (-1021.257) * [-1021.058] (-1021.767) (-1019.388) (-1017.310) -- 0:00:19
Average standard deviation of split frequencies: 0.009003
680500 -- (-1017.404) [-1019.379] (-1018.128) (-1021.263) * [-1018.893] (-1017.946) (-1018.960) (-1018.020) -- 0:00:19
681000 -- (-1022.230) [-1020.052] (-1019.461) (-1019.107) * (-1020.472) (-1018.231) (-1019.569) [-1017.706] -- 0:00:19
681500 -- (-1020.310) [-1018.592] (-1026.818) (-1019.786) * (-1017.710) [-1019.821] (-1018.548) (-1019.334) -- 0:00:19
682000 -- [-1018.183] (-1019.251) (-1022.672) (-1019.168) * (-1017.376) (-1017.629) [-1019.786] (-1019.705) -- 0:00:19
682500 -- [-1019.705] (-1016.736) (-1017.582) (-1022.122) * (-1022.027) (-1018.768) [-1018.496] (-1018.182) -- 0:00:19
683000 -- (-1019.217) [-1018.510] (-1019.714) (-1020.509) * (-1019.521) (-1021.103) (-1018.114) [-1017.747] -- 0:00:19
683500 -- [-1019.074] (-1018.132) (-1017.827) (-1018.128) * (-1017.188) [-1017.331] (-1017.862) (-1017.789) -- 0:00:19
684000 -- (-1020.867) [-1021.013] (-1016.469) (-1019.468) * [-1018.155] (-1019.193) (-1019.047) (-1017.716) -- 0:00:19
684500 -- (-1017.820) (-1018.366) [-1018.401] (-1021.415) * (-1017.895) (-1018.925) [-1018.173] (-1017.381) -- 0:00:19
685000 -- (-1023.555) [-1018.223] (-1019.135) (-1020.642) * [-1017.115] (-1019.142) (-1019.676) (-1019.249) -- 0:00:19
Average standard deviation of split frequencies: 0.009663
685500 -- [-1021.664] (-1018.151) (-1018.650) (-1018.904) * [-1022.537] (-1019.767) (-1017.671) (-1024.801) -- 0:00:19
686000 -- [-1022.106] (-1018.433) (-1018.341) (-1019.055) * (-1018.756) (-1021.966) [-1017.473] (-1020.969) -- 0:00:19
686500 -- (-1019.179) [-1019.291] (-1019.902) (-1020.271) * (-1018.523) [-1017.272] (-1018.295) (-1018.751) -- 0:00:19
687000 -- [-1019.436] (-1017.074) (-1019.425) (-1018.290) * (-1019.348) (-1020.145) [-1017.755] (-1018.401) -- 0:00:19
687500 -- (-1017.822) (-1021.629) (-1020.619) [-1018.708] * (-1018.309) (-1020.087) [-1017.580] (-1018.324) -- 0:00:19
688000 -- [-1017.758] (-1019.988) (-1019.145) (-1017.977) * (-1024.131) (-1021.632) (-1017.372) [-1020.796] -- 0:00:19
688500 -- (-1019.649) (-1019.033) (-1019.909) [-1017.944] * [-1017.480] (-1019.201) (-1018.755) (-1022.927) -- 0:00:19
689000 -- [-1017.594] (-1021.346) (-1019.277) (-1016.848) * [-1016.679] (-1021.923) (-1019.526) (-1021.814) -- 0:00:19
689500 -- (-1020.478) [-1017.210] (-1021.176) (-1020.327) * (-1018.331) (-1024.461) [-1018.516] (-1025.654) -- 0:00:19
690000 -- (-1017.739) (-1024.916) (-1020.688) [-1018.954] * (-1019.592) (-1016.914) (-1018.018) [-1019.269] -- 0:00:19
Average standard deviation of split frequencies: 0.009513
690500 -- (-1019.433) (-1018.817) [-1018.597] (-1019.092) * [-1018.229] (-1016.951) (-1024.286) (-1019.514) -- 0:00:19
691000 -- [-1018.419] (-1019.734) (-1019.657) (-1018.821) * (-1020.534) (-1016.813) (-1020.166) [-1019.167] -- 0:00:19
691500 -- (-1022.455) (-1018.448) [-1017.469] (-1018.714) * (-1020.387) (-1016.917) [-1020.616] (-1017.945) -- 0:00:19
692000 -- (-1019.706) (-1017.947) (-1017.199) [-1017.819] * (-1023.220) (-1017.752) (-1019.567) [-1021.052] -- 0:00:19
692500 -- [-1016.644] (-1020.553) (-1019.229) (-1020.261) * (-1019.626) (-1020.807) [-1018.959] (-1021.066) -- 0:00:19
693000 -- [-1017.626] (-1021.742) (-1018.125) (-1020.607) * (-1019.908) (-1019.100) [-1020.255] (-1023.969) -- 0:00:19
693500 -- (-1019.598) (-1020.740) [-1018.510] (-1019.897) * (-1021.712) (-1019.560) (-1022.696) [-1018.779] -- 0:00:19
694000 -- [-1018.554] (-1017.669) (-1018.834) (-1023.588) * [-1019.906] (-1017.345) (-1020.694) (-1018.570) -- 0:00:18
694500 -- (-1018.483) [-1018.256] (-1017.269) (-1023.206) * [-1017.412] (-1017.665) (-1020.258) (-1021.770) -- 0:00:18
695000 -- (-1021.802) [-1017.606] (-1018.758) (-1017.378) * [-1019.015] (-1017.641) (-1016.801) (-1018.296) -- 0:00:18
Average standard deviation of split frequencies: 0.008805
695500 -- (-1020.629) (-1020.891) [-1018.497] (-1017.290) * (-1019.850) [-1020.980] (-1016.848) (-1021.785) -- 0:00:18
696000 -- [-1017.344] (-1021.447) (-1020.474) (-1019.403) * (-1019.161) (-1020.229) [-1018.232] (-1017.809) -- 0:00:18
696500 -- (-1018.106) (-1021.184) [-1017.434] (-1020.697) * (-1017.630) (-1020.577) [-1018.486] (-1017.383) -- 0:00:18
697000 -- (-1021.233) (-1021.159) (-1016.945) [-1017.605] * [-1018.834] (-1017.111) (-1020.805) (-1019.856) -- 0:00:18
697500 -- (-1017.174) (-1017.534) [-1018.312] (-1018.851) * (-1019.479) [-1020.713] (-1020.810) (-1019.162) -- 0:00:18
698000 -- [-1026.384] (-1017.720) (-1021.407) (-1018.411) * (-1018.821) [-1019.117] (-1019.482) (-1018.933) -- 0:00:18
698500 -- (-1018.117) (-1017.991) [-1017.288] (-1018.091) * (-1018.584) (-1018.875) (-1018.182) [-1017.970] -- 0:00:18
699000 -- (-1019.627) (-1022.486) (-1019.401) [-1017.734] * (-1017.513) [-1017.673] (-1019.476) (-1020.183) -- 0:00:18
699500 -- (-1018.724) (-1019.667) [-1018.375] (-1018.665) * [-1018.337] (-1017.316) (-1018.101) (-1020.778) -- 0:00:18
700000 -- (-1021.789) (-1019.234) [-1020.265] (-1021.931) * (-1017.715) (-1020.050) (-1020.484) [-1017.799] -- 0:00:18
Average standard deviation of split frequencies: 0.008999
700500 -- (-1018.119) [-1018.533] (-1016.817) (-1022.558) * [-1018.132] (-1017.847) (-1021.738) (-1017.927) -- 0:00:18
701000 -- (-1017.271) [-1019.715] (-1017.895) (-1018.462) * (-1018.691) [-1019.966] (-1021.634) (-1017.065) -- 0:00:18
701500 -- (-1016.942) (-1020.590) (-1019.903) [-1019.519] * (-1022.608) (-1018.444) [-1019.146] (-1017.339) -- 0:00:18
702000 -- (-1018.329) [-1018.294] (-1018.660) (-1021.604) * (-1018.583) (-1022.688) (-1019.100) [-1020.348] -- 0:00:18
702500 -- (-1020.512) [-1020.643] (-1022.344) (-1022.925) * (-1022.190) (-1019.797) [-1018.029] (-1021.705) -- 0:00:18
703000 -- [-1017.973] (-1018.276) (-1024.844) (-1020.803) * (-1022.949) [-1016.722] (-1019.150) (-1017.038) -- 0:00:18
703500 -- (-1020.367) (-1019.070) (-1021.483) [-1017.309] * (-1022.834) [-1018.154] (-1017.086) (-1018.619) -- 0:00:18
704000 -- (-1018.628) (-1018.669) [-1020.252] (-1018.125) * (-1020.229) (-1019.748) [-1018.815] (-1018.603) -- 0:00:18
704500 -- [-1019.835] (-1018.799) (-1019.556) (-1020.604) * [-1018.067] (-1018.323) (-1018.219) (-1021.779) -- 0:00:18
705000 -- (-1024.813) [-1020.101] (-1017.463) (-1019.717) * (-1019.861) (-1024.555) (-1018.963) [-1018.769] -- 0:00:18
Average standard deviation of split frequencies: 0.009265
705500 -- (-1019.800) (-1017.525) (-1020.499) [-1017.802] * (-1017.318) (-1018.173) (-1019.452) [-1019.993] -- 0:00:18
706000 -- (-1017.717) (-1021.809) (-1020.176) [-1019.216] * (-1018.830) [-1017.767] (-1018.566) (-1018.890) -- 0:00:18
706500 -- [-1017.567] (-1019.366) (-1022.454) (-1019.107) * (-1018.787) (-1018.221) (-1018.322) [-1017.670] -- 0:00:18
707000 -- [-1017.570] (-1018.210) (-1018.472) (-1019.661) * (-1019.409) [-1020.525] (-1017.572) (-1020.161) -- 0:00:18
707500 -- (-1022.045) [-1018.742] (-1022.094) (-1020.693) * (-1018.613) (-1017.326) (-1020.995) [-1019.107] -- 0:00:18
708000 -- (-1017.884) (-1018.754) [-1017.064] (-1018.019) * [-1019.076] (-1018.523) (-1021.734) (-1017.138) -- 0:00:18
708500 -- [-1017.796] (-1017.093) (-1018.420) (-1020.494) * (-1017.528) (-1021.108) (-1019.211) [-1017.630] -- 0:00:18
709000 -- (-1018.139) [-1016.536] (-1017.700) (-1019.329) * (-1017.893) (-1019.054) [-1019.211] (-1017.808) -- 0:00:18
709500 -- (-1019.922) [-1017.126] (-1017.283) (-1022.120) * (-1019.677) (-1025.059) [-1017.149] (-1017.847) -- 0:00:18
710000 -- (-1017.194) [-1017.261] (-1017.807) (-1019.009) * (-1019.205) [-1020.191] (-1020.468) (-1018.882) -- 0:00:17
Average standard deviation of split frequencies: 0.009452
710500 -- (-1018.367) (-1020.542) [-1024.842] (-1018.672) * (-1019.088) (-1017.214) [-1018.547] (-1017.022) -- 0:00:17
711000 -- (-1017.426) [-1017.061] (-1019.671) (-1033.197) * [-1019.163] (-1018.697) (-1018.898) (-1019.585) -- 0:00:17
711500 -- (-1017.612) (-1017.345) (-1018.434) [-1021.602] * (-1025.014) (-1017.883) [-1018.749] (-1018.998) -- 0:00:17
712000 -- (-1018.638) (-1019.628) (-1021.736) [-1017.794] * (-1031.344) (-1016.798) (-1019.753) [-1019.970] -- 0:00:17
712500 -- (-1018.750) (-1020.236) [-1020.402] (-1018.789) * (-1018.155) (-1017.620) (-1018.418) [-1020.284] -- 0:00:17
713000 -- (-1020.037) (-1021.486) (-1018.840) [-1018.932] * [-1016.544] (-1017.362) (-1017.876) (-1020.533) -- 0:00:17
713500 -- (-1019.704) (-1018.117) (-1018.410) [-1018.626] * (-1018.296) (-1018.918) [-1016.953] (-1018.030) -- 0:00:17
714000 -- [-1018.558] (-1017.768) (-1019.733) (-1018.058) * (-1017.329) [-1019.520] (-1017.793) (-1019.308) -- 0:00:17
714500 -- [-1016.881] (-1017.726) (-1018.051) (-1018.367) * (-1018.018) (-1018.368) [-1018.831] (-1019.839) -- 0:00:17
715000 -- [-1019.294] (-1018.096) (-1017.484) (-1020.556) * (-1018.797) (-1017.954) (-1019.140) [-1018.698] -- 0:00:17
Average standard deviation of split frequencies: 0.008806
715500 -- (-1019.494) (-1018.254) [-1020.231] (-1017.503) * (-1017.484) (-1019.548) [-1018.381] (-1017.272) -- 0:00:17
716000 -- [-1017.583] (-1019.408) (-1019.727) (-1018.880) * (-1018.316) (-1019.377) (-1018.670) [-1018.861] -- 0:00:17
716500 -- (-1017.184) [-1017.353] (-1018.038) (-1017.558) * (-1018.076) (-1017.762) [-1018.282] (-1023.347) -- 0:00:17
717000 -- (-1017.513) [-1017.344] (-1017.879) (-1019.695) * [-1018.714] (-1020.854) (-1024.582) (-1019.738) -- 0:00:17
717500 -- (-1019.245) [-1020.591] (-1017.412) (-1021.991) * (-1019.272) (-1017.867) [-1021.859] (-1018.870) -- 0:00:17
718000 -- [-1017.152] (-1021.543) (-1020.802) (-1021.594) * (-1017.346) (-1017.128) (-1023.294) [-1018.583] -- 0:00:17
718500 -- (-1017.277) (-1022.097) (-1017.893) [-1018.489] * [-1017.309] (-1020.267) (-1022.062) (-1018.488) -- 0:00:17
719000 -- (-1018.670) (-1019.347) (-1018.149) [-1020.360] * (-1019.034) (-1018.286) [-1020.877] (-1018.671) -- 0:00:17
719500 -- (-1019.836) [-1021.820] (-1016.892) (-1017.483) * (-1020.057) [-1017.906] (-1017.141) (-1019.598) -- 0:00:17
720000 -- (-1018.884) [-1018.095] (-1018.383) (-1020.185) * (-1022.378) (-1018.298) [-1019.056] (-1018.725) -- 0:00:17
Average standard deviation of split frequencies: 0.008381
720500 -- [-1018.316] (-1018.702) (-1019.936) (-1018.398) * [-1019.854] (-1021.040) (-1023.613) (-1019.145) -- 0:00:17
721000 -- (-1018.348) (-1017.377) [-1017.434] (-1017.484) * [-1022.012] (-1020.127) (-1022.419) (-1018.771) -- 0:00:17
721500 -- (-1017.557) [-1017.925] (-1020.346) (-1022.251) * (-1022.833) (-1018.697) [-1020.033] (-1017.450) -- 0:00:17
722000 -- (-1020.280) (-1018.654) [-1021.010] (-1024.574) * [-1019.706] (-1020.771) (-1018.543) (-1016.884) -- 0:00:17
722500 -- (-1019.140) (-1019.214) [-1018.027] (-1017.886) * (-1018.095) [-1018.554] (-1017.603) (-1018.242) -- 0:00:17
723000 -- (-1018.581) (-1022.228) (-1017.791) [-1017.867] * (-1018.929) [-1021.312] (-1017.485) (-1018.058) -- 0:00:17
723500 -- (-1019.656) [-1017.775] (-1017.521) (-1020.000) * [-1017.912] (-1018.666) (-1018.500) (-1021.646) -- 0:00:17
724000 -- (-1019.678) (-1017.647) (-1019.783) [-1017.761] * (-1020.568) (-1021.091) (-1019.365) [-1019.124] -- 0:00:17
724500 -- (-1024.076) (-1020.077) (-1023.266) [-1020.163] * (-1020.902) (-1021.108) (-1019.488) [-1017.717] -- 0:00:17
725000 -- [-1022.951] (-1021.104) (-1018.677) (-1020.119) * (-1018.183) (-1018.714) [-1017.144] (-1017.686) -- 0:00:17
Average standard deviation of split frequencies: 0.008212
725500 -- [-1021.216] (-1019.596) (-1019.252) (-1018.454) * (-1020.546) (-1021.230) [-1019.763] (-1016.906) -- 0:00:17
726000 -- (-1018.584) (-1018.118) [-1020.851] (-1017.583) * [-1021.095] (-1017.977) (-1018.547) (-1017.298) -- 0:00:16
726500 -- [-1022.456] (-1021.390) (-1019.208) (-1018.436) * (-1018.324) (-1017.864) [-1017.975] (-1017.983) -- 0:00:16
727000 -- (-1018.315) (-1017.906) (-1017.287) [-1021.419] * (-1017.292) (-1017.472) (-1017.743) [-1019.527] -- 0:00:16
727500 -- [-1019.180] (-1017.244) (-1019.093) (-1022.329) * (-1017.632) (-1020.059) (-1018.619) [-1019.238] -- 0:00:16
728000 -- (-1019.527) (-1019.681) (-1020.925) [-1017.733] * (-1019.987) (-1017.132) (-1020.342) [-1018.393] -- 0:00:16
728500 -- (-1018.474) (-1018.827) [-1018.343] (-1017.102) * (-1018.709) (-1017.081) (-1020.658) [-1019.862] -- 0:00:16
729000 -- (-1024.710) (-1019.348) (-1019.147) [-1020.827] * (-1018.962) (-1018.021) (-1028.393) [-1018.837] -- 0:00:16
729500 -- [-1024.375] (-1018.728) (-1019.302) (-1024.036) * (-1019.809) (-1017.100) [-1018.652] (-1017.313) -- 0:00:16
730000 -- (-1017.613) [-1018.682] (-1018.984) (-1021.812) * [-1020.950] (-1019.334) (-1016.680) (-1019.925) -- 0:00:16
Average standard deviation of split frequencies: 0.008266
730500 -- (-1018.677) (-1018.011) (-1019.330) [-1020.405] * (-1018.081) (-1018.190) [-1017.138] (-1017.597) -- 0:00:16
731000 -- (-1016.873) [-1017.990] (-1016.435) (-1018.190) * [-1018.244] (-1017.860) (-1017.777) (-1017.645) -- 0:00:16
731500 -- (-1018.927) (-1021.073) [-1016.429] (-1017.565) * (-1017.442) (-1017.153) (-1021.162) [-1017.736] -- 0:00:16
732000 -- (-1017.317) (-1017.227) (-1018.535) [-1022.890] * [-1017.433] (-1017.514) (-1017.521) (-1017.429) -- 0:00:16
732500 -- [-1022.531] (-1017.031) (-1017.788) (-1018.705) * [-1017.469] (-1020.974) (-1020.410) (-1019.000) -- 0:00:16
733000 -- (-1017.348) (-1017.476) [-1018.212] (-1019.960) * (-1017.667) (-1018.185) [-1017.381] (-1018.511) -- 0:00:16
733500 -- (-1020.092) (-1017.457) [-1017.840] (-1023.783) * (-1017.434) (-1021.052) (-1019.362) [-1017.608] -- 0:00:16
734000 -- (-1021.345) [-1016.659] (-1020.769) (-1018.686) * (-1018.336) (-1017.639) [-1017.495] (-1019.139) -- 0:00:16
734500 -- [-1024.830] (-1017.521) (-1021.421) (-1019.386) * (-1020.054) (-1018.782) [-1018.216] (-1018.599) -- 0:00:16
735000 -- (-1021.435) (-1016.803) [-1017.363] (-1018.850) * (-1021.703) (-1018.955) [-1021.497] (-1019.556) -- 0:00:16
Average standard deviation of split frequencies: 0.008126
735500 -- (-1017.238) (-1017.153) [-1019.129] (-1017.510) * (-1019.764) (-1018.912) (-1023.936) [-1022.669] -- 0:00:16
736000 -- [-1018.430] (-1017.679) (-1017.963) (-1018.759) * (-1018.192) (-1020.307) (-1018.049) [-1019.611] -- 0:00:16
736500 -- [-1018.735] (-1024.964) (-1022.414) (-1016.944) * (-1018.250) (-1021.746) [-1021.690] (-1017.033) -- 0:00:16
737000 -- (-1018.595) [-1017.973] (-1019.217) (-1017.286) * [-1017.979] (-1017.847) (-1021.307) (-1016.796) -- 0:00:16
737500 -- [-1020.956] (-1024.677) (-1021.581) (-1016.724) * (-1017.937) (-1017.526) (-1018.171) [-1017.706] -- 0:00:16
738000 -- (-1018.172) (-1020.299) [-1018.298] (-1018.888) * [-1017.033] (-1019.194) (-1026.393) (-1018.330) -- 0:00:16
738500 -- (-1018.734) (-1020.260) (-1020.805) [-1016.712] * (-1017.891) (-1020.456) (-1020.366) [-1017.117] -- 0:00:16
739000 -- [-1019.839] (-1019.409) (-1021.553) (-1016.712) * (-1016.787) (-1020.420) (-1018.537) [-1017.237] -- 0:00:16
739500 -- [-1024.205] (-1020.035) (-1018.982) (-1018.043) * [-1021.756] (-1024.715) (-1019.522) (-1017.554) -- 0:00:16
740000 -- [-1017.547] (-1018.500) (-1019.203) (-1018.074) * (-1017.622) [-1018.958] (-1021.320) (-1017.554) -- 0:00:16
Average standard deviation of split frequencies: 0.008354
740500 -- (-1017.697) [-1018.300] (-1024.059) (-1021.753) * (-1018.183) [-1017.565] (-1020.031) (-1018.576) -- 0:00:16
741000 -- (-1023.525) [-1020.153] (-1028.926) (-1020.353) * (-1020.132) [-1018.436] (-1016.812) (-1020.315) -- 0:00:16
741500 -- (-1023.013) [-1023.053] (-1024.997) (-1019.860) * (-1018.374) [-1019.430] (-1018.173) (-1020.290) -- 0:00:16
742000 -- (-1022.558) (-1019.708) [-1019.697] (-1019.929) * (-1016.993) (-1018.612) (-1017.115) [-1018.406] -- 0:00:15
742500 -- (-1019.134) [-1020.009] (-1019.454) (-1017.334) * (-1017.217) (-1018.451) [-1018.427] (-1019.447) -- 0:00:15
743000 -- (-1018.728) [-1016.805] (-1017.558) (-1020.118) * (-1017.486) (-1018.597) (-1019.049) [-1017.946] -- 0:00:15
743500 -- (-1023.676) (-1021.213) (-1017.914) [-1020.004] * (-1020.669) [-1017.197] (-1019.947) (-1018.439) -- 0:00:15
744000 -- [-1021.253] (-1016.986) (-1018.730) (-1018.561) * [-1017.482] (-1017.342) (-1018.045) (-1018.271) -- 0:00:15
744500 -- [-1017.467] (-1018.982) (-1018.977) (-1019.891) * (-1018.514) (-1017.006) [-1017.237] (-1017.716) -- 0:00:15
745000 -- (-1017.343) [-1019.661] (-1018.346) (-1026.452) * [-1018.897] (-1017.811) (-1019.743) (-1023.363) -- 0:00:15
Average standard deviation of split frequencies: 0.008215
745500 -- (-1018.258) (-1018.622) [-1019.170] (-1018.653) * (-1020.299) (-1016.707) (-1020.709) [-1019.938] -- 0:00:15
746000 -- (-1017.230) (-1019.964) (-1019.131) [-1019.474] * (-1018.597) (-1021.705) [-1020.411] (-1019.824) -- 0:00:15
746500 -- (-1021.836) [-1019.000] (-1018.221) (-1019.527) * (-1020.126) [-1019.219] (-1017.589) (-1017.943) -- 0:00:15
747000 -- (-1018.235) [-1018.644] (-1017.786) (-1019.311) * (-1022.145) (-1018.262) [-1019.483] (-1021.391) -- 0:00:15
747500 -- (-1018.378) (-1019.269) (-1019.853) [-1019.191] * (-1017.357) [-1018.404] (-1020.286) (-1021.810) -- 0:00:15
748000 -- (-1017.239) (-1019.633) (-1023.030) [-1018.584] * (-1017.826) (-1018.081) [-1020.325] (-1021.569) -- 0:00:15
748500 -- [-1017.798] (-1025.890) (-1017.443) (-1017.294) * (-1018.806) (-1017.861) (-1019.687) [-1018.833] -- 0:00:15
749000 -- [-1017.580] (-1020.463) (-1019.860) (-1022.048) * [-1018.537] (-1016.867) (-1020.548) (-1018.823) -- 0:00:15
749500 -- [-1018.538] (-1022.616) (-1017.813) (-1018.903) * (-1019.184) (-1019.722) [-1019.586] (-1020.075) -- 0:00:15
750000 -- (-1019.565) (-1018.862) [-1019.806] (-1019.264) * (-1018.149) (-1021.982) (-1019.453) [-1020.737] -- 0:00:15
Average standard deviation of split frequencies: 0.008866
750500 -- [-1016.982] (-1019.480) (-1018.737) (-1018.231) * (-1019.891) (-1020.457) [-1017.766] (-1018.338) -- 0:00:15
751000 -- (-1017.820) (-1019.038) (-1020.025) [-1017.871] * (-1018.106) (-1017.543) (-1017.224) [-1017.951] -- 0:00:15
751500 -- (-1017.244) [-1018.386] (-1023.911) (-1017.339) * (-1018.093) [-1018.309] (-1019.934) (-1023.434) -- 0:00:15
752000 -- (-1017.251) (-1019.776) (-1025.876) [-1017.032] * [-1018.106] (-1019.808) (-1022.023) (-1022.325) -- 0:00:15
752500 -- (-1019.384) (-1018.697) [-1020.467] (-1021.391) * (-1018.126) [-1018.748] (-1023.028) (-1018.596) -- 0:00:15
753000 -- (-1019.221) (-1016.955) [-1018.117] (-1020.219) * (-1017.100) (-1020.758) [-1021.006] (-1020.654) -- 0:00:15
753500 -- (-1018.574) [-1016.973] (-1022.075) (-1023.906) * (-1017.327) (-1019.007) [-1018.000] (-1022.273) -- 0:00:15
754000 -- (-1017.031) [-1018.887] (-1021.236) (-1018.190) * (-1017.720) [-1019.174] (-1019.920) (-1018.745) -- 0:00:15
754500 -- (-1019.466) [-1019.780] (-1017.741) (-1017.656) * (-1016.701) [-1019.189] (-1020.036) (-1017.009) -- 0:00:15
755000 -- (-1021.380) (-1021.291) [-1017.338] (-1017.481) * (-1019.391) [-1019.912] (-1022.371) (-1017.375) -- 0:00:15
Average standard deviation of split frequencies: 0.008418
755500 -- [-1016.818] (-1024.809) (-1020.184) (-1020.862) * [-1017.591] (-1019.265) (-1018.051) (-1020.117) -- 0:00:15
756000 -- (-1016.863) (-1022.408) [-1019.713] (-1021.041) * [-1018.924] (-1019.324) (-1017.357) (-1016.905) -- 0:00:15
756500 -- (-1016.865) (-1020.315) [-1018.730] (-1019.038) * [-1020.011] (-1025.705) (-1018.689) (-1018.708) -- 0:00:15
757000 -- [-1017.923] (-1020.416) (-1016.830) (-1019.219) * (-1019.166) (-1018.362) [-1017.353] (-1020.275) -- 0:00:15
757500 -- (-1018.536) (-1019.264) [-1016.959] (-1018.894) * (-1018.766) [-1017.285] (-1017.463) (-1021.465) -- 0:00:15
758000 -- (-1018.074) (-1019.937) [-1016.959] (-1018.872) * (-1018.373) (-1020.415) [-1021.881] (-1017.975) -- 0:00:15
758500 -- (-1019.339) (-1018.167) (-1019.363) [-1020.946] * [-1020.362] (-1018.535) (-1017.917) (-1018.284) -- 0:00:14
759000 -- (-1020.658) (-1019.662) [-1017.655] (-1017.173) * (-1024.691) (-1018.305) [-1017.999] (-1020.267) -- 0:00:14
759500 -- (-1022.187) [-1018.636] (-1017.318) (-1016.969) * (-1018.080) (-1018.147) [-1017.248] (-1018.835) -- 0:00:14
760000 -- (-1023.661) [-1018.093] (-1018.997) (-1021.661) * [-1017.697] (-1017.208) (-1018.651) (-1018.422) -- 0:00:14
Average standard deviation of split frequencies: 0.008521
760500 -- (-1019.379) [-1017.954] (-1020.072) (-1020.385) * (-1023.439) [-1017.500] (-1018.864) (-1018.929) -- 0:00:14
761000 -- (-1019.026) [-1017.285] (-1020.576) (-1018.711) * (-1021.152) (-1017.175) (-1019.092) [-1019.418] -- 0:00:14
761500 -- (-1019.060) [-1017.916] (-1020.185) (-1017.328) * (-1021.113) (-1017.254) [-1018.128] (-1021.412) -- 0:00:14
762000 -- (-1018.520) [-1018.142] (-1018.587) (-1019.381) * (-1027.199) [-1017.862] (-1023.002) (-1019.089) -- 0:00:14
762500 -- (-1019.211) [-1017.793] (-1018.103) (-1020.189) * (-1029.815) [-1017.995] (-1019.985) (-1017.536) -- 0:00:14
763000 -- (-1022.602) [-1016.778] (-1018.847) (-1019.353) * (-1018.593) (-1017.649) (-1016.774) [-1017.692] -- 0:00:14
763500 -- [-1018.938] (-1017.428) (-1021.839) (-1018.452) * (-1018.070) [-1018.492] (-1017.572) (-1023.003) -- 0:00:14
764000 -- (-1020.301) (-1017.133) (-1018.150) [-1017.715] * (-1018.070) (-1018.830) (-1020.374) [-1018.805] -- 0:00:14
764500 -- [-1017.906] (-1018.259) (-1020.187) (-1019.576) * [-1018.478] (-1018.987) (-1017.942) (-1018.323) -- 0:00:14
765000 -- [-1017.812] (-1018.869) (-1019.629) (-1021.146) * [-1020.100] (-1018.259) (-1018.831) (-1016.743) -- 0:00:14
Average standard deviation of split frequencies: 0.007654
765500 -- (-1022.469) (-1018.745) (-1017.468) [-1017.266] * (-1018.659) [-1019.063] (-1018.783) (-1017.429) -- 0:00:14
766000 -- (-1019.275) (-1019.352) [-1018.696] (-1018.205) * (-1021.398) [-1019.229] (-1020.021) (-1017.408) -- 0:00:14
766500 -- [-1018.712] (-1020.345) (-1018.410) (-1017.403) * (-1018.683) (-1018.402) (-1018.403) [-1019.093] -- 0:00:14
767000 -- (-1017.892) (-1018.293) (-1018.005) [-1016.840] * (-1017.592) (-1019.704) [-1018.065] (-1017.877) -- 0:00:14
767500 -- (-1018.823) [-1019.471] (-1020.718) (-1017.210) * (-1016.891) [-1021.478] (-1017.199) (-1019.166) -- 0:00:14
768000 -- (-1020.756) (-1018.662) (-1019.121) [-1018.591] * (-1018.264) (-1020.676) (-1020.071) [-1018.418] -- 0:00:14
768500 -- [-1018.393] (-1018.992) (-1019.373) (-1021.417) * (-1021.098) (-1017.875) (-1019.081) [-1020.255] -- 0:00:14
769000 -- [-1018.081] (-1017.127) (-1017.786) (-1018.651) * [-1020.591] (-1021.182) (-1019.373) (-1020.678) -- 0:00:14
769500 -- (-1021.918) (-1017.264) [-1017.212] (-1018.678) * (-1018.417) (-1018.531) [-1027.243] (-1019.003) -- 0:00:14
770000 -- (-1025.002) [-1017.570] (-1016.838) (-1020.478) * [-1018.135] (-1019.498) (-1022.319) (-1020.999) -- 0:00:14
Average standard deviation of split frequencies: 0.007646
770500 -- (-1025.890) [-1017.513] (-1018.486) (-1019.888) * (-1017.823) [-1018.588] (-1020.584) (-1019.050) -- 0:00:14
771000 -- [-1024.120] (-1018.184) (-1019.650) (-1020.694) * [-1024.717] (-1019.055) (-1020.865) (-1018.536) -- 0:00:14
771500 -- (-1020.110) [-1017.899] (-1021.052) (-1018.308) * (-1021.180) (-1019.617) (-1022.527) [-1021.695] -- 0:00:14
772000 -- [-1020.657] (-1017.899) (-1018.884) (-1018.639) * [-1019.332] (-1020.649) (-1017.593) (-1022.760) -- 0:00:14
772500 -- (-1019.946) (-1018.692) (-1018.201) [-1018.259] * [-1019.597] (-1018.968) (-1018.998) (-1024.982) -- 0:00:14
773000 -- (-1019.185) (-1019.688) [-1017.885] (-1018.422) * (-1021.095) (-1019.911) [-1017.741] (-1018.673) -- 0:00:14
773500 -- (-1017.742) (-1020.835) [-1018.874] (-1017.489) * (-1017.198) (-1019.004) [-1019.082] (-1018.553) -- 0:00:14
774000 -- (-1017.673) (-1017.000) (-1019.745) [-1021.946] * [-1017.215] (-1017.715) (-1021.374) (-1017.446) -- 0:00:14
774500 -- [-1020.258] (-1017.027) (-1020.523) (-1020.521) * (-1017.285) [-1017.234] (-1021.597) (-1017.520) -- 0:00:13
775000 -- (-1022.218) (-1018.112) [-1018.555] (-1022.009) * [-1017.396] (-1020.631) (-1020.727) (-1017.673) -- 0:00:13
Average standard deviation of split frequencies: 0.008087
775500 -- (-1018.107) (-1020.008) [-1017.936] (-1021.269) * (-1017.441) [-1020.650] (-1020.089) (-1017.639) -- 0:00:13
776000 -- (-1017.795) (-1019.502) (-1024.105) [-1023.167] * (-1019.122) (-1021.100) (-1022.019) [-1017.691] -- 0:00:13
776500 -- (-1021.014) [-1019.410] (-1017.930) (-1018.634) * (-1020.091) [-1017.624] (-1022.247) (-1018.243) -- 0:00:13
777000 -- (-1017.825) (-1019.320) [-1017.612] (-1020.552) * (-1019.907) [-1023.293] (-1017.141) (-1018.810) -- 0:00:13
777500 -- [-1018.341] (-1019.714) (-1021.988) (-1020.246) * [-1018.224] (-1020.613) (-1017.696) (-1017.126) -- 0:00:13
778000 -- (-1017.973) (-1018.173) [-1017.413] (-1019.042) * (-1017.055) (-1020.944) (-1022.791) [-1017.934] -- 0:00:13
778500 -- (-1019.059) (-1020.990) [-1019.023] (-1016.502) * (-1017.394) (-1024.094) [-1017.596] (-1021.824) -- 0:00:13
779000 -- (-1019.345) [-1023.174] (-1018.472) (-1017.779) * (-1018.183) [-1019.465] (-1018.014) (-1020.712) -- 0:00:13
779500 -- (-1018.729) (-1019.727) (-1018.382) [-1018.147] * (-1018.396) (-1019.586) [-1019.011] (-1016.673) -- 0:00:13
780000 -- [-1018.608] (-1018.367) (-1018.482) (-1027.346) * (-1017.083) (-1021.261) [-1018.669] (-1027.556) -- 0:00:13
Average standard deviation of split frequencies: 0.007699
780500 -- (-1018.645) (-1022.927) (-1019.340) [-1020.381] * (-1019.549) (-1020.499) [-1018.098] (-1019.226) -- 0:00:13
781000 -- (-1019.753) (-1023.049) [-1018.014] (-1021.310) * [-1020.322] (-1021.197) (-1017.784) (-1021.372) -- 0:00:13
781500 -- (-1017.169) (-1020.532) [-1018.021] (-1021.080) * (-1021.182) (-1017.690) (-1016.890) [-1018.879] -- 0:00:13
782000 -- (-1019.290) (-1018.105) (-1021.315) [-1023.745] * (-1018.757) [-1017.613] (-1022.467) (-1017.914) -- 0:00:13
782500 -- [-1017.759] (-1018.535) (-1018.281) (-1021.542) * (-1017.887) (-1018.337) (-1019.928) [-1018.296] -- 0:00:13
783000 -- [-1018.469] (-1018.953) (-1018.196) (-1017.736) * (-1021.127) (-1019.745) (-1022.884) [-1019.652] -- 0:00:13
783500 -- [-1017.722] (-1019.481) (-1017.656) (-1018.288) * [-1017.857] (-1022.425) (-1021.892) (-1019.870) -- 0:00:13
784000 -- [-1018.857] (-1017.081) (-1017.959) (-1022.079) * (-1018.929) [-1017.473] (-1019.680) (-1023.475) -- 0:00:13
784500 -- [-1017.920] (-1017.394) (-1017.879) (-1020.004) * (-1022.123) (-1019.101) [-1020.318] (-1020.175) -- 0:00:13
785000 -- (-1017.742) [-1018.822] (-1020.206) (-1022.091) * (-1019.278) (-1019.540) [-1022.462] (-1021.192) -- 0:00:13
Average standard deviation of split frequencies: 0.007572
785500 -- (-1019.936) (-1020.558) [-1020.490] (-1019.556) * (-1022.328) (-1017.798) (-1020.628) [-1018.934] -- 0:00:13
786000 -- (-1019.008) (-1018.127) [-1018.321] (-1021.932) * (-1018.617) [-1019.268] (-1022.873) (-1018.403) -- 0:00:13
786500 -- (-1019.983) (-1019.409) (-1018.420) [-1016.421] * [-1018.670] (-1019.298) (-1025.491) (-1019.380) -- 0:00:13
787000 -- (-1019.873) (-1027.011) [-1017.519] (-1017.061) * (-1020.885) [-1018.963] (-1022.622) (-1022.005) -- 0:00:13
787500 -- (-1020.647) (-1022.337) (-1019.545) [-1017.572] * [-1019.973] (-1023.758) (-1023.257) (-1017.070) -- 0:00:13
788000 -- [-1019.929] (-1021.594) (-1019.762) (-1018.160) * (-1019.869) (-1023.531) (-1019.859) [-1019.150] -- 0:00:13
788500 -- (-1021.140) (-1020.666) [-1016.824] (-1018.787) * (-1019.849) [-1020.854] (-1020.938) (-1019.457) -- 0:00:13
789000 -- (-1019.498) (-1020.097) (-1017.978) [-1017.991] * [-1017.862] (-1020.749) (-1022.599) (-1019.721) -- 0:00:13
789500 -- (-1022.604) (-1020.067) [-1018.036] (-1018.668) * (-1018.442) (-1021.300) [-1016.748] (-1019.040) -- 0:00:13
790000 -- (-1020.479) (-1017.986) (-1020.997) [-1017.526] * [-1019.896] (-1017.642) (-1021.066) (-1019.914) -- 0:00:13
Average standard deviation of split frequencies: 0.007974
790500 -- (-1019.603) (-1020.713) (-1020.305) [-1020.575] * (-1018.433) (-1017.226) (-1020.042) [-1017.369] -- 0:00:12
791000 -- [-1017.447] (-1017.540) (-1018.663) (-1017.672) * [-1018.764] (-1020.349) (-1018.515) (-1019.723) -- 0:00:12
791500 -- (-1017.474) (-1023.193) [-1018.983] (-1018.356) * (-1019.326) [-1019.078] (-1020.174) (-1019.629) -- 0:00:12
792000 -- (-1018.496) [-1018.947] (-1017.729) (-1018.474) * (-1016.596) (-1019.194) [-1017.415] (-1018.993) -- 0:00:12
792500 -- (-1017.772) (-1023.321) (-1018.255) [-1018.858] * (-1018.200) (-1017.149) [-1017.003] (-1017.499) -- 0:00:12
793000 -- (-1019.678) (-1020.350) [-1018.261] (-1018.154) * [-1018.826] (-1021.909) (-1017.952) (-1018.262) -- 0:00:12
793500 -- (-1022.154) (-1023.620) (-1018.806) [-1018.623] * (-1017.107) (-1021.758) (-1017.049) [-1017.420] -- 0:00:12
794000 -- (-1017.767) (-1019.382) [-1019.169] (-1019.451) * (-1019.505) [-1019.289] (-1022.476) (-1018.624) -- 0:00:12
794500 -- [-1018.772] (-1018.626) (-1018.711) (-1022.258) * (-1018.410) (-1021.201) [-1019.590] (-1018.984) -- 0:00:12
795000 -- (-1018.864) (-1018.068) [-1020.226] (-1019.405) * (-1017.735) (-1018.619) (-1022.283) [-1018.073] -- 0:00:12
Average standard deviation of split frequencies: 0.007810
795500 -- [-1018.745] (-1020.704) (-1021.893) (-1018.104) * (-1021.772) [-1019.442] (-1020.276) (-1018.611) -- 0:00:12
796000 -- [-1018.038] (-1021.190) (-1024.189) (-1018.278) * (-1018.518) (-1017.864) [-1018.416] (-1020.020) -- 0:00:12
796500 -- (-1022.217) [-1018.500] (-1020.490) (-1017.976) * [-1019.454] (-1017.240) (-1022.492) (-1022.655) -- 0:00:12
797000 -- [-1017.676] (-1018.033) (-1018.614) (-1020.387) * [-1020.706] (-1021.630) (-1018.110) (-1022.684) -- 0:00:12
797500 -- (-1017.519) [-1021.981] (-1019.529) (-1019.694) * (-1017.836) [-1018.244] (-1019.169) (-1020.024) -- 0:00:12
798000 -- (-1017.060) (-1018.061) (-1021.620) [-1016.966] * (-1019.020) [-1018.277] (-1019.074) (-1018.307) -- 0:00:12
798500 -- (-1017.966) (-1018.121) [-1017.812] (-1018.302) * [-1017.821] (-1017.860) (-1020.789) (-1018.896) -- 0:00:12
799000 -- (-1019.250) (-1019.058) [-1017.916] (-1017.314) * (-1018.946) [-1019.780] (-1020.924) (-1019.602) -- 0:00:12
799500 -- [-1021.014] (-1019.125) (-1017.956) (-1021.253) * [-1021.724] (-1020.029) (-1017.421) (-1018.186) -- 0:00:12
800000 -- (-1018.306) [-1018.124] (-1018.128) (-1024.046) * (-1021.659) (-1018.294) (-1017.246) [-1018.252] -- 0:00:12
Average standard deviation of split frequencies: 0.008022
800500 -- [-1019.203] (-1018.386) (-1017.834) (-1022.537) * (-1021.609) [-1017.518] (-1017.245) (-1018.846) -- 0:00:12
801000 -- [-1017.633] (-1018.810) (-1017.994) (-1019.679) * (-1020.122) (-1020.370) (-1017.255) [-1020.821] -- 0:00:12
801500 -- (-1019.681) (-1017.453) (-1017.685) [-1017.332] * (-1021.342) (-1019.711) (-1022.060) [-1018.056] -- 0:00:12
802000 -- (-1020.383) (-1019.022) [-1017.342] (-1017.124) * (-1021.199) [-1018.978] (-1017.965) (-1018.337) -- 0:00:12
802500 -- [-1018.023] (-1019.617) (-1017.404) (-1021.629) * (-1019.354) (-1021.966) (-1025.051) [-1018.259] -- 0:00:12
803000 -- (-1018.835) (-1017.512) [-1021.231] (-1020.516) * (-1020.498) (-1020.207) [-1017.494] (-1021.130) -- 0:00:12
803500 -- [-1018.250] (-1018.734) (-1019.852) (-1021.173) * (-1024.590) [-1018.875] (-1019.077) (-1021.633) -- 0:00:12
804000 -- (-1021.287) [-1017.321] (-1020.496) (-1021.120) * (-1018.950) (-1021.846) (-1023.440) [-1017.802] -- 0:00:12
804500 -- (-1017.350) (-1017.589) (-1017.116) [-1018.856] * (-1019.338) [-1018.811] (-1017.959) (-1018.373) -- 0:00:12
805000 -- [-1016.638] (-1017.438) (-1017.287) (-1018.478) * (-1016.773) (-1021.446) [-1019.356] (-1017.840) -- 0:00:12
Average standard deviation of split frequencies: 0.007713
805500 -- (-1017.222) [-1019.115] (-1019.210) (-1018.988) * (-1017.293) (-1019.168) (-1018.313) [-1021.343] -- 0:00:12
806000 -- (-1017.607) (-1018.427) [-1017.887] (-1021.347) * [-1019.643] (-1017.372) (-1018.523) (-1019.140) -- 0:00:12
806500 -- (-1019.292) [-1017.254] (-1020.844) (-1020.139) * [-1019.212] (-1019.422) (-1017.076) (-1018.657) -- 0:00:11
807000 -- [-1017.709] (-1018.127) (-1023.466) (-1020.133) * (-1020.030) (-1020.917) (-1024.360) [-1021.290] -- 0:00:11
807500 -- (-1020.456) [-1017.765] (-1025.559) (-1020.780) * (-1019.032) [-1017.563] (-1018.944) (-1020.120) -- 0:00:11
808000 -- (-1018.382) (-1020.002) (-1022.760) [-1021.183] * [-1018.173] (-1023.624) (-1020.758) (-1020.215) -- 0:00:11
808500 -- [-1016.874] (-1019.810) (-1021.315) (-1019.924) * (-1019.939) (-1020.456) [-1020.006] (-1021.162) -- 0:00:11
809000 -- [-1018.245] (-1017.276) (-1017.089) (-1020.594) * (-1019.909) [-1019.015] (-1017.171) (-1017.519) -- 0:00:11
809500 -- [-1018.278] (-1017.173) (-1020.199) (-1018.708) * (-1019.789) [-1017.229] (-1016.806) (-1017.313) -- 0:00:11
810000 -- (-1018.629) [-1016.493] (-1020.849) (-1017.507) * (-1018.371) (-1018.774) [-1017.746] (-1021.767) -- 0:00:11
Average standard deviation of split frequencies: 0.007669
810500 -- (-1019.660) (-1017.570) [-1017.911] (-1018.050) * (-1016.901) [-1018.031] (-1018.997) (-1022.877) -- 0:00:11
811000 -- [-1021.310] (-1018.076) (-1019.624) (-1017.796) * (-1018.455) (-1018.153) [-1021.801] (-1024.091) -- 0:00:11
811500 -- [-1016.529] (-1018.666) (-1021.606) (-1019.914) * [-1017.716] (-1018.945) (-1018.848) (-1018.114) -- 0:00:11
812000 -- (-1020.360) (-1017.915) (-1021.679) [-1019.573] * (-1019.336) [-1020.259] (-1018.680) (-1017.801) -- 0:00:11
812500 -- (-1017.135) (-1018.380) (-1029.726) [-1020.609] * [-1018.392] (-1017.987) (-1017.971) (-1018.592) -- 0:00:11
813000 -- (-1020.469) (-1020.740) (-1020.910) [-1017.871] * (-1019.292) (-1020.644) [-1019.614] (-1016.580) -- 0:00:11
813500 -- [-1017.737] (-1017.219) (-1022.414) (-1020.051) * (-1018.488) [-1017.725] (-1021.971) (-1018.347) -- 0:00:11
814000 -- (-1018.773) [-1019.078] (-1018.174) (-1018.624) * (-1020.334) [-1018.394] (-1019.701) (-1019.981) -- 0:00:11
814500 -- [-1018.314] (-1022.328) (-1021.034) (-1022.114) * (-1019.030) (-1020.646) (-1021.762) [-1021.365] -- 0:00:11
815000 -- [-1017.615] (-1018.778) (-1019.202) (-1023.091) * (-1018.626) [-1017.774] (-1020.357) (-1019.577) -- 0:00:11
Average standard deviation of split frequencies: 0.007402
815500 -- [-1017.736] (-1017.117) (-1017.630) (-1025.000) * (-1018.124) (-1018.477) (-1020.090) [-1018.707] -- 0:00:11
816000 -- [-1017.978] (-1017.313) (-1017.904) (-1021.294) * (-1017.591) [-1021.035] (-1022.835) (-1021.396) -- 0:00:11
816500 -- (-1019.623) [-1019.032] (-1017.100) (-1022.361) * [-1017.341] (-1018.499) (-1019.018) (-1020.099) -- 0:00:11
817000 -- (-1019.146) (-1021.939) (-1017.619) [-1021.317] * [-1019.983] (-1018.812) (-1017.255) (-1018.977) -- 0:00:11
817500 -- (-1017.583) [-1016.938] (-1018.120) (-1020.619) * (-1024.544) (-1018.452) [-1017.607] (-1018.462) -- 0:00:11
818000 -- (-1019.318) [-1020.849] (-1019.149) (-1019.062) * [-1019.491] (-1025.305) (-1020.127) (-1017.727) -- 0:00:11
818500 -- (-1021.092) [-1018.773] (-1017.238) (-1018.901) * [-1016.762] (-1017.088) (-1018.056) (-1020.059) -- 0:00:11
819000 -- (-1018.841) [-1018.190] (-1018.336) (-1020.993) * [-1017.671] (-1019.042) (-1018.326) (-1019.001) -- 0:00:11
819500 -- (-1018.888) (-1018.768) [-1018.336] (-1022.167) * [-1017.793] (-1021.954) (-1018.545) (-1018.538) -- 0:00:11
820000 -- (-1021.813) [-1017.241] (-1017.820) (-1019.404) * (-1018.024) (-1016.912) [-1020.923] (-1018.579) -- 0:00:11
Average standard deviation of split frequencies: 0.007396
820500 -- (-1018.476) [-1016.821] (-1020.315) (-1019.754) * (-1020.052) [-1016.723] (-1018.388) (-1017.441) -- 0:00:11
821000 -- (-1017.595) (-1019.037) (-1024.729) [-1017.681] * [-1020.439] (-1019.401) (-1019.037) (-1016.743) -- 0:00:11
821500 -- (-1017.165) (-1022.961) [-1019.668] (-1023.690) * (-1021.238) [-1020.176] (-1018.762) (-1019.053) -- 0:00:11
822000 -- (-1017.739) (-1021.986) (-1020.878) [-1018.020] * (-1023.266) (-1019.833) [-1017.149] (-1017.857) -- 0:00:11
822500 -- [-1017.300] (-1024.116) (-1020.970) (-1019.174) * [-1017.448] (-1019.923) (-1017.476) (-1019.424) -- 0:00:11
823000 -- [-1017.272] (-1025.501) (-1021.706) (-1020.439) * (-1018.526) (-1018.245) [-1018.194] (-1019.388) -- 0:00:10
823500 -- [-1017.752] (-1019.340) (-1021.733) (-1018.381) * (-1024.016) [-1020.729] (-1019.774) (-1022.009) -- 0:00:10
824000 -- (-1019.832) (-1025.522) (-1023.000) [-1018.296] * (-1020.996) [-1018.969] (-1021.100) (-1020.578) -- 0:00:10
824500 -- (-1021.138) (-1021.207) [-1017.351] (-1017.638) * (-1020.086) (-1018.363) (-1019.179) [-1020.844] -- 0:00:10
825000 -- (-1020.234) (-1018.072) [-1017.617] (-1016.996) * (-1021.101) (-1017.687) (-1019.865) [-1019.512] -- 0:00:10
Average standard deviation of split frequencies: 0.007633
825500 -- (-1018.738) [-1021.552] (-1017.305) (-1018.837) * (-1018.523) [-1018.359] (-1020.455) (-1017.353) -- 0:00:10
826000 -- [-1018.950] (-1020.472) (-1020.901) (-1017.985) * [-1017.668] (-1017.468) (-1021.899) (-1021.811) -- 0:00:10
826500 -- [-1019.894] (-1018.300) (-1019.162) (-1018.129) * (-1016.440) (-1017.758) (-1023.243) [-1017.882] -- 0:00:10
827000 -- (-1019.205) (-1018.205) (-1024.624) [-1017.765] * (-1016.704) [-1018.562] (-1020.490) (-1019.223) -- 0:00:10
827500 -- (-1017.395) [-1018.781] (-1017.248) (-1018.385) * [-1018.502] (-1021.952) (-1026.524) (-1020.550) -- 0:00:10
828000 -- (-1017.064) [-1019.279] (-1018.195) (-1019.186) * [-1019.021] (-1024.658) (-1021.425) (-1020.176) -- 0:00:10
828500 -- (-1018.572) (-1020.015) (-1023.575) [-1018.335] * (-1020.952) [-1020.485] (-1018.033) (-1019.646) -- 0:00:10
829000 -- [-1020.749] (-1016.752) (-1022.219) (-1018.795) * (-1019.884) (-1020.471) (-1019.367) [-1024.640] -- 0:00:10
829500 -- [-1016.870] (-1024.962) (-1017.142) (-1017.365) * [-1018.396] (-1018.508) (-1019.655) (-1020.594) -- 0:00:10
830000 -- (-1018.847) (-1018.300) [-1018.948] (-1018.067) * (-1019.101) (-1022.499) (-1016.563) [-1019.031] -- 0:00:10
Average standard deviation of split frequencies: 0.007803
830500 -- (-1019.681) [-1018.411] (-1017.157) (-1018.240) * (-1020.230) (-1022.616) (-1017.398) [-1019.031] -- 0:00:10
831000 -- (-1018.043) (-1017.272) (-1018.543) [-1020.647] * (-1021.956) (-1019.415) (-1016.886) [-1019.449] -- 0:00:10
831500 -- [-1019.946] (-1018.396) (-1017.924) (-1017.757) * (-1022.209) [-1019.747] (-1019.246) (-1019.089) -- 0:00:10
832000 -- (-1020.616) (-1019.323) (-1018.239) [-1020.073] * (-1023.978) [-1017.765] (-1020.445) (-1019.683) -- 0:00:10
832500 -- (-1018.216) (-1018.606) [-1016.726] (-1018.085) * (-1023.153) (-1017.337) (-1022.113) [-1020.305] -- 0:00:10
833000 -- (-1017.990) [-1017.539] (-1017.568) (-1017.735) * (-1020.856) (-1018.713) [-1017.950] (-1017.253) -- 0:00:10
833500 -- (-1019.974) (-1017.985) [-1017.754] (-1017.166) * [-1017.004] (-1024.590) (-1018.011) (-1018.214) -- 0:00:10
834000 -- (-1024.059) [-1017.710] (-1017.780) (-1018.026) * (-1018.752) (-1019.944) [-1017.612] (-1018.929) -- 0:00:10
834500 -- (-1018.422) (-1018.164) (-1020.552) [-1020.449] * (-1020.347) (-1017.185) [-1017.482] (-1018.685) -- 0:00:10
835000 -- (-1020.939) [-1017.145] (-1025.749) (-1018.719) * (-1019.372) (-1016.695) (-1018.178) [-1019.304] -- 0:00:10
Average standard deviation of split frequencies: 0.007894
835500 -- (-1027.191) (-1017.457) (-1019.621) [-1018.831] * (-1025.872) [-1016.952] (-1019.162) (-1021.184) -- 0:00:10
836000 -- (-1021.601) (-1021.056) (-1018.834) [-1017.913] * (-1019.796) (-1022.202) (-1018.405) [-1020.807] -- 0:00:10
836500 -- (-1021.524) (-1020.833) [-1017.460] (-1017.031) * [-1020.023] (-1020.880) (-1019.408) (-1018.886) -- 0:00:10
837000 -- [-1017.755] (-1018.120) (-1019.118) (-1023.267) * [-1018.559] (-1018.916) (-1020.404) (-1018.732) -- 0:00:10
837500 -- [-1017.203] (-1022.324) (-1018.459) (-1021.952) * (-1018.574) (-1019.408) [-1020.738] (-1018.083) -- 0:00:10
838000 -- [-1019.697] (-1018.162) (-1017.551) (-1020.076) * (-1019.505) (-1017.863) [-1017.450] (-1018.734) -- 0:00:10
838500 -- (-1019.476) (-1017.504) [-1018.771] (-1018.878) * (-1021.182) (-1022.242) [-1018.010] (-1019.059) -- 0:00:10
839000 -- (-1020.770) [-1017.743] (-1019.419) (-1019.179) * (-1026.862) (-1019.192) [-1019.262] (-1017.721) -- 0:00:09
839500 -- [-1019.173] (-1017.739) (-1017.546) (-1018.297) * [-1022.502] (-1019.554) (-1019.144) (-1019.869) -- 0:00:09
840000 -- (-1021.848) (-1022.288) [-1018.687] (-1018.145) * (-1018.891) (-1019.450) [-1017.734] (-1018.014) -- 0:00:09
Average standard deviation of split frequencies: 0.007991
840500 -- (-1019.040) [-1022.185] (-1016.971) (-1018.485) * (-1021.933) (-1019.640) (-1019.218) [-1018.477] -- 0:00:09
841000 -- [-1017.759] (-1025.948) (-1016.942) (-1018.199) * (-1017.671) [-1019.965] (-1019.279) (-1024.049) -- 0:00:09
841500 -- (-1019.591) (-1018.203) (-1017.240) [-1018.416] * (-1019.282) [-1019.215] (-1017.384) (-1018.828) -- 0:00:09
842000 -- (-1020.292) (-1020.091) [-1020.070] (-1020.295) * [-1020.024] (-1018.508) (-1017.681) (-1018.378) -- 0:00:09
842500 -- (-1020.046) [-1016.764] (-1017.314) (-1018.677) * [-1019.666] (-1018.344) (-1019.298) (-1018.734) -- 0:00:09
843000 -- (-1018.719) (-1018.062) (-1022.337) [-1018.070] * (-1017.774) (-1018.369) [-1018.321] (-1021.713) -- 0:00:09
843500 -- (-1017.902) [-1017.690] (-1018.361) (-1018.247) * (-1019.919) [-1017.733] (-1017.851) (-1018.980) -- 0:00:09
844000 -- [-1017.235] (-1018.238) (-1020.149) (-1018.158) * [-1017.691] (-1018.071) (-1018.017) (-1018.309) -- 0:00:09
844500 -- (-1019.035) (-1016.820) (-1020.169) [-1020.979] * [-1020.393] (-1016.698) (-1017.858) (-1021.253) -- 0:00:09
845000 -- (-1018.269) [-1017.320] (-1025.080) (-1017.557) * (-1019.710) [-1016.705] (-1021.059) (-1022.278) -- 0:00:09
Average standard deviation of split frequencies: 0.007697
845500 -- [-1018.615] (-1017.610) (-1020.501) (-1024.600) * (-1018.421) (-1019.579) [-1019.155] (-1021.154) -- 0:00:09
846000 -- (-1020.312) (-1019.965) (-1019.119) [-1017.055] * [-1019.335] (-1017.461) (-1019.482) (-1018.153) -- 0:00:09
846500 -- [-1020.017] (-1020.612) (-1019.690) (-1016.664) * (-1017.621) (-1021.472) (-1020.944) [-1019.281] -- 0:00:09
847000 -- (-1018.565) [-1017.229] (-1020.287) (-1019.096) * (-1020.041) [-1018.344] (-1021.028) (-1017.476) -- 0:00:09
847500 -- (-1026.819) (-1024.867) (-1019.581) [-1022.573] * (-1017.014) (-1019.103) (-1020.202) [-1018.716] -- 0:00:09
848000 -- [-1018.659] (-1019.169) (-1023.200) (-1021.864) * (-1017.886) (-1019.876) [-1020.639] (-1019.151) -- 0:00:09
848500 -- [-1017.953] (-1017.040) (-1017.370) (-1019.389) * (-1019.538) (-1020.689) (-1017.817) [-1020.223] -- 0:00:09
849000 -- (-1019.435) (-1017.789) [-1021.317] (-1022.397) * (-1018.839) (-1023.799) (-1018.464) [-1019.768] -- 0:00:09
849500 -- [-1016.988] (-1018.076) (-1018.126) (-1018.228) * (-1018.111) (-1020.005) [-1017.748] (-1023.681) -- 0:00:09
850000 -- [-1021.850] (-1020.700) (-1018.173) (-1019.445) * (-1019.619) [-1019.975] (-1017.032) (-1022.689) -- 0:00:09
Average standard deviation of split frequencies: 0.007724
850500 -- [-1016.888] (-1023.921) (-1019.024) (-1020.771) * (-1018.106) [-1018.273] (-1017.592) (-1021.262) -- 0:00:09
851000 -- [-1018.052] (-1018.096) (-1021.518) (-1018.340) * (-1018.330) (-1018.700) (-1018.417) [-1020.694] -- 0:00:09
851500 -- (-1017.938) (-1018.875) (-1020.423) [-1018.500] * (-1017.231) (-1022.420) (-1021.284) [-1017.905] -- 0:00:09
852000 -- [-1022.183] (-1020.720) (-1018.942) (-1019.390) * (-1022.481) (-1020.259) [-1017.054] (-1021.591) -- 0:00:09
852500 -- [-1018.741] (-1019.958) (-1019.605) (-1018.191) * (-1020.434) (-1021.688) (-1020.234) [-1019.783] -- 0:00:09
853000 -- (-1018.567) (-1022.057) [-1017.400] (-1018.824) * (-1022.052) [-1019.892] (-1020.539) (-1020.412) -- 0:00:09
853500 -- [-1017.977] (-1018.421) (-1019.657) (-1017.348) * (-1017.714) (-1017.972) (-1021.230) [-1018.548] -- 0:00:09
854000 -- (-1018.106) [-1016.854] (-1020.796) (-1017.512) * (-1019.889) [-1018.136] (-1022.010) (-1018.390) -- 0:00:09
854500 -- (-1022.477) [-1016.974] (-1023.156) (-1018.645) * (-1022.420) [-1019.086] (-1020.125) (-1020.985) -- 0:00:09
855000 -- (-1017.633) (-1018.950) [-1018.562] (-1019.118) * (-1021.671) (-1020.823) (-1019.464) [-1018.750] -- 0:00:08
Average standard deviation of split frequencies: 0.007641
855500 -- (-1017.259) (-1019.031) (-1019.532) [-1022.455] * [-1017.764] (-1020.210) (-1024.102) (-1017.609) -- 0:00:08
856000 -- (-1018.644) (-1018.938) (-1017.535) [-1019.086] * [-1022.646] (-1018.496) (-1021.428) (-1019.098) -- 0:00:08
856500 -- [-1017.390] (-1021.059) (-1018.868) (-1025.740) * (-1019.236) [-1018.348] (-1017.549) (-1017.817) -- 0:00:08
857000 -- (-1019.799) [-1019.544] (-1019.908) (-1018.849) * (-1026.054) [-1017.046] (-1017.748) (-1020.665) -- 0:00:09
857500 -- (-1018.252) (-1018.844) [-1019.939] (-1025.059) * [-1018.583] (-1017.701) (-1018.013) (-1018.301) -- 0:00:08
858000 -- (-1018.108) (-1018.227) [-1016.518] (-1019.399) * (-1023.855) (-1023.782) [-1016.865] (-1019.180) -- 0:00:08
858500 -- (-1019.823) (-1018.749) (-1018.425) [-1020.019] * (-1021.429) [-1018.656] (-1020.325) (-1024.609) -- 0:00:08
859000 -- [-1019.066] (-1020.216) (-1018.395) (-1018.030) * (-1017.755) [-1019.656] (-1021.017) (-1017.706) -- 0:00:08
859500 -- (-1017.827) (-1020.934) (-1019.839) [-1021.781] * (-1018.806) [-1018.025] (-1019.729) (-1019.549) -- 0:00:08
860000 -- (-1019.913) (-1020.011) [-1020.048] (-1022.309) * (-1019.586) [-1020.719] (-1021.658) (-1018.264) -- 0:00:08
Average standard deviation of split frequencies: 0.007497
860500 -- (-1017.305) (-1018.638) (-1019.188) [-1019.379] * [-1017.694] (-1019.754) (-1022.017) (-1019.536) -- 0:00:08
861000 -- (-1017.946) (-1019.713) [-1018.108] (-1018.001) * (-1017.937) [-1019.198] (-1018.960) (-1025.254) -- 0:00:08
861500 -- (-1020.673) (-1019.831) [-1017.980] (-1018.593) * [-1018.199] (-1018.783) (-1017.291) (-1021.738) -- 0:00:08
862000 -- [-1021.227] (-1018.379) (-1018.629) (-1018.799) * (-1025.045) [-1022.378] (-1017.687) (-1021.856) -- 0:00:08
862500 -- [-1018.724] (-1018.859) (-1024.687) (-1016.990) * [-1018.092] (-1022.517) (-1018.966) (-1017.859) -- 0:00:08
863000 -- [-1017.936] (-1018.332) (-1019.627) (-1017.322) * [-1019.096] (-1021.125) (-1017.801) (-1018.566) -- 0:00:08
863500 -- (-1018.100) (-1019.170) [-1018.610] (-1018.532) * (-1017.601) (-1018.223) (-1017.826) [-1018.146] -- 0:00:08
864000 -- (-1018.582) [-1019.005] (-1021.600) (-1018.002) * (-1018.382) (-1016.722) (-1020.384) [-1018.033] -- 0:00:08
864500 -- [-1018.067] (-1017.502) (-1025.348) (-1018.559) * (-1018.908) (-1019.142) (-1021.033) [-1017.045] -- 0:00:08
865000 -- (-1021.901) [-1016.885] (-1020.655) (-1024.570) * (-1018.344) [-1017.197] (-1027.490) (-1018.538) -- 0:00:08
Average standard deviation of split frequencies: 0.007587
865500 -- (-1019.241) [-1018.441] (-1020.880) (-1023.090) * (-1018.468) (-1017.632) [-1017.945] (-1018.573) -- 0:00:08
866000 -- (-1016.860) (-1017.795) (-1021.706) [-1018.328] * (-1018.936) (-1018.918) [-1017.054] (-1019.293) -- 0:00:08
866500 -- (-1018.414) (-1018.298) (-1016.818) [-1018.447] * [-1017.649] (-1021.027) (-1024.649) (-1020.565) -- 0:00:08
867000 -- [-1017.525] (-1020.209) (-1020.307) (-1019.713) * (-1019.165) (-1023.644) [-1017.816] (-1018.794) -- 0:00:08
867500 -- (-1020.560) (-1022.144) (-1016.625) [-1019.032] * [-1017.381] (-1018.515) (-1017.785) (-1018.951) -- 0:00:08
868000 -- (-1019.641) (-1018.097) [-1021.796] (-1017.398) * (-1021.057) (-1021.226) [-1017.863] (-1018.634) -- 0:00:08
868500 -- (-1019.318) [-1017.541] (-1018.373) (-1019.892) * (-1021.567) (-1020.265) [-1018.444] (-1022.025) -- 0:00:08
869000 -- (-1018.682) (-1016.978) [-1018.257] (-1020.057) * (-1018.777) [-1018.163] (-1018.236) (-1020.210) -- 0:00:08
869500 -- (-1018.367) [-1019.555] (-1021.130) (-1019.778) * [-1019.416] (-1018.219) (-1018.001) (-1022.019) -- 0:00:08
870000 -- [-1017.522] (-1017.619) (-1018.965) (-1020.064) * (-1023.344) [-1020.099] (-1017.967) (-1016.912) -- 0:00:08
Average standard deviation of split frequencies: 0.007715
870500 -- (-1018.187) (-1019.626) [-1019.773] (-1017.427) * (-1020.466) [-1018.527] (-1018.110) (-1018.088) -- 0:00:08
871000 -- (-1018.283) [-1018.145] (-1019.598) (-1017.775) * (-1019.342) (-1020.657) [-1016.784] (-1018.435) -- 0:00:07
871500 -- [-1018.538] (-1019.883) (-1020.106) (-1021.957) * (-1017.737) [-1022.427] (-1018.764) (-1019.934) -- 0:00:08
872000 -- (-1017.751) [-1016.786] (-1019.428) (-1017.366) * (-1018.048) [-1019.131] (-1021.334) (-1018.519) -- 0:00:08
872500 -- (-1017.805) [-1017.205] (-1018.149) (-1017.665) * (-1017.616) (-1020.300) (-1021.574) [-1018.397] -- 0:00:08
873000 -- (-1018.018) (-1021.351) [-1017.356] (-1017.681) * (-1018.533) [-1018.933] (-1019.245) (-1017.002) -- 0:00:08
873500 -- (-1020.680) [-1016.691] (-1019.343) (-1017.684) * [-1018.599] (-1018.591) (-1020.452) (-1017.004) -- 0:00:07
874000 -- (-1017.932) (-1017.408) (-1017.984) [-1017.720] * [-1019.986] (-1020.458) (-1023.002) (-1019.609) -- 0:00:07
874500 -- [-1018.338] (-1017.993) (-1018.928) (-1020.487) * (-1017.590) [-1018.155] (-1016.923) (-1017.864) -- 0:00:07
875000 -- (-1018.914) [-1018.137] (-1022.001) (-1018.277) * (-1017.960) (-1021.589) [-1018.214] (-1019.381) -- 0:00:07
Average standard deviation of split frequencies: 0.007668
875500 -- (-1020.948) [-1018.934] (-1019.321) (-1017.976) * (-1018.877) (-1021.750) [-1017.115] (-1020.181) -- 0:00:07
876000 -- (-1020.290) (-1018.211) (-1019.688) [-1017.423] * [-1017.553] (-1022.362) (-1019.412) (-1018.599) -- 0:00:07
876500 -- (-1018.617) (-1018.881) (-1018.886) [-1019.001] * (-1017.807) (-1019.287) (-1018.928) [-1020.088] -- 0:00:07
877000 -- (-1017.059) [-1017.385] (-1023.759) (-1020.037) * (-1018.296) [-1017.538] (-1019.803) (-1019.535) -- 0:00:07
877500 -- (-1017.702) (-1018.968) [-1016.885] (-1018.724) * [-1020.413] (-1018.157) (-1019.373) (-1026.777) -- 0:00:07
878000 -- [-1018.638] (-1018.797) (-1018.439) (-1017.635) * (-1018.442) (-1019.867) (-1017.862) [-1022.576] -- 0:00:07
878500 -- (-1017.922) (-1021.934) [-1019.253] (-1021.043) * [-1018.878] (-1018.085) (-1017.833) (-1021.667) -- 0:00:07
879000 -- (-1020.640) [-1021.053] (-1024.742) (-1030.696) * (-1018.336) (-1019.160) [-1017.460] (-1018.026) -- 0:00:07
879500 -- [-1020.834] (-1018.688) (-1024.252) (-1017.660) * (-1018.344) (-1017.632) (-1017.673) [-1019.678] -- 0:00:07
880000 -- (-1020.702) (-1018.158) (-1017.901) [-1018.513] * [-1019.899] (-1017.901) (-1016.697) (-1017.359) -- 0:00:07
Average standard deviation of split frequencies: 0.007851
880500 -- [-1020.010] (-1018.703) (-1018.702) (-1020.954) * [-1019.107] (-1018.236) (-1020.564) (-1018.305) -- 0:00:07
881000 -- [-1018.053] (-1017.932) (-1024.186) (-1020.333) * (-1019.584) (-1018.050) (-1019.659) [-1018.645] -- 0:00:07
881500 -- [-1021.430] (-1019.352) (-1019.558) (-1021.195) * (-1019.114) (-1018.982) (-1019.120) [-1018.626] -- 0:00:07
882000 -- (-1017.266) (-1020.192) (-1017.651) [-1020.873] * (-1019.377) (-1018.004) [-1017.644] (-1017.619) -- 0:00:07
882500 -- (-1018.426) (-1018.714) [-1017.507] (-1023.025) * [-1018.538] (-1019.273) (-1019.079) (-1017.678) -- 0:00:07
883000 -- (-1018.024) (-1017.569) (-1019.717) [-1020.096] * (-1018.888) [-1018.238] (-1021.188) (-1017.724) -- 0:00:07
883500 -- (-1019.341) (-1019.305) (-1020.327) [-1016.923] * (-1018.096) (-1017.694) [-1025.605] (-1022.247) -- 0:00:07
884000 -- [-1018.189] (-1017.037) (-1020.322) (-1019.612) * (-1019.594) [-1017.755] (-1019.367) (-1023.759) -- 0:00:07
884500 -- [-1018.766] (-1018.229) (-1018.416) (-1019.925) * (-1019.777) (-1022.683) (-1018.999) [-1022.541] -- 0:00:07
885000 -- (-1018.041) (-1018.984) (-1018.897) [-1019.717] * [-1016.772] (-1025.529) (-1018.840) (-1020.110) -- 0:00:07
Average standard deviation of split frequencies: 0.008123
885500 -- [-1019.215] (-1019.722) (-1024.446) (-1019.992) * (-1018.358) (-1020.341) [-1017.850] (-1020.000) -- 0:00:07
886000 -- [-1018.001] (-1017.040) (-1018.136) (-1022.265) * (-1016.979) (-1018.530) (-1017.117) [-1017.602] -- 0:00:07
886500 -- (-1017.551) (-1020.196) (-1020.596) [-1019.250] * (-1017.551) [-1019.464] (-1022.819) (-1020.925) -- 0:00:07
887000 -- (-1021.437) [-1018.136] (-1016.886) (-1022.232) * [-1018.510] (-1018.904) (-1022.000) (-1022.098) -- 0:00:07
887500 -- (-1017.884) (-1019.663) [-1019.454] (-1021.539) * [-1019.578] (-1025.061) (-1019.296) (-1020.671) -- 0:00:06
888000 -- (-1018.014) (-1019.949) (-1017.225) [-1018.912] * [-1019.882] (-1019.528) (-1021.116) (-1017.832) -- 0:00:07
888500 -- (-1018.552) (-1019.242) [-1017.332] (-1019.301) * (-1019.188) (-1021.675) (-1018.557) [-1024.030] -- 0:00:07
889000 -- (-1021.972) (-1022.387) (-1024.363) [-1020.243] * (-1018.550) (-1019.922) (-1018.123) [-1018.632] -- 0:00:06
889500 -- (-1019.050) [-1016.833] (-1018.732) (-1021.180) * (-1020.958) [-1018.545] (-1017.049) (-1018.841) -- 0:00:06
890000 -- (-1018.265) (-1016.965) (-1019.148) [-1021.947] * (-1019.277) [-1017.529] (-1019.940) (-1018.698) -- 0:00:06
Average standard deviation of split frequencies: 0.008468
890500 -- (-1017.690) (-1016.597) [-1018.966] (-1022.999) * [-1019.072] (-1019.850) (-1019.558) (-1018.051) -- 0:00:06
891000 -- [-1017.450] (-1019.266) (-1019.153) (-1025.815) * (-1020.190) [-1016.931] (-1020.098) (-1017.711) -- 0:00:06
891500 -- (-1016.811) (-1019.437) (-1021.684) [-1019.891] * (-1019.554) (-1016.821) (-1016.629) [-1019.573] -- 0:00:06
892000 -- (-1016.809) (-1020.593) [-1017.404] (-1018.730) * (-1022.526) [-1017.912] (-1018.310) (-1017.531) -- 0:00:06
892500 -- (-1016.652) [-1017.359] (-1018.355) (-1018.581) * (-1018.236) (-1022.485) (-1018.256) [-1017.202] -- 0:00:06
893000 -- [-1018.092] (-1017.588) (-1018.654) (-1018.528) * (-1019.104) (-1019.719) [-1019.253] (-1019.062) -- 0:00:06
893500 -- (-1020.065) (-1020.481) (-1019.283) [-1020.678] * (-1018.501) (-1020.726) [-1018.246] (-1021.084) -- 0:00:06
894000 -- (-1018.537) [-1019.156] (-1020.546) (-1018.693) * (-1020.101) (-1019.907) (-1017.239) [-1017.754] -- 0:00:06
894500 -- [-1018.054] (-1016.918) (-1017.183) (-1017.166) * (-1023.650) (-1019.424) (-1017.474) [-1017.016] -- 0:00:06
895000 -- (-1017.973) [-1018.683] (-1017.929) (-1018.401) * (-1017.805) [-1020.044] (-1016.921) (-1020.948) -- 0:00:06
Average standard deviation of split frequencies: 0.008348
895500 -- (-1018.311) [-1017.732] (-1017.686) (-1020.274) * (-1020.997) (-1019.463) [-1017.039] (-1018.748) -- 0:00:06
896000 -- [-1017.486] (-1017.377) (-1018.581) (-1019.360) * [-1019.107] (-1020.577) (-1021.741) (-1018.367) -- 0:00:06
896500 -- (-1018.040) (-1019.288) [-1021.013] (-1017.351) * [-1017.765] (-1018.692) (-1018.354) (-1017.110) -- 0:00:06
897000 -- (-1020.457) [-1020.026] (-1019.933) (-1017.411) * (-1017.540) (-1019.895) (-1018.165) [-1017.726] -- 0:00:06
897500 -- [-1018.719] (-1017.617) (-1024.394) (-1020.070) * (-1018.975) [-1020.241] (-1027.218) (-1019.805) -- 0:00:06
898000 -- [-1017.074] (-1019.564) (-1024.652) (-1017.772) * [-1019.616] (-1019.192) (-1018.196) (-1019.743) -- 0:00:06
898500 -- (-1021.403) (-1022.935) (-1021.081) [-1018.836] * [-1020.669] (-1019.244) (-1018.636) (-1019.629) -- 0:00:06
899000 -- (-1019.529) (-1023.209) (-1017.634) [-1019.905] * (-1019.643) (-1018.373) (-1019.098) [-1020.002] -- 0:00:06
899500 -- (-1019.084) [-1019.703] (-1018.443) (-1020.636) * (-1020.364) (-1019.393) (-1018.056) [-1017.832] -- 0:00:06
900000 -- (-1019.713) (-1019.391) [-1018.530] (-1017.172) * [-1018.338] (-1017.464) (-1018.264) (-1017.438) -- 0:00:06
Average standard deviation of split frequencies: 0.007886
900500 -- (-1018.790) [-1018.780] (-1020.933) (-1018.112) * (-1018.051) [-1016.836] (-1017.040) (-1023.541) -- 0:00:06
901000 -- [-1019.968] (-1016.886) (-1022.146) (-1019.999) * (-1022.036) [-1017.806] (-1019.509) (-1021.225) -- 0:00:06
901500 -- (-1018.608) (-1018.207) (-1017.386) [-1020.801] * (-1018.964) [-1018.412] (-1023.672) (-1021.749) -- 0:00:06
902000 -- [-1022.458] (-1020.413) (-1020.004) (-1019.850) * (-1018.185) [-1021.518] (-1017.454) (-1018.708) -- 0:00:06
902500 -- (-1017.694) (-1016.808) (-1017.713) [-1018.471] * (-1019.952) [-1019.956] (-1017.569) (-1018.762) -- 0:00:06
903000 -- (-1023.263) [-1021.387] (-1018.519) (-1017.280) * [-1018.381] (-1019.451) (-1021.259) (-1018.097) -- 0:00:06
903500 -- (-1018.435) (-1018.627) [-1020.630] (-1019.454) * (-1017.869) (-1020.383) (-1019.710) [-1018.116] -- 0:00:05
904000 -- (-1021.903) (-1017.016) (-1020.529) [-1018.590] * (-1021.238) [-1018.972] (-1019.884) (-1018.528) -- 0:00:06
904500 -- (-1017.055) (-1016.987) (-1020.132) [-1019.129] * (-1017.634) (-1017.669) (-1018.080) [-1018.442] -- 0:00:06
905000 -- (-1018.822) (-1016.821) [-1018.911] (-1017.478) * (-1018.824) (-1017.997) (-1020.723) [-1019.999] -- 0:00:05
Average standard deviation of split frequencies: 0.007770
905500 -- [-1020.992] (-1020.720) (-1019.559) (-1021.269) * (-1020.526) (-1020.584) (-1018.249) [-1019.500] -- 0:00:05
906000 -- (-1018.447) [-1018.770] (-1017.217) (-1019.871) * (-1021.569) (-1018.871) [-1021.379] (-1019.129) -- 0:00:05
906500 -- (-1020.117) [-1023.272] (-1018.301) (-1019.299) * [-1019.910] (-1019.057) (-1018.869) (-1021.785) -- 0:00:05
907000 -- (-1018.529) (-1018.963) [-1020.131] (-1022.237) * (-1017.414) (-1018.211) (-1020.212) [-1016.854] -- 0:00:05
907500 -- (-1019.218) (-1020.152) [-1022.821] (-1019.391) * (-1022.778) [-1017.909] (-1017.867) (-1020.407) -- 0:00:05
908000 -- (-1020.736) [-1017.019] (-1019.176) (-1017.483) * (-1021.704) (-1018.213) (-1018.079) [-1017.955] -- 0:00:05
908500 -- (-1019.046) (-1017.718) (-1019.056) [-1019.945] * (-1017.682) (-1017.076) (-1018.133) [-1017.063] -- 0:00:05
909000 -- [-1020.234] (-1017.718) (-1019.010) (-1020.489) * (-1020.093) [-1025.291] (-1018.213) (-1018.130) -- 0:00:05
909500 -- [-1018.276] (-1019.364) (-1020.460) (-1019.493) * (-1018.527) (-1021.428) (-1020.735) [-1017.315] -- 0:00:05
910000 -- (-1018.646) (-1020.365) [-1017.409] (-1020.117) * (-1020.329) [-1017.330] (-1017.906) (-1018.887) -- 0:00:05
Average standard deviation of split frequencies: 0.007834
910500 -- (-1018.341) (-1018.300) (-1020.360) [-1018.524] * [-1018.602] (-1019.500) (-1017.996) (-1017.562) -- 0:00:05
911000 -- [-1018.273] (-1020.334) (-1019.304) (-1021.672) * (-1018.175) [-1016.612] (-1018.547) (-1017.040) -- 0:00:05
911500 -- [-1021.553] (-1018.025) (-1018.524) (-1020.883) * (-1018.339) [-1022.071] (-1018.042) (-1018.833) -- 0:00:05
912000 -- (-1019.944) [-1019.692] (-1021.240) (-1020.045) * (-1021.228) [-1018.329] (-1016.903) (-1018.195) -- 0:00:05
912500 -- (-1021.396) (-1017.195) [-1023.811] (-1023.534) * (-1017.509) [-1017.673] (-1019.049) (-1017.283) -- 0:00:05
913000 -- (-1019.711) (-1017.836) [-1021.377] (-1021.070) * [-1017.341] (-1019.339) (-1021.106) (-1018.483) -- 0:00:05
913500 -- (-1019.268) [-1017.294] (-1017.604) (-1018.962) * (-1018.179) (-1019.112) [-1017.997] (-1020.788) -- 0:00:05
914000 -- (-1017.916) (-1018.516) [-1025.544] (-1019.818) * [-1018.113] (-1017.426) (-1019.467) (-1022.472) -- 0:00:05
914500 -- (-1020.091) [-1016.866] (-1023.169) (-1020.705) * (-1028.825) (-1017.412) [-1019.102] (-1023.552) -- 0:00:05
915000 -- (-1020.952) (-1017.962) [-1017.607] (-1021.117) * (-1020.973) [-1016.842] (-1020.565) (-1017.944) -- 0:00:05
Average standard deviation of split frequencies: 0.008166
915500 -- (-1020.860) (-1019.036) [-1017.178] (-1022.087) * (-1020.247) (-1017.664) (-1020.834) [-1018.031] -- 0:00:05
916000 -- (-1021.886) (-1016.968) [-1017.305] (-1022.366) * (-1018.831) [-1017.524] (-1020.325) (-1016.916) -- 0:00:05
916500 -- (-1019.975) (-1019.358) [-1020.876] (-1018.992) * (-1023.352) [-1017.440] (-1016.997) (-1016.829) -- 0:00:05
917000 -- [-1021.976] (-1019.061) (-1017.085) (-1023.445) * [-1023.457] (-1018.235) (-1020.624) (-1018.901) -- 0:00:05
917500 -- (-1024.535) (-1020.233) [-1019.192] (-1020.288) * [-1020.441] (-1016.641) (-1021.950) (-1017.923) -- 0:00:05
918000 -- [-1021.748] (-1023.697) (-1018.538) (-1018.189) * (-1020.348) (-1017.195) (-1019.668) [-1018.548] -- 0:00:05
918500 -- (-1021.845) (-1018.036) (-1020.186) [-1019.306] * (-1019.696) (-1017.219) [-1019.727] (-1023.643) -- 0:00:05
919000 -- (-1020.627) (-1021.550) [-1019.905] (-1020.610) * [-1020.668] (-1017.845) (-1019.371) (-1022.274) -- 0:00:05
919500 -- (-1017.514) [-1019.500] (-1020.004) (-1020.652) * [-1019.069] (-1016.894) (-1019.004) (-1018.586) -- 0:00:04
920000 -- (-1017.312) (-1017.973) (-1018.923) [-1018.234] * (-1018.939) [-1019.091] (-1020.124) (-1019.611) -- 0:00:04
Average standard deviation of split frequencies: 0.007885
920500 -- [-1017.511] (-1018.861) (-1018.000) (-1018.851) * (-1019.280) (-1018.318) (-1019.552) [-1020.127] -- 0:00:05
921000 -- (-1018.508) (-1019.617) [-1017.693] (-1017.663) * (-1022.225) [-1019.720] (-1021.142) (-1026.532) -- 0:00:04
921500 -- (-1019.946) [-1019.958] (-1017.577) (-1018.923) * [-1020.827] (-1024.765) (-1017.796) (-1020.539) -- 0:00:04
922000 -- (-1021.035) (-1018.387) (-1019.005) [-1019.956] * (-1018.337) (-1017.147) [-1017.504] (-1019.162) -- 0:00:04
922500 -- [-1020.100] (-1018.411) (-1020.572) (-1018.652) * (-1018.537) [-1017.134] (-1018.214) (-1022.433) -- 0:00:04
923000 -- (-1017.705) (-1016.928) [-1019.184] (-1019.308) * [-1017.364] (-1016.963) (-1019.627) (-1019.919) -- 0:00:04
923500 -- [-1017.008] (-1020.825) (-1018.226) (-1018.787) * (-1019.728) (-1019.767) [-1018.650] (-1019.304) -- 0:00:04
924000 -- (-1020.345) (-1019.531) [-1018.026] (-1018.830) * (-1022.130) (-1018.165) [-1021.154] (-1019.528) -- 0:00:04
924500 -- (-1019.522) [-1017.199] (-1021.481) (-1025.391) * (-1020.822) [-1018.002] (-1017.771) (-1025.265) -- 0:00:04
925000 -- [-1020.107] (-1016.985) (-1021.161) (-1020.421) * (-1022.055) [-1017.696] (-1018.965) (-1018.682) -- 0:00:04
Average standard deviation of split frequencies: 0.007954
925500 -- (-1017.923) (-1017.101) [-1017.253] (-1021.009) * (-1020.911) (-1020.292) [-1017.487] (-1018.004) -- 0:00:04
926000 -- (-1017.783) [-1019.467] (-1018.218) (-1018.517) * (-1020.307) (-1018.362) [-1019.610] (-1018.838) -- 0:00:04
926500 -- (-1018.118) (-1018.380) (-1019.768) [-1018.261] * (-1021.137) (-1020.748) [-1022.404] (-1019.466) -- 0:00:04
927000 -- (-1020.690) [-1018.525] (-1018.969) (-1021.360) * (-1018.476) (-1024.440) (-1017.175) [-1022.600] -- 0:00:04
927500 -- (-1020.965) (-1019.358) (-1021.208) [-1024.802] * (-1017.729) (-1019.219) [-1021.324] (-1018.837) -- 0:00:04
928000 -- [-1021.634] (-1017.466) (-1019.481) (-1025.626) * (-1019.535) (-1020.880) (-1017.774) [-1016.862] -- 0:00:04
928500 -- (-1019.655) (-1017.568) [-1020.782] (-1022.221) * [-1017.129] (-1021.953) (-1017.432) (-1019.483) -- 0:00:04
929000 -- (-1018.497) (-1017.963) [-1020.299] (-1019.896) * (-1016.505) [-1018.789] (-1027.159) (-1017.972) -- 0:00:04
929500 -- [-1018.490] (-1019.583) (-1021.117) (-1017.306) * [-1018.566] (-1022.689) (-1021.058) (-1018.292) -- 0:00:04
930000 -- (-1021.239) [-1018.589] (-1022.674) (-1018.264) * (-1018.868) (-1023.745) [-1020.966] (-1018.263) -- 0:00:04
Average standard deviation of split frequencies: 0.007408
930500 -- (-1020.601) (-1018.338) (-1020.046) [-1018.818] * [-1018.041] (-1023.630) (-1018.584) (-1020.403) -- 0:00:04
931000 -- (-1022.950) [-1019.520] (-1018.384) (-1020.313) * (-1018.207) [-1017.842] (-1018.612) (-1021.852) -- 0:00:04
931500 -- (-1020.732) (-1023.002) [-1020.070] (-1021.863) * (-1018.750) [-1020.685] (-1018.152) (-1017.503) -- 0:00:04
932000 -- (-1016.783) (-1021.201) [-1017.277] (-1020.455) * (-1019.280) [-1018.074] (-1017.557) (-1018.139) -- 0:00:04
932500 -- (-1019.262) (-1022.362) [-1017.301] (-1025.215) * [-1017.986] (-1018.799) (-1020.076) (-1021.271) -- 0:00:04
933000 -- (-1022.647) (-1019.397) [-1018.804] (-1023.493) * (-1018.245) (-1017.407) (-1021.366) [-1019.540] -- 0:00:04
933500 -- (-1020.653) (-1018.767) (-1019.359) [-1017.536] * (-1018.016) [-1019.250] (-1021.788) (-1020.187) -- 0:00:04
934000 -- [-1017.245] (-1017.360) (-1018.389) (-1017.546) * [-1018.664] (-1023.966) (-1020.728) (-1021.701) -- 0:00:04
934500 -- [-1017.101] (-1018.335) (-1019.293) (-1020.379) * [-1020.715] (-1021.622) (-1019.468) (-1018.986) -- 0:00:04
935000 -- [-1016.865] (-1020.206) (-1016.817) (-1018.925) * (-1019.401) (-1018.200) (-1019.072) [-1018.195] -- 0:00:04
Average standard deviation of split frequencies: 0.007743
935500 -- (-1020.198) (-1016.735) [-1018.703] (-1020.608) * [-1020.552] (-1018.746) (-1017.840) (-1021.566) -- 0:00:03
936000 -- [-1018.211] (-1018.726) (-1017.830) (-1017.861) * (-1017.417) [-1019.774] (-1019.172) (-1022.320) -- 0:00:03
936500 -- (-1018.450) (-1019.556) [-1017.111] (-1019.939) * (-1017.417) (-1022.421) (-1016.784) [-1018.506] -- 0:00:03
937000 -- (-1018.923) (-1018.653) (-1020.577) [-1018.752] * [-1017.411] (-1020.031) (-1018.321) (-1018.435) -- 0:00:03
937500 -- (-1019.457) (-1017.830) [-1018.266] (-1019.108) * (-1017.996) (-1019.928) (-1017.750) [-1018.511] -- 0:00:03
938000 -- (-1019.864) [-1019.254] (-1018.061) (-1016.929) * (-1020.254) (-1019.164) [-1019.557] (-1018.737) -- 0:00:03
938500 -- [-1020.757] (-1018.074) (-1021.140) (-1017.629) * (-1017.898) (-1020.403) (-1018.610) [-1019.236] -- 0:00:03
939000 -- (-1018.997) (-1023.253) [-1021.876] (-1020.212) * (-1017.833) (-1018.758) (-1019.178) [-1022.399] -- 0:00:03
939500 -- (-1017.718) (-1021.924) (-1019.665) [-1019.201] * [-1017.596] (-1019.295) (-1018.423) (-1020.902) -- 0:00:03
940000 -- (-1019.151) (-1019.176) (-1020.262) [-1019.624] * (-1017.836) (-1021.920) [-1019.826] (-1018.825) -- 0:00:03
Average standard deviation of split frequencies: 0.007392
940500 -- (-1017.753) (-1019.983) [-1019.595] (-1022.338) * [-1017.674] (-1019.377) (-1017.995) (-1020.406) -- 0:00:03
941000 -- (-1018.479) (-1022.028) (-1019.441) [-1019.308] * [-1017.328] (-1019.330) (-1017.666) (-1021.479) -- 0:00:03
941500 -- [-1018.184] (-1018.944) (-1017.662) (-1021.737) * [-1016.567] (-1018.502) (-1022.197) (-1026.629) -- 0:00:03
942000 -- (-1019.977) [-1017.699] (-1022.197) (-1019.302) * [-1017.614] (-1019.023) (-1020.268) (-1020.260) -- 0:00:03
942500 -- (-1019.071) (-1018.374) [-1018.142] (-1018.131) * [-1021.344] (-1021.843) (-1017.847) (-1022.189) -- 0:00:03
943000 -- (-1018.525) (-1016.988) [-1016.639] (-1016.877) * (-1021.753) (-1020.688) [-1017.660] (-1025.541) -- 0:00:03
943500 -- (-1020.793) (-1018.239) [-1020.520] (-1020.880) * (-1019.538) [-1020.253] (-1019.621) (-1017.607) -- 0:00:03
944000 -- (-1019.073) (-1017.113) (-1018.843) [-1021.924] * (-1018.525) [-1018.364] (-1018.482) (-1021.647) -- 0:00:03
944500 -- (-1019.018) (-1019.917) (-1024.903) [-1018.005] * (-1018.861) (-1023.326) (-1022.047) [-1019.035] -- 0:00:03
945000 -- (-1018.754) (-1019.557) [-1022.409] (-1019.928) * [-1019.345] (-1019.703) (-1018.557) (-1019.795) -- 0:00:03
Average standard deviation of split frequencies: 0.007257
945500 -- [-1019.963] (-1017.719) (-1019.735) (-1020.247) * [-1020.143] (-1018.792) (-1018.923) (-1018.073) -- 0:00:03
946000 -- (-1021.074) [-1018.979] (-1018.327) (-1019.344) * (-1018.308) (-1017.412) [-1018.876] (-1019.800) -- 0:00:03
946500 -- [-1020.731] (-1018.417) (-1019.108) (-1017.115) * (-1019.433) (-1017.172) (-1019.606) [-1017.890] -- 0:00:03
947000 -- (-1017.991) [-1017.690] (-1024.237) (-1017.483) * [-1019.014] (-1019.238) (-1022.763) (-1017.133) -- 0:00:03
947500 -- (-1018.703) (-1020.617) (-1020.768) [-1017.762] * (-1022.041) (-1023.097) (-1019.551) [-1018.743] -- 0:00:03
948000 -- [-1016.837] (-1017.485) (-1020.168) (-1017.579) * (-1018.232) (-1017.854) [-1017.009] (-1020.269) -- 0:00:03
948500 -- (-1024.403) (-1017.702) [-1018.527] (-1019.219) * [-1017.875] (-1018.100) (-1017.009) (-1019.820) -- 0:00:03
949000 -- (-1025.851) (-1022.990) [-1018.672] (-1019.227) * (-1017.152) (-1017.591) [-1016.576] (-1018.845) -- 0:00:03
949500 -- (-1020.693) [-1016.919] (-1019.066) (-1026.572) * (-1021.690) [-1017.383] (-1022.803) (-1017.736) -- 0:00:03
950000 -- [-1016.888] (-1017.705) (-1017.227) (-1019.355) * [-1017.266] (-1017.689) (-1019.225) (-1017.780) -- 0:00:03
Average standard deviation of split frequencies: 0.007140
950500 -- [-1017.702] (-1017.654) (-1018.723) (-1019.185) * [-1021.878] (-1017.765) (-1020.649) (-1017.821) -- 0:00:03
951000 -- (-1023.735) (-1018.037) (-1018.923) [-1017.231] * (-1018.450) [-1018.887] (-1022.347) (-1019.166) -- 0:00:03
951500 -- (-1020.142) (-1019.021) (-1019.799) [-1017.594] * [-1018.772] (-1018.126) (-1018.018) (-1018.926) -- 0:00:03
952000 -- (-1019.501) [-1018.496] (-1018.025) (-1022.242) * (-1019.064) [-1021.171] (-1019.583) (-1020.429) -- 0:00:02
952500 -- (-1020.323) (-1016.656) [-1020.286] (-1018.407) * (-1017.731) (-1019.652) [-1017.891] (-1019.712) -- 0:00:02
953000 -- (-1018.473) (-1016.617) (-1017.778) [-1021.013] * (-1020.456) (-1016.680) (-1017.748) [-1019.481] -- 0:00:02
953500 -- (-1017.437) [-1017.356] (-1021.118) (-1018.836) * (-1021.561) (-1017.778) [-1017.524] (-1019.996) -- 0:00:02
954000 -- (-1020.003) (-1017.475) (-1020.400) [-1026.460] * (-1019.004) (-1018.024) [-1017.286] (-1017.562) -- 0:00:02
954500 -- (-1019.034) (-1018.673) [-1017.747] (-1023.926) * [-1022.387] (-1020.724) (-1016.993) (-1018.272) -- 0:00:02
955000 -- [-1018.649] (-1018.831) (-1021.151) (-1021.508) * (-1018.862) (-1019.158) [-1017.808] (-1017.572) -- 0:00:02
Average standard deviation of split frequencies: 0.007166
955500 -- (-1017.933) (-1019.504) (-1021.143) [-1018.372] * (-1019.918) [-1019.906] (-1018.475) (-1018.455) -- 0:00:02
956000 -- [-1020.458] (-1019.340) (-1021.502) (-1018.020) * (-1017.951) (-1017.546) (-1017.831) [-1021.614] -- 0:00:02
956500 -- (-1018.680) (-1025.993) [-1018.176] (-1019.879) * (-1018.782) (-1019.561) [-1019.184] (-1018.037) -- 0:00:02
957000 -- (-1017.051) (-1020.790) [-1017.655] (-1020.574) * [-1016.604] (-1025.964) (-1021.620) (-1017.980) -- 0:00:02
957500 -- (-1017.049) (-1019.459) (-1024.655) [-1017.373] * (-1017.605) (-1018.212) [-1016.818] (-1018.282) -- 0:00:02
958000 -- (-1018.494) (-1020.366) [-1018.088] (-1018.951) * (-1018.848) (-1016.989) (-1016.934) [-1020.889] -- 0:00:02
958500 -- [-1019.935] (-1020.741) (-1022.099) (-1017.314) * (-1017.448) (-1018.709) [-1017.287] (-1017.392) -- 0:00:02
959000 -- (-1019.494) [-1019.739] (-1023.214) (-1017.270) * (-1017.591) [-1018.128] (-1017.201) (-1017.531) -- 0:00:02
959500 -- [-1017.213] (-1019.779) (-1021.797) (-1024.045) * [-1020.195] (-1022.462) (-1018.954) (-1017.022) -- 0:00:02
960000 -- (-1019.093) (-1018.133) [-1019.542] (-1020.841) * [-1018.278] (-1021.503) (-1017.807) (-1016.913) -- 0:00:02
Average standard deviation of split frequencies: 0.007361
960500 -- (-1018.162) (-1018.790) (-1020.453) [-1018.681] * (-1017.685) [-1022.143] (-1020.003) (-1017.548) -- 0:00:02
961000 -- (-1021.087) (-1020.370) (-1024.052) [-1017.549] * (-1020.953) (-1019.780) (-1018.512) [-1017.058] -- 0:00:02
961500 -- [-1017.152] (-1022.011) (-1018.388) (-1023.895) * (-1020.489) (-1018.856) [-1018.390] (-1019.824) -- 0:00:02
962000 -- [-1019.249] (-1019.808) (-1020.398) (-1027.813) * (-1026.130) (-1019.771) [-1017.917] (-1018.251) -- 0:00:02
962500 -- (-1019.251) (-1019.769) [-1017.382] (-1022.876) * (-1018.778) (-1021.602) [-1018.239] (-1021.770) -- 0:00:02
963000 -- (-1016.914) (-1019.159) (-1020.815) [-1019.215] * (-1020.131) (-1021.905) [-1019.163] (-1016.977) -- 0:00:02
963500 -- (-1019.325) [-1016.759] (-1021.142) (-1017.856) * (-1017.506) (-1019.014) (-1024.073) [-1022.564] -- 0:00:02
964000 -- (-1020.319) (-1019.213) [-1019.236] (-1021.211) * [-1017.250] (-1017.828) (-1017.526) (-1017.976) -- 0:00:02
964500 -- (-1020.512) (-1019.834) (-1020.233) [-1019.968] * (-1017.664) [-1019.887] (-1018.357) (-1020.774) -- 0:00:02
965000 -- (-1019.044) (-1020.978) (-1018.686) [-1017.423] * [-1018.433] (-1019.986) (-1018.168) (-1019.149) -- 0:00:02
Average standard deviation of split frequencies: 0.007289
965500 -- (-1020.313) [-1018.064] (-1017.438) (-1017.936) * (-1018.091) (-1019.195) [-1017.548] (-1017.764) -- 0:00:02
966000 -- (-1021.200) (-1019.490) [-1020.250] (-1018.042) * (-1019.348) (-1018.489) [-1018.054] (-1018.829) -- 0:00:02
966500 -- (-1020.428) [-1017.715] (-1019.270) (-1016.927) * (-1018.913) (-1019.069) [-1018.932] (-1019.859) -- 0:00:02
967000 -- (-1021.399) (-1017.877) [-1026.398] (-1022.566) * (-1019.402) (-1017.327) (-1017.658) [-1018.304] -- 0:00:02
967500 -- [-1017.644] (-1017.991) (-1027.150) (-1018.865) * [-1017.360] (-1019.969) (-1018.100) (-1017.395) -- 0:00:02
968000 -- (-1020.525) (-1017.709) (-1019.855) [-1022.690] * (-1021.731) [-1016.936] (-1018.271) (-1022.443) -- 0:00:01
968500 -- [-1022.597] (-1017.295) (-1018.280) (-1021.567) * (-1020.424) [-1019.881] (-1018.920) (-1018.662) -- 0:00:01
969000 -- (-1018.056) [-1019.702] (-1019.033) (-1016.737) * [-1020.235] (-1020.609) (-1019.392) (-1019.131) -- 0:00:01
969500 -- [-1016.578] (-1017.388) (-1019.242) (-1018.220) * [-1020.928] (-1019.754) (-1018.656) (-1018.314) -- 0:00:01
970000 -- [-1022.158] (-1020.559) (-1019.722) (-1017.990) * [-1018.088] (-1020.063) (-1018.932) (-1017.573) -- 0:00:01
Average standard deviation of split frequencies: 0.007163
970500 -- (-1017.747) [-1019.470] (-1020.380) (-1018.172) * (-1019.867) (-1018.598) (-1017.660) [-1017.801] -- 0:00:01
971000 -- [-1018.530] (-1017.204) (-1020.464) (-1018.365) * (-1017.643) (-1024.499) (-1018.387) [-1027.107] -- 0:00:01
971500 -- [-1018.804] (-1017.233) (-1017.959) (-1019.314) * [-1018.370] (-1020.091) (-1018.834) (-1019.850) -- 0:00:01
972000 -- [-1018.767] (-1017.460) (-1018.206) (-1019.538) * (-1018.746) (-1020.794) [-1020.147] (-1018.140) -- 0:00:01
972500 -- (-1020.638) [-1017.548] (-1018.324) (-1021.351) * (-1019.886) (-1020.479) [-1018.781] (-1018.405) -- 0:00:01
973000 -- (-1019.228) (-1019.601) [-1016.823] (-1018.614) * (-1020.395) (-1021.712) [-1018.839] (-1017.317) -- 0:00:01
973500 -- [-1018.781] (-1021.859) (-1018.596) (-1024.389) * (-1019.036) [-1019.074] (-1018.119) (-1028.384) -- 0:00:01
974000 -- (-1021.469) (-1019.560) [-1023.632] (-1018.231) * [-1018.310] (-1019.110) (-1017.192) (-1019.739) -- 0:00:01
974500 -- [-1017.977] (-1025.022) (-1018.199) (-1020.671) * (-1018.281) (-1023.798) [-1017.579] (-1020.162) -- 0:00:01
975000 -- (-1018.522) (-1023.133) (-1018.402) [-1020.087] * (-1020.940) (-1021.335) [-1018.001] (-1018.791) -- 0:00:01
Average standard deviation of split frequencies: 0.007116
975500 -- [-1018.868] (-1021.509) (-1022.314) (-1018.898) * (-1019.187) (-1021.891) (-1019.003) [-1018.021] -- 0:00:01
976000 -- (-1018.734) (-1019.913) [-1022.200] (-1017.338) * (-1020.477) (-1017.734) (-1019.725) [-1019.757] -- 0:00:01
976500 -- (-1025.398) (-1020.924) [-1019.874] (-1019.427) * [-1019.349] (-1023.617) (-1019.236) (-1021.743) -- 0:00:01
977000 -- (-1024.278) (-1019.356) (-1018.529) [-1018.613] * (-1018.393) [-1023.806] (-1018.493) (-1021.289) -- 0:00:01
977500 -- (-1018.902) (-1018.442) [-1019.177] (-1018.932) * (-1020.081) (-1021.391) [-1020.355] (-1022.199) -- 0:00:01
978000 -- (-1017.338) (-1019.545) (-1020.306) [-1019.068] * [-1021.368] (-1017.168) (-1018.704) (-1020.660) -- 0:00:01
978500 -- (-1017.528) (-1019.037) [-1022.323] (-1019.071) * (-1020.563) (-1017.455) [-1019.782] (-1018.177) -- 0:00:01
979000 -- (-1020.192) (-1019.350) (-1018.557) [-1020.384] * [-1018.683] (-1022.569) (-1019.148) (-1021.112) -- 0:00:01
979500 -- (-1018.425) [-1020.555] (-1017.659) (-1021.626) * (-1019.102) [-1019.555] (-1017.750) (-1018.869) -- 0:00:01
980000 -- [-1018.381] (-1019.123) (-1019.973) (-1017.222) * (-1018.808) (-1020.400) (-1018.942) [-1022.336] -- 0:00:01
Average standard deviation of split frequencies: 0.007627
980500 -- (-1017.301) [-1024.214] (-1019.163) (-1017.573) * (-1019.283) (-1019.601) (-1017.753) [-1019.717] -- 0:00:01
981000 -- (-1017.694) [-1020.354] (-1019.767) (-1017.269) * (-1020.535) (-1016.961) [-1017.596] (-1019.748) -- 0:00:01
981500 -- [-1017.603] (-1018.689) (-1020.142) (-1018.025) * (-1018.400) (-1017.919) [-1018.460] (-1019.413) -- 0:00:01
982000 -- (-1017.529) (-1021.331) [-1019.757] (-1021.180) * [-1018.322] (-1017.838) (-1018.035) (-1017.251) -- 0:00:01
982500 -- [-1024.629] (-1017.344) (-1018.337) (-1020.558) * (-1017.962) (-1020.033) (-1017.302) [-1018.962] -- 0:00:01
983000 -- (-1018.242) [-1020.912] (-1018.043) (-1019.184) * (-1018.790) (-1018.717) (-1018.934) [-1017.637] -- 0:00:01
983500 -- (-1018.276) [-1018.131] (-1018.979) (-1018.761) * [-1016.875] (-1021.810) (-1020.457) (-1021.267) -- 0:00:01
984000 -- [-1017.970] (-1017.925) (-1018.833) (-1018.595) * [-1020.801] (-1020.363) (-1017.451) (-1018.542) -- 0:00:00
984500 -- (-1019.145) [-1018.263] (-1018.905) (-1020.818) * (-1018.650) (-1017.834) (-1018.986) [-1021.860] -- 0:00:00
985000 -- (-1018.310) [-1019.757] (-1020.906) (-1018.166) * (-1017.539) [-1017.853] (-1020.679) (-1020.262) -- 0:00:00
Average standard deviation of split frequencies: 0.007261
985500 -- [-1019.399] (-1020.605) (-1021.356) (-1021.952) * (-1021.839) [-1019.233] (-1017.489) (-1018.923) -- 0:00:00
986000 -- (-1020.288) (-1016.509) [-1017.322] (-1021.751) * (-1018.624) (-1017.881) [-1020.362] (-1017.801) -- 0:00:00
986500 -- (-1017.526) [-1016.535] (-1020.698) (-1018.597) * (-1022.700) (-1023.989) (-1017.113) [-1017.075] -- 0:00:00
987000 -- (-1019.044) (-1016.538) [-1018.047] (-1019.075) * [-1019.865] (-1020.011) (-1016.968) (-1017.673) -- 0:00:00
987500 -- (-1019.745) (-1018.945) [-1019.343] (-1017.286) * (-1019.881) (-1020.438) (-1017.517) [-1018.253] -- 0:00:00
988000 -- (-1023.717) [-1018.977] (-1018.754) (-1020.285) * (-1023.976) (-1020.101) [-1019.487] (-1019.916) -- 0:00:00
988500 -- [-1016.841] (-1017.044) (-1018.169) (-1020.091) * (-1018.164) (-1018.286) [-1018.433] (-1018.966) -- 0:00:00
989000 -- (-1018.167) [-1020.553] (-1017.584) (-1017.471) * (-1018.163) (-1020.396) (-1018.258) [-1019.126] -- 0:00:00
989500 -- [-1022.210] (-1019.584) (-1018.478) (-1017.931) * (-1020.342) (-1020.404) (-1018.224) [-1020.477] -- 0:00:00
990000 -- [-1018.770] (-1018.343) (-1020.750) (-1020.259) * (-1017.833) (-1018.332) (-1019.820) [-1018.855] -- 0:00:00
Average standard deviation of split frequencies: 0.007487
990500 -- (-1018.692) (-1018.630) (-1018.599) [-1019.431] * (-1019.401) [-1017.920] (-1022.956) (-1019.096) -- 0:00:00
991000 -- (-1018.556) (-1019.509) (-1017.070) [-1019.680] * (-1018.628) [-1018.804] (-1018.445) (-1018.062) -- 0:00:00
991500 -- (-1020.571) (-1020.809) [-1016.727] (-1017.705) * (-1019.924) (-1017.483) (-1020.984) [-1018.214] -- 0:00:00
992000 -- [-1017.230] (-1021.156) (-1017.292) (-1018.606) * (-1018.346) (-1017.506) (-1019.409) [-1022.724] -- 0:00:00
992500 -- [-1017.426] (-1019.046) (-1018.302) (-1022.586) * (-1018.200) [-1021.263] (-1022.514) (-1018.138) -- 0:00:00
993000 -- (-1016.864) (-1020.071) [-1017.823] (-1019.083) * (-1018.036) [-1016.920] (-1017.369) (-1018.804) -- 0:00:00
993500 -- (-1018.260) (-1022.051) (-1021.977) [-1018.331] * (-1017.297) [-1020.058] (-1019.543) (-1017.596) -- 0:00:00
994000 -- (-1019.274) (-1023.835) [-1019.262] (-1019.514) * (-1017.026) (-1020.493) [-1018.299] (-1017.598) -- 0:00:00
994500 -- [-1018.314] (-1018.942) (-1017.704) (-1021.242) * (-1020.080) [-1017.985] (-1018.386) (-1018.513) -- 0:00:00
995000 -- [-1018.975] (-1018.111) (-1017.615) (-1019.847) * [-1017.879] (-1020.821) (-1021.889) (-1018.250) -- 0:00:00
Average standard deviation of split frequencies: 0.007604
995500 -- [-1019.799] (-1018.686) (-1017.960) (-1017.076) * [-1019.251] (-1020.709) (-1021.217) (-1018.435) -- 0:00:00
996000 -- (-1020.116) (-1017.577) (-1018.914) [-1018.198] * [-1016.915] (-1020.519) (-1021.151) (-1018.527) -- 0:00:00
996500 -- (-1018.333) (-1019.035) (-1019.341) [-1019.440] * (-1016.911) (-1018.228) (-1017.547) [-1019.959] -- 0:00:00
997000 -- [-1018.296] (-1020.551) (-1020.717) (-1022.177) * (-1017.876) (-1018.386) (-1018.825) [-1019.796] -- 0:00:00
997500 -- [-1017.435] (-1017.530) (-1017.932) (-1020.270) * (-1018.898) [-1018.487] (-1019.201) (-1018.680) -- 0:00:00
998000 -- (-1018.014) [-1022.013] (-1018.134) (-1018.034) * [-1021.376] (-1017.924) (-1021.294) (-1020.178) -- 0:00:00
998500 -- [-1018.892] (-1018.391) (-1018.158) (-1021.215) * (-1022.485) [-1017.926] (-1018.501) (-1018.919) -- 0:00:00
999000 -- (-1018.157) (-1020.416) [-1016.936] (-1017.971) * (-1018.830) [-1019.101] (-1019.634) (-1022.595) -- 0:00:00
999500 -- [-1018.128] (-1019.948) (-1017.488) (-1017.563) * [-1019.926] (-1018.642) (-1020.325) (-1022.722) -- 0:00:00
1000000 -- (-1017.870) [-1017.998] (-1020.207) (-1017.288) * [-1020.814] (-1019.576) (-1019.313) (-1023.584) -- 0:00:00
Average standard deviation of split frequencies: 0.007663
Analysis completed in 1 mins 2 seconds
Analysis used 61.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1016.41
Likelihood of best state for "cold" chain of run 2 was -1016.41
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 66 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
27.6 % ( 23 %) Dirichlet(Pi{all})
28.7 % ( 27 %) Slider(Pi{all})
78.8 % ( 47 %) Multiplier(Alpha{1,2})
77.7 % ( 56 %) Multiplier(Alpha{3})
21.3 % ( 23 %) Slider(Pinvar{all})
98.5 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 64 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 21 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 60 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
27.4 % ( 26 %) Dirichlet(Pi{all})
29.1 % ( 16 %) Slider(Pi{all})
78.7 % ( 41 %) Multiplier(Alpha{1,2})
77.6 % ( 48 %) Multiplier(Alpha{3})
20.5 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 28 %) Multiplier(V{all})
97.5 % ( 98 %) Nodeslider(V{all})
30.4 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166592 0.82 0.67
3 | 166564 167219 0.84
4 | 165951 166930 166744
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166865 0.82 0.67
3 | 166014 166721 0.84
4 | 166531 166676 167193
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1018.21
| 1 1 11 1 |
| 2 2 |
| 2 21 2 2 |
| 1 2 1 2 2 1 1 2 |
|1 2 1 12 1 2 2 1 * 21 2 11 1 1|
| 1* 22 2 22122 1 2 2 * 21 |
| 2 22 11 1 121 2 2 * 2 2 2 1 2 2 |
| 1 12 * 1 * 2 21 2 1 2 |
| 12 21 1 1 1 2 2|
| 1 12 1 2 1 |
|2 2* 1 11 1 12 |
| 2 2 |
| 1 |
| 1 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1019.90
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1018.17 -1021.36
2 -1018.17 -1021.37
--------------------------------------
TOTAL -1018.17 -1021.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.905153 0.092386 0.369773 1.524082 0.868701 1443.18 1469.70 1.000
r(A<->C){all} 0.183087 0.022214 0.000036 0.484401 0.147267 196.59 199.36 1.004
r(A<->G){all} 0.166040 0.019929 0.000337 0.457689 0.128301 156.47 222.50 1.004
r(A<->T){all} 0.151048 0.017158 0.000007 0.424938 0.112053 189.95 220.42 1.001
r(C<->G){all} 0.176979 0.021425 0.000072 0.474096 0.136889 205.13 231.32 1.013
r(C<->T){all} 0.160529 0.017442 0.000032 0.424880 0.128246 133.12 204.29 1.005
r(G<->T){all} 0.162316 0.017786 0.000015 0.428818 0.129973 238.23 264.87 1.007
pi(A){all} 0.217595 0.000229 0.189683 0.248446 0.217673 1227.59 1311.53 1.000
pi(C){all} 0.187093 0.000195 0.159881 0.214556 0.186912 1207.05 1307.62 1.000
pi(G){all} 0.311351 0.000273 0.280295 0.344782 0.310813 1165.63 1251.17 1.000
pi(T){all} 0.283960 0.000276 0.252141 0.316673 0.283615 1195.32 1246.63 1.001
alpha{1,2} 0.419730 0.211994 0.000140 1.328387 0.263099 1301.41 1385.37 1.000
alpha{3} 0.453390 0.239721 0.000135 1.432013 0.297066 1158.74 1208.13 1.000
pinvar{all} 0.997884 0.000006 0.993279 0.999999 0.998666 1067.61 1162.63 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- ...*.*
9 -- .***.*
10 -- ..**..
11 -- .**...
12 -- ..****
13 -- .*...*
14 -- ....**
15 -- .**.**
16 -- ...**.
17 -- .****.
18 -- .*..*.
19 -- .*.*..
20 -- ..*..*
21 -- .*.***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 462 0.153897 0.010364 0.146569 0.161226 2
8 460 0.153231 0.006595 0.148568 0.157895 2
9 450 0.149900 0.009422 0.143238 0.156562 2
10 447 0.148901 0.000471 0.148568 0.149234 2
11 439 0.146236 0.008009 0.140573 0.151899 2
12 435 0.144903 0.005182 0.141239 0.148568 2
13 434 0.144570 0.009422 0.137908 0.151233 2
14 433 0.144237 0.005182 0.140573 0.147901 2
15 427 0.142239 0.006124 0.137908 0.146569 2
16 423 0.140906 0.010835 0.133245 0.148568 2
17 423 0.140906 0.006124 0.136576 0.145237 2
18 421 0.140240 0.003298 0.137908 0.142572 2
19 394 0.131246 0.014133 0.121252 0.141239 2
20 391 0.130247 0.011777 0.121919 0.138574 2
21 387 0.128914 0.008009 0.123251 0.134577 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100876 0.010148 0.000004 0.312511 0.070477 1.000 2
length{all}[2] 0.100935 0.010462 0.000010 0.302054 0.069928 1.000 2
length{all}[3] 0.099141 0.009855 0.000015 0.300183 0.067843 1.000 2
length{all}[4] 0.102433 0.010756 0.000126 0.313168 0.070040 1.001 2
length{all}[5] 0.100200 0.010364 0.000060 0.295698 0.065705 1.000 2
length{all}[6] 0.101992 0.011268 0.000002 0.307362 0.070466 1.001 2
length{all}[7] 0.092695 0.009885 0.000003 0.298942 0.063569 0.998 2
length{all}[8] 0.102104 0.010255 0.000293 0.305623 0.068081 1.003 2
length{all}[9] 0.103918 0.010965 0.000067 0.336857 0.069417 0.999 2
length{all}[10] 0.102227 0.008591 0.000604 0.277882 0.073317 0.999 2
length{all}[11] 0.096307 0.008098 0.000139 0.279246 0.067940 1.003 2
length{all}[12] 0.101057 0.009795 0.000365 0.306317 0.069898 0.999 2
length{all}[13] 0.100393 0.008221 0.000875 0.270419 0.077795 1.002 2
length{all}[14] 0.098325 0.008627 0.000348 0.276255 0.073777 0.998 2
length{all}[15] 0.104013 0.009968 0.000199 0.318781 0.073731 0.999 2
length{all}[16] 0.092895 0.008651 0.000240 0.282156 0.065755 1.006 2
length{all}[17] 0.105586 0.011066 0.000977 0.309205 0.078684 0.998 2
length{all}[18] 0.101390 0.013631 0.000266 0.312462 0.065495 1.001 2
length{all}[19] 0.106860 0.010768 0.000315 0.311767 0.075154 1.001 2
length{all}[20] 0.098684 0.008765 0.000106 0.291708 0.066950 1.001 2
length{all}[21] 0.100872 0.009064 0.000089 0.299234 0.074504 1.000 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007663
Maximum standard deviation of split frequencies = 0.014133
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|--------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 744
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 248 / 248 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 248 / 248 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.057348 0.105278 0.053540 0.072361 0.043062 0.049213 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1070.555262
Iterating by ming2
Initial: fx= 1070.555262
x= 0.05735 0.10528 0.05354 0.07236 0.04306 0.04921 0.30000 1.30000
1 h-m-p 0.0000 0.0002 594.8818 +++ 1007.801738 m 0.0002 14 | 1/8
2 h-m-p 0.0012 0.0159 78.1444 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 546.8931 ++ 1000.241895 m 0.0000 45 | 2/8
4 h-m-p 0.0002 0.0200 65.0500 ----------.. | 2/8
5 h-m-p 0.0000 0.0000 489.2932 ++ 995.981970 m 0.0000 75 | 3/8
6 h-m-p 0.0001 0.0250 52.1234 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 423.5945 ++ 993.170391 m 0.0000 105 | 4/8
8 h-m-p 0.0001 0.0335 39.0537 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 345.4404 ++ 985.771406 m 0.0001 135 | 5/8
10 h-m-p 0.0006 0.0503 26.0193 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 244.1946 ++ 977.602011 m 0.0001 166 | 6/8
12 h-m-p 1.2203 8.0000 0.0000 ++ 977.602011 m 8.0000 177 | 6/8
13 h-m-p 0.0902 8.0000 0.0008 -----Y 977.602011 0 0.0000 195 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 977.602011 m 8.0000 211 | 6/8
15 h-m-p 0.0160 8.0000 0.0991 +++++ 977.602005 m 8.0000 227 | 6/8
16 h-m-p 0.6891 8.0000 1.1507 ++ 977.601989 m 8.0000 240 | 6/8
17 h-m-p 1.6000 8.0000 1.1889 ++ 977.601985 m 8.0000 251 | 6/8
18 h-m-p 0.7450 8.0000 12.7659 ++ 977.601967 m 8.0000 262 | 6/8
19 h-m-p 1.6000 8.0000 37.6948 ++ 977.601952 m 8.0000 273 | 6/8
20 h-m-p 1.6000 8.0000 49.5884 ++ 977.601947 m 8.0000 284 | 6/8
21 h-m-p 0.0836 0.4182 427.6669 ++ 977.601946 m 0.4182 295 | 6/8
22 h-m-p 0.0000 0.0000 228.9947
h-m-p: 0.00000000e+00 0.00000000e+00 2.28994680e+02 977.601946
.. | 6/8
23 h-m-p 0.0160 8.0000 0.0000 --------C 977.601946 0 0.0000 322 | 7/8
24 h-m-p 0.1762 8.0000 0.0000 --Y 977.601946 0 0.0028 337
Out..
lnL = -977.601946
338 lfun, 338 eigenQcodon, 2028 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.086010 0.065645 0.022524 0.043043 0.082857 0.072116 999.000000 0.882295 0.482794
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.026984
np = 9
lnL0 = -1067.078115
Iterating by ming2
Initial: fx= 1067.078115
x= 0.08601 0.06564 0.02252 0.04304 0.08286 0.07212 951.42857 0.88229 0.48279
1 h-m-p 0.0000 0.0001 578.3649 ++ 1035.591022 m 0.0001 14 | 1/9
2 h-m-p 0.0002 0.0012 159.8214 ++ 1009.612771 m 0.0012 26 | 2/9
3 h-m-p 0.0000 0.0000 14568.3177 ++ 988.071067 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0002 543.2285 ++ 982.931199 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0001 1842.0418 ++ 980.454510 m 0.0001 62 | 5/9
6 h-m-p 0.0001 0.0006 38.7713 ----------.. | 5/9
7 h-m-p 0.0000 0.0000 345.4416 ++ 978.400234 m 0.0000 94 | 6/9
8 h-m-p 0.0017 0.1698 2.4929 ------------.. | 6/9
9 h-m-p 0.0000 0.0000 245.0553 ++ 977.602012 m 0.0000 128 | 7/9
10 h-m-p 1.6000 8.0000 0.0000 Y 977.602012 0 1.6000 140 | 6/9
11 h-m-p 0.0160 8.0000 0.0016 +++++ 977.602011 m 8.0000 157 | 6/9
12 h-m-p 0.0263 0.9018 0.4928 +++ 977.601994 m 0.9018 173 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 +Y 977.601994 0 5.3333 189 | 7/9
14 h-m-p 1.6000 8.0000 0.0001 C 977.601994 0 1.6000 203 | 7/9
15 h-m-p 1.6000 8.0000 0.0000 --------------Y 977.601994 0 0.0000 231
Out..
lnL = -977.601994
232 lfun, 696 eigenQcodon, 2784 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.045790 0.060906 0.013481 0.047439 0.014217 0.068507 951.652405 1.099553 0.503233 0.438251 14.428020
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.008148
np = 11
lnL0 = -1023.077298
Iterating by ming2
Initial: fx= 1023.077298
x= 0.04579 0.06091 0.01348 0.04744 0.01422 0.06851 951.65240 1.09955 0.50323 0.43825 14.42802
1 h-m-p 0.0000 0.0001 345.8754 ++ 1011.306395 m 0.0001 16 | 1/11
2 h-m-p 0.0012 0.0097 24.4507 ++ 1005.024770 m 0.0097 30 | 2/11
3 h-m-p 0.0001 0.0004 195.4702 ++ 995.495537 m 0.0004 44 | 3/11
4 h-m-p 0.0004 0.0019 104.9828 ++ 992.583294 m 0.0019 58 | 4/11
5 h-m-p 0.0000 0.0001 517.2963 ++ 991.161604 m 0.0001 72 | 5/11
6 h-m-p 0.0002 0.0010 177.9625 ++ 989.606963 m 0.0010 86 | 6/11
7 h-m-p 0.0125 6.2453 18.3402 -------------.. | 6/11
8 h-m-p 0.0000 0.0003 180.3594 +++ 977.601966 m 0.0003 126 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 977.601966 m 8.0000 140 | 7/11
10 h-m-p 0.0400 8.0000 0.0010 ++++ 977.601966 m 8.0000 160 | 7/11
11 h-m-p 0.0160 8.0000 2.7863 +++++ 977.601944 m 8.0000 181 | 7/11
12 h-m-p 1.6000 8.0000 1.5515 ++ 977.601942 m 8.0000 195 | 7/11
13 h-m-p 1.6000 8.0000 3.8010 ++ 977.601941 m 8.0000 209 | 7/11
14 h-m-p 0.2724 1.3622 38.9712 ++ 977.601940 m 1.3622 223 | 7/11
15 h-m-p -0.0000 -0.0000 226.0134
h-m-p: -0.00000000e+00 -0.00000000e+00 2.26013430e+02 977.601940
.. | 7/11
16 h-m-p 0.0160 8.0000 0.0000 ++Y 977.601940 0 0.2560 250 | 7/11
17 h-m-p 1.6000 8.0000 0.0000 ---------Y 977.601940 0 0.0000 277
Out..
lnL = -977.601940
278 lfun, 1112 eigenQcodon, 5004 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -977.596344 S = -977.596161 -0.000070
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:03
did 20 / 58 patterns 0:03
did 30 / 58 patterns 0:03
did 40 / 58 patterns 0:03
did 50 / 58 patterns 0:03
did 58 / 58 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106190 0.061619 0.095342 0.102397 0.102143 0.021716 951.700036 0.576881 1.801484
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.037317
np = 9
lnL0 = -1091.933320
Iterating by ming2
Initial: fx= 1091.933320
x= 0.10619 0.06162 0.09534 0.10240 0.10214 0.02172 951.70004 0.57688 1.80148
1 h-m-p 0.0000 0.0001 545.7679 ++ 1063.834674 m 0.0001 14 | 1/9
2 h-m-p 0.0018 0.0239 26.1968 ------------.. | 1/9
3 h-m-p 0.0000 0.0002 506.4959 +++ 1017.960864 m 0.0002 49 | 2/9
4 h-m-p 0.0049 0.0387 16.0109 ------------.. | 2/9
5 h-m-p 0.0000 0.0001 471.8260 ++ 984.135074 m 0.0001 83 | 3/9
6 h-m-p 0.0148 0.2334 4.1134 -------------.. | 3/9
7 h-m-p 0.0000 0.0000 424.1650 ++ 978.749099 m 0.0000 118 | 4/9
8 h-m-p 0.0024 1.0357 4.3425 ------------.. | 4/9
9 h-m-p 0.0000 0.0000 348.7123 ++ 978.613597 m 0.0000 152 | 5/9
10 h-m-p 0.0029 1.4716 3.7757 ------------.. | 5/9
11 h-m-p 0.0000 0.0000 246.2660 ++ 977.602046 m 0.0000 186 | 6/9
12 h-m-p 0.3448 8.0000 0.0000 Y 977.602046 0 0.3448 198 | 6/9
13 h-m-p 0.5173 8.0000 0.0000 Y 977.602046 0 0.0625 213
Out..
lnL = -977.602046
214 lfun, 2354 eigenQcodon, 12840 P(t)
Time used: 0:07
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.081230 0.109345 0.066014 0.060249 0.050630 0.075207 951.700036 0.900000 0.885017 1.463806 12.897614
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.013558
np = 11
lnL0 = -1044.518906
Iterating by ming2
Initial: fx= 1044.518906
x= 0.08123 0.10934 0.06601 0.06025 0.05063 0.07521 951.70004 0.90000 0.88502 1.46381 12.89761
1 h-m-p 0.0000 0.0004 287.2004 +++ 1005.518105 m 0.0004 17 | 1/11
2 h-m-p 0.0000 0.0001 503.6186 ++ 996.558858 m 0.0001 31 | 2/11
3 h-m-p 0.0027 0.0134 14.8105 +YYYYC 993.909898 4 0.0106 50 | 2/11
4 h-m-p 0.0001 0.0007 30.0786 ++ 993.671045 m 0.0007 64 | 3/11
5 h-m-p 0.0017 0.0275 9.0102 +++ 988.217192 m 0.0275 79 | 4/11
6 h-m-p 0.0000 0.0001 6891.5953 ++ 986.790056 m 0.0001 93 | 5/11
7 h-m-p 0.0000 0.0000 3255.2768 ++ 986.603476 m 0.0000 107 | 6/11
8 h-m-p 0.0004 0.0341 39.7679 +
QuantileBeta(0.15, 0.00500, 2.19970) = 1.194319e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.92072) = 8.446189e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
+ 979.429102 m 0.0341 123
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.709578e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24910) = 7.449512e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
| 6/11
9 h-m-p 0.1854 0.9271 3.6025
QuantileBeta(0.15, 0.00500, 2.60027) = 9.712063e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.08689) = 7.910795e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.20854) = 7.559745e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.23896) = 7.476773e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24656) = 7.456313e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24846) = 7.451215e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24893) = 7.449942e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24905) = 7.449624e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24908) = 7.449544e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449524e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449519e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449518e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449518e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.709578e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24910) = 7.449512e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
| 6/11
10 h-m-p 0.0000 0.0000 246.8041
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
+ 977.602091 m 0.0000 164
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.709578e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24910) = 7.449512e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449517e-161 2000 rounds
| 7/11
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449520e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
+ 977.602091 m 8.0000 178
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.709581e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24924) = 7.449126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24894) = 7.449916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
| 7/11
12 h-m-p 0.0109 5.4470 0.3385
QuantileBeta(0.15, 0.00500, 3.24611) = 7.457508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23718) = 7.481571e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.20144) = 7.579388e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05848) = 7.997492e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.48665) = 1.025631e-160 2000 rounds
++ 977.601945 m 5.4470 199 | 8/11
13 h-m-p 0.8453 8.0000 1.8328
QuantileBeta(0.15, 0.00500, 3.24909) = 7.449521e-161 2000 rounds
-----------Y 977.601945 0 0.0000 228 | 8/11
14 h-m-p 0.0333 8.0000 0.0000 ---C 977.601945 0 0.0002 245 | 8/11
15 h-m-p 0.0263 8.0000 0.0000 C 977.601945 0 0.0066 262
Out..
lnL = -977.601945
263 lfun, 3156 eigenQcodon, 17358 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -977.597645 S = -977.596362 -0.000562
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:12
did 20 / 58 patterns 0:12
did 30 / 58 patterns 0:12
did 40 / 58 patterns 0:12
did 50 / 58 patterns 0:12
did 58 / 58 patterns 0:13
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=248
NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
NC_002677_1_NP_302729_1_1601_gidB VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
NZ_AP014567_1_WP_010909047_1_2999_rsmG VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL
**************************************************
NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
NC_002677_1_NP_302729_1_1601_gidB ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
NZ_AP014567_1_WP_010909047_1_2999_rsmG ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG
**************************************************
NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
NC_002677_1_NP_302729_1_1601_gidB LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
NZ_AP014567_1_WP_010909047_1_2999_rsmG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD
**************************************************
NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
NC_002677_1_NP_302729_1_1601_gidB RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
NZ_AP014567_1_WP_010909047_1_2999_rsmG RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR
**************************************************
NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
NC_002677_1_NP_302729_1_1601_gidB VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
NZ_AP014567_1_WP_010909047_1_2999_rsmG VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
************************************************
>NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA >NC_002677_1_NP_302729_1_1601_gidB GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA >NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA >NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA >NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA >NZ_AP014567_1_WP_010909047_1_2999_rsmG GTGTTTCACGTGAAACATGTCGGTTCTTACGAGGAGTTGGCATCCTTTAC GTCAGTTAAAGGCAATCTTGGATTTGATACTGTGTTTGAAGCTGTATTCA TGATTTTTGGACCACGTCTTAATATTGCTCAGCGGTATGTCGATCTACTC GCAAATACAGGAATTGAACGTGGATTGCTTGGTCCTCATGAGGCTAACCG GCTTTGGGATCGGCATCTATTGAACAGTGCAGTGGTAGCCGAACTTCTTG ATCCTGGTGATCGGGTAGTGGATATTGGAAGTGGTGCGGGGTTGCCGGGG TTGCCGTTGGCTATTGCCCGGCCGGATCTTCAGGTTGTGTTGCTTGAGCC ACTGTTACGTCGAGTTACTTTTCTTCGAGAAGTAGTGGCTGAGCTTGGAC TTGATGTTGAAGTGGTTCGTGGCCGAGCTGAGGAGTTGTGGGTGCGTGAT CGGATCGGTGAAAGAGATGTGGCTGTATCACGAGCGGTAGCGGCCTTGGA CAAGTTGACAAAGTGGAGCATACCGTTGTTACGACCAGGTGGTCAAATAC TTGCAATCAAAGGGGAACATGTTTTTGACGAAATCCATCAACATCGGCGT GTAATGGCCTCATTGGGCGCCGTTGATGTCATGGTGGTGGTATGTGGTGC GAATTATTTGTGTCGTCCCGTAACAGTAGTCCTAACGCGATGCGGACAGC AGATGCGGCACAAACCAGCGCGTGTGGGGGACAGGAAAACACAA
>NC_011896_1_WP_010909047_1_2895_MLBR_RS13785 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ >NC_002677_1_NP_302729_1_1601_gidB VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ >NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ >NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ >NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930 VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ >NZ_AP014567_1_WP_010909047_1_2999_rsmG VFHVKHVGSYEELASFTSVKGNLGFDTVFEAVFMIFGPRLNIAQRYVDLL ANTGIERGLLGPHEANRLWDRHLLNSAVVAELLDPGDRVVDIGSGAGLPG LPLAIARPDLQVVLLEPLLRRVTFLREVVAELGLDVEVVRGRAEELWVRD RIGERDVAVSRAVAALDKLTKWSIPLLRPGGQILAIKGEHVFDEIHQHRR VMASLGAVDVMVVVCGANYLCRPVTVVLTRCGQQMRHKPARVGDRKTQ
#NEXUS
[ID: 0531505978]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010909047_1_2895_MLBR_RS13785
NC_002677_1_NP_302729_1_1601_gidB
NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935
NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960
NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930
NZ_AP014567_1_WP_010909047_1_2999_rsmG
;
end;
begin trees;
translate
1 NC_011896_1_WP_010909047_1_2895_MLBR_RS13785,
2 NC_002677_1_NP_302729_1_1601_gidB,
3 NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935,
4 NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960,
5 NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930,
6 NZ_AP014567_1_WP_010909047_1_2999_rsmG
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.0704766,2:0.06992799,3:0.0678426,4:0.07004014,5:0.06570498,6:0.07046556);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.0704766,2:0.06992799,3:0.0678426,4:0.07004014,5:0.06570498,6:0.07046556);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1018.17 -1021.36
2 -1018.17 -1021.37
--------------------------------------
TOTAL -1018.17 -1021.37
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/2res/gidB/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.905153 0.092386 0.369773 1.524082 0.868701 1443.18 1469.70 1.000
r(A<->C){all} 0.183087 0.022214 0.000036 0.484401 0.147267 196.59 199.36 1.004
r(A<->G){all} 0.166040 0.019929 0.000337 0.457689 0.128301 156.47 222.50 1.004
r(A<->T){all} 0.151048 0.017158 0.000007 0.424938 0.112053 189.95 220.42 1.001
r(C<->G){all} 0.176979 0.021425 0.000072 0.474096 0.136889 205.13 231.32 1.013
r(C<->T){all} 0.160529 0.017442 0.000032 0.424880 0.128246 133.12 204.29 1.005
r(G<->T){all} 0.162316 0.017786 0.000015 0.428818 0.129973 238.23 264.87 1.007
pi(A){all} 0.217595 0.000229 0.189683 0.248446 0.217673 1227.59 1311.53 1.000
pi(C){all} 0.187093 0.000195 0.159881 0.214556 0.186912 1207.05 1307.62 1.000
pi(G){all} 0.311351 0.000273 0.280295 0.344782 0.310813 1165.63 1251.17 1.000
pi(T){all} 0.283960 0.000276 0.252141 0.316673 0.283615 1195.32 1246.63 1.001
alpha{1,2} 0.419730 0.211994 0.000140 1.328387 0.263099 1301.41 1385.37 1.000
alpha{3} 0.453390 0.239721 0.000135 1.432013 0.297066 1158.74 1208.13 1.000
pinvar{all} 0.997884 0.000006 0.993279 0.999999 0.998666 1067.61 1162.63 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/2res/gidB/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 248
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 7 7 7 7 7 7 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 1 1 1 1 1 1
Leu TTA 2 2 2 2 2 2 | TCA 3 3 3 3 3 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 13 13 13 13 13 13 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 12 12 12 12 12 12 | Pro CCT 2 2 2 2 2 2 | His CAT 6 6 6 6 6 6 | Arg CGT 8 8 8 8 8 8
CTC 1 1 1 1 1 1 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 0 0 0 0 0 0
CTA 3 3 3 3 3 3 | CCA 4 4 4 4 4 4 | Gln CAA 3 3 3 3 3 3 | CGA 6 6 6 6 6 6
CTG 1 1 1 1 1 1 | CCG 4 4 4 4 4 4 | CAG 4 4 4 4 4 4 | CGG 8 8 8 8 8 8
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 2 2 2 2 2 2 | Asn AAT 4 4 4 4 4 4 | Ser AGT 2 2 2 2 2 2
ATC 3 3 3 3 3 3 | ACC 0 0 0 0 0 0 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 4 4 4 4 4 4 | Lys AAA 5 5 5 5 5 5 | Arg AGA 1 1 1 1 1 1
Met ATG 4 4 4 4 4 4 | ACG 2 2 2 2 2 2 | AAG 2 2 2 2 2 2 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 7 7 7 7 7 7 | Ala GCT 7 7 7 7 7 7 | Asp GAT 11 11 11 11 11 11 | Gly GGT 8 8 8 8 8 8
GTC 4 4 4 4 4 4 | GCC 5 5 5 5 5 5 | GAC 3 3 3 3 3 3 | GGC 3 3 3 3 3 3
GTA 10 10 10 10 10 10 | GCA 4 4 4 4 4 4 | Glu GAA 8 8 8 8 8 8 | GGA 7 7 7 7 7 7
GTG 13 13 13 13 13 13 | GCG 5 5 5 5 5 5 | GAG 7 7 7 7 7 7 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010909047_1_2895_MLBR_RS13785
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
#2: NC_002677_1_NP_302729_1_1601_gidB
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
#3: NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
#4: NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
#5: NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
#6: NZ_AP014567_1_WP_010909047_1_2999_rsmG
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 42 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 12
TTC 6 | TCC 6 | TAC 6 | TGC 6
Leu L TTA 12 | TCA 18 | *** * TAA 0 | *** * TGA 0
TTG 78 | TCG 0 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 72 | Pro P CCT 12 | His H CAT 36 | Arg R CGT 48
CTC 6 | CCC 6 | CAC 12 | CGC 0
CTA 18 | CCA 24 | Gln Q CAA 18 | CGA 36
CTG 6 | CCG 24 | CAG 24 | CGG 48
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 12 | Asn N AAT 24 | Ser S AGT 12
ATC 18 | ACC 0 | AAC 12 | AGC 6
ATA 12 | ACA 24 | Lys K AAA 30 | Arg R AGA 6
Met M ATG 24 | ACG 12 | AAG 12 | AGG 6
------------------------------------------------------------------------------
Val V GTT 42 | Ala A GCT 42 | Asp D GAT 66 | Gly G GGT 48
GTC 24 | GCC 30 | GAC 18 | GGC 18
GTA 60 | GCA 24 | Glu E GAA 48 | GGA 42
GTG 78 | GCG 30 | GAG 42 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14919 C:0.26210 A:0.16129 G:0.42742
position 2: T:0.35484 C:0.18145 A:0.24194 G:0.22177
position 3: T:0.34677 C:0.11694 A:0.25000 G:0.28629
Average T:0.28360 C:0.18683 A:0.21774 G:0.31183
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -977.601946 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 12.897614
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909047_1_2895_MLBR_RS13785: 0.000004, NC_002677_1_NP_302729_1_1601_gidB: 0.000004, NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935: 0.000004, NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960: 0.000004, NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930: 0.000004, NZ_AP014567_1_WP_010909047_1_2999_rsmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 12.89761
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 479.4 264.6 12.8976 0.0000 0.0000 0.0 0.0
7..2 0.000 479.4 264.6 12.8976 0.0000 0.0000 0.0 0.0
7..3 0.000 479.4 264.6 12.8976 0.0000 0.0000 0.0 0.0
7..4 0.000 479.4 264.6 12.8976 0.0000 0.0000 0.0 0.0
7..5 0.000 479.4 264.6 12.8976 0.0000 0.0000 0.0 0.0
7..6 0.000 479.4 264.6 12.8976 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -977.601994 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.652405 0.000010 0.086331
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909047_1_2895_MLBR_RS13785: 0.000004, NC_002677_1_NP_302729_1_1601_gidB: 0.000004, NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935: 0.000004, NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960: 0.000004, NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930: 0.000004, NZ_AP014567_1_WP_010909047_1_2999_rsmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.65240
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.08633 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 479.4 264.6 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 479.4 264.6 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 479.4 264.6 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 479.4 264.6 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 479.4 264.6 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 479.4 264.6 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -977.601940 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.700036 0.000299 0.000000 0.000001 77.606849
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909047_1_2895_MLBR_RS13785: 0.000004, NC_002677_1_NP_302729_1_1601_gidB: 0.000004, NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935: 0.000004, NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960: 0.000004, NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930: 0.000004, NZ_AP014567_1_WP_010909047_1_2999_rsmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.70004
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00030 0.00000 0.99970
w: 0.00000 1.00000 77.60685
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 479.4 264.6 77.5836 0.0000 0.0000 0.0 0.0
7..2 0.000 479.4 264.6 77.5836 0.0000 0.0000 0.0 0.0
7..3 0.000 479.4 264.6 77.5836 0.0000 0.0000 0.0 0.0
7..4 0.000 479.4 264.6 77.5836 0.0000 0.0000 0.0 0.0
7..5 0.000 479.4 264.6 77.5836 0.0000 0.0000 0.0 0.0
7..6 0.000 479.4 264.6 77.5836 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909047_1_2895_MLBR_RS13785)
Pr(w>1) post mean +- SE for w
1 V 1.000** 77.584
2 F 1.000** 77.584
3 H 1.000** 77.584
4 V 1.000** 77.584
5 K 1.000** 77.584
6 H 1.000** 77.584
7 V 1.000** 77.584
8 G 1.000** 77.584
9 S 1.000** 77.584
10 Y 1.000** 77.584
11 E 1.000** 77.584
12 E 1.000** 77.584
13 L 1.000** 77.584
14 A 1.000** 77.584
15 S 1.000** 77.584
16 F 1.000** 77.584
17 T 1.000** 77.584
18 S 1.000** 77.584
19 V 1.000** 77.584
20 K 1.000** 77.584
21 G 1.000** 77.584
22 N 1.000** 77.584
23 L 1.000** 77.584
24 G 1.000** 77.584
25 F 1.000** 77.584
26 D 1.000** 77.584
27 T 1.000** 77.584
28 V 1.000** 77.584
29 F 1.000** 77.584
30 E 1.000** 77.584
31 A 1.000** 77.584
32 V 1.000** 77.584
33 F 1.000** 77.584
34 M 1.000** 77.584
35 I 1.000** 77.584
36 F 1.000** 77.584
37 G 1.000** 77.584
38 P 1.000** 77.584
39 R 1.000** 77.584
40 L 1.000** 77.584
41 N 1.000** 77.584
42 I 1.000** 77.584
43 A 1.000** 77.584
44 Q 1.000** 77.584
45 R 1.000** 77.584
46 Y 1.000** 77.584
47 V 1.000** 77.584
48 D 1.000** 77.584
49 L 1.000** 77.584
50 L 1.000** 77.584
51 A 1.000** 77.584
52 N 1.000** 77.584
53 T 1.000** 77.584
54 G 1.000** 77.584
55 I 1.000** 77.584
56 E 1.000** 77.584
57 R 1.000** 77.584
58 G 1.000** 77.584
59 L 1.000** 77.584
60 L 1.000** 77.584
61 G 1.000** 77.584
62 P 1.000** 77.584
63 H 1.000** 77.584
64 E 1.000** 77.584
65 A 1.000** 77.584
66 N 1.000** 77.584
67 R 1.000** 77.584
68 L 1.000** 77.584
69 W 1.000** 77.584
70 D 1.000** 77.584
71 R 1.000** 77.584
72 H 1.000** 77.584
73 L 1.000** 77.584
74 L 1.000** 77.584
75 N 1.000** 77.584
76 S 1.000** 77.584
77 A 1.000** 77.584
78 V 1.000** 77.584
79 V 1.000** 77.584
80 A 1.000** 77.584
81 E 1.000** 77.584
82 L 1.000** 77.584
83 L 1.000** 77.584
84 D 1.000** 77.584
85 P 1.000** 77.584
86 G 1.000** 77.584
87 D 1.000** 77.584
88 R 1.000** 77.584
89 V 1.000** 77.584
90 V 1.000** 77.584
91 D 1.000** 77.584
92 I 1.000** 77.584
93 G 1.000** 77.584
94 S 1.000** 77.584
95 G 1.000** 77.584
96 A 1.000** 77.584
97 G 1.000** 77.584
98 L 1.000** 77.584
99 P 1.000** 77.584
100 G 1.000** 77.584
101 L 1.000** 77.584
102 P 1.000** 77.584
103 L 1.000** 77.584
104 A 1.000** 77.584
105 I 1.000** 77.584
106 A 1.000** 77.584
107 R 1.000** 77.584
108 P 1.000** 77.584
109 D 1.000** 77.584
110 L 1.000** 77.584
111 Q 1.000** 77.584
112 V 1.000** 77.584
113 V 1.000** 77.584
114 L 1.000** 77.584
115 L 1.000** 77.584
116 E 1.000** 77.584
117 P 1.000** 77.584
118 L 1.000** 77.584
119 L 1.000** 77.584
120 R 1.000** 77.584
121 R 1.000** 77.584
122 V 1.000** 77.584
123 T 1.000** 77.584
124 F 1.000** 77.584
125 L 1.000** 77.584
126 R 1.000** 77.584
127 E 1.000** 77.584
128 V 1.000** 77.584
129 V 1.000** 77.584
130 A 1.000** 77.584
131 E 1.000** 77.584
132 L 1.000** 77.584
133 G 1.000** 77.584
134 L 1.000** 77.584
135 D 1.000** 77.584
136 V 1.000** 77.584
137 E 1.000** 77.584
138 V 1.000** 77.584
139 V 1.000** 77.584
140 R 1.000** 77.584
141 G 1.000** 77.584
142 R 1.000** 77.584
143 A 1.000** 77.584
144 E 1.000** 77.584
145 E 1.000** 77.584
146 L 1.000** 77.584
147 W 1.000** 77.584
148 V 1.000** 77.584
149 R 1.000** 77.584
150 D 1.000** 77.584
151 R 1.000** 77.584
152 I 1.000** 77.584
153 G 1.000** 77.584
154 E 1.000** 77.584
155 R 1.000** 77.584
156 D 1.000** 77.584
157 V 1.000** 77.584
158 A 1.000** 77.584
159 V 1.000** 77.584
160 S 1.000** 77.584
161 R 1.000** 77.584
162 A 1.000** 77.584
163 V 1.000** 77.584
164 A 1.000** 77.584
165 A 1.000** 77.584
166 L 1.000** 77.584
167 D 1.000** 77.584
168 K 1.000** 77.584
169 L 1.000** 77.584
170 T 1.000** 77.584
171 K 1.000** 77.584
172 W 1.000** 77.584
173 S 1.000** 77.584
174 I 1.000** 77.584
175 P 1.000** 77.584
176 L 1.000** 77.584
177 L 1.000** 77.584
178 R 1.000** 77.584
179 P 1.000** 77.584
180 G 1.000** 77.584
181 G 1.000** 77.584
182 Q 1.000** 77.584
183 I 1.000** 77.584
184 L 1.000** 77.584
185 A 1.000** 77.584
186 I 1.000** 77.584
187 K 1.000** 77.584
188 G 1.000** 77.584
189 E 1.000** 77.584
190 H 1.000** 77.584
191 V 1.000** 77.584
192 F 1.000** 77.584
193 D 1.000** 77.584
194 E 1.000** 77.584
195 I 1.000** 77.584
196 H 1.000** 77.584
197 Q 1.000** 77.584
198 H 1.000** 77.584
199 R 1.000** 77.584
200 R 1.000** 77.584
201 V 1.000** 77.584
202 M 1.000** 77.584
203 A 1.000** 77.584
204 S 1.000** 77.584
205 L 1.000** 77.584
206 G 1.000** 77.584
207 A 1.000** 77.584
208 V 1.000** 77.584
209 D 1.000** 77.584
210 V 1.000** 77.584
211 M 1.000** 77.584
212 V 1.000** 77.584
213 V 1.000** 77.584
214 V 1.000** 77.584
215 C 1.000** 77.584
216 G 1.000** 77.584
217 A 1.000** 77.584
218 N 1.000** 77.584
219 Y 1.000** 77.584
220 L 1.000** 77.584
221 C 1.000** 77.584
222 R 1.000** 77.584
223 P 1.000** 77.584
224 V 1.000** 77.584
225 T 1.000** 77.584
226 V 1.000** 77.584
227 V 1.000** 77.584
228 L 1.000** 77.584
229 T 1.000** 77.584
230 R 1.000** 77.584
231 C 1.000** 77.584
232 G 1.000** 77.584
233 Q 1.000** 77.584
234 Q 1.000** 77.584
235 M 1.000** 77.584
236 R 1.000** 77.584
237 H 1.000** 77.584
238 K 1.000** 77.584
239 P 1.000** 77.584
240 A 1.000** 77.584
241 R 1.000** 77.584
242 V 1.000** 77.584
243 G 1.000** 77.584
244 D 1.000** 77.584
245 R 1.000** 77.584
246 K 1.000** 77.584
247 T 1.000** 77.584
248 Q 1.000** 77.584
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909047_1_2895_MLBR_RS13785)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -977.602046 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.700036 0.576620 1.801334
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909047_1_2895_MLBR_RS13785: 0.000004, NC_002677_1_NP_302729_1_1601_gidB: 0.000004, NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935: 0.000004, NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960: 0.000004, NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930: 0.000004, NZ_AP014567_1_WP_010909047_1_2999_rsmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.70004
Parameters in M7 (beta):
p = 0.57662 q = 1.80133
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00283 0.01917 0.04718 0.08630 0.13711 0.20110 0.28112 0.38258 0.51744 0.72559
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 479.4 264.6 0.2400 0.0000 0.0000 0.0 0.0
7..2 0.000 479.4 264.6 0.2400 0.0000 0.0000 0.0 0.0
7..3 0.000 479.4 264.6 0.2400 0.0000 0.0000 0.0 0.0
7..4 0.000 479.4 264.6 0.2400 0.0000 0.0000 0.0 0.0
7..5 0.000 479.4 264.6 0.2400 0.0000 0.0000 0.0 0.0
7..6 0.000 479.4 264.6 0.2400 0.0000 0.0000 0.0 0.0
Time used: 0:07
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -977.601945 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.691815 0.000010 0.005000 1.759938 13.967967
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010909047_1_2895_MLBR_RS13785: 0.000004, NC_002677_1_NP_302729_1_1601_gidB: 0.000004, NZ_LVXE01000010_1_WP_010909047_1_259_A3216_RS04935: 0.000004, NZ_LYPH01000099_1_WP_010909047_1_2891_A8144_RS13960: 0.000004, NZ_CP029543_1_WP_010909047_1_2935_DIJ64_RS14930: 0.000004, NZ_AP014567_1_WP_010909047_1_2999_rsmG: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.69181
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.75994
(p1 = 0.99999) w = 13.96797
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 13.96797
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 479.4 264.6 13.9678 0.0000 0.0000 0.0 0.0
7..2 0.000 479.4 264.6 13.9678 0.0000 0.0000 0.0 0.0
7..3 0.000 479.4 264.6 13.9678 0.0000 0.0000 0.0 0.0
7..4 0.000 479.4 264.6 13.9678 0.0000 0.0000 0.0 0.0
7..5 0.000 479.4 264.6 13.9678 0.0000 0.0000 0.0 0.0
7..6 0.000 479.4 264.6 13.9678 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909047_1_2895_MLBR_RS13785)
Pr(w>1) post mean +- SE for w
1 V 1.000** 13.968
2 F 1.000** 13.968
3 H 1.000** 13.968
4 V 1.000** 13.968
5 K 1.000** 13.968
6 H 1.000** 13.968
7 V 1.000** 13.968
8 G 1.000** 13.968
9 S 1.000** 13.968
10 Y 1.000** 13.968
11 E 1.000** 13.968
12 E 1.000** 13.968
13 L 1.000** 13.968
14 A 1.000** 13.968
15 S 1.000** 13.968
16 F 1.000** 13.968
17 T 1.000** 13.968
18 S 1.000** 13.968
19 V 1.000** 13.968
20 K 1.000** 13.968
21 G 1.000** 13.968
22 N 1.000** 13.968
23 L 1.000** 13.968
24 G 1.000** 13.968
25 F 1.000** 13.968
26 D 1.000** 13.968
27 T 1.000** 13.968
28 V 1.000** 13.968
29 F 1.000** 13.968
30 E 1.000** 13.968
31 A 1.000** 13.968
32 V 1.000** 13.968
33 F 1.000** 13.968
34 M 1.000** 13.968
35 I 1.000** 13.968
36 F 1.000** 13.968
37 G 1.000** 13.968
38 P 1.000** 13.968
39 R 1.000** 13.968
40 L 1.000** 13.968
41 N 1.000** 13.968
42 I 1.000** 13.968
43 A 1.000** 13.968
44 Q 1.000** 13.968
45 R 1.000** 13.968
46 Y 1.000** 13.968
47 V 1.000** 13.968
48 D 1.000** 13.968
49 L 1.000** 13.968
50 L 1.000** 13.968
51 A 1.000** 13.968
52 N 1.000** 13.968
53 T 1.000** 13.968
54 G 1.000** 13.968
55 I 1.000** 13.968
56 E 1.000** 13.968
57 R 1.000** 13.968
58 G 1.000** 13.968
59 L 1.000** 13.968
60 L 1.000** 13.968
61 G 1.000** 13.968
62 P 1.000** 13.968
63 H 1.000** 13.968
64 E 1.000** 13.968
65 A 1.000** 13.968
66 N 1.000** 13.968
67 R 1.000** 13.968
68 L 1.000** 13.968
69 W 1.000** 13.968
70 D 1.000** 13.968
71 R 1.000** 13.968
72 H 1.000** 13.968
73 L 1.000** 13.968
74 L 1.000** 13.968
75 N 1.000** 13.968
76 S 1.000** 13.968
77 A 1.000** 13.968
78 V 1.000** 13.968
79 V 1.000** 13.968
80 A 1.000** 13.968
81 E 1.000** 13.968
82 L 1.000** 13.968
83 L 1.000** 13.968
84 D 1.000** 13.968
85 P 1.000** 13.968
86 G 1.000** 13.968
87 D 1.000** 13.968
88 R 1.000** 13.968
89 V 1.000** 13.968
90 V 1.000** 13.968
91 D 1.000** 13.968
92 I 1.000** 13.968
93 G 1.000** 13.968
94 S 1.000** 13.968
95 G 1.000** 13.968
96 A 1.000** 13.968
97 G 1.000** 13.968
98 L 1.000** 13.968
99 P 1.000** 13.968
100 G 1.000** 13.968
101 L 1.000** 13.968
102 P 1.000** 13.968
103 L 1.000** 13.968
104 A 1.000** 13.968
105 I 1.000** 13.968
106 A 1.000** 13.968
107 R 1.000** 13.968
108 P 1.000** 13.968
109 D 1.000** 13.968
110 L 1.000** 13.968
111 Q 1.000** 13.968
112 V 1.000** 13.968
113 V 1.000** 13.968
114 L 1.000** 13.968
115 L 1.000** 13.968
116 E 1.000** 13.968
117 P 1.000** 13.968
118 L 1.000** 13.968
119 L 1.000** 13.968
120 R 1.000** 13.968
121 R 1.000** 13.968
122 V 1.000** 13.968
123 T 1.000** 13.968
124 F 1.000** 13.968
125 L 1.000** 13.968
126 R 1.000** 13.968
127 E 1.000** 13.968
128 V 1.000** 13.968
129 V 1.000** 13.968
130 A 1.000** 13.968
131 E 1.000** 13.968
132 L 1.000** 13.968
133 G 1.000** 13.968
134 L 1.000** 13.968
135 D 1.000** 13.968
136 V 1.000** 13.968
137 E 1.000** 13.968
138 V 1.000** 13.968
139 V 1.000** 13.968
140 R 1.000** 13.968
141 G 1.000** 13.968
142 R 1.000** 13.968
143 A 1.000** 13.968
144 E 1.000** 13.968
145 E 1.000** 13.968
146 L 1.000** 13.968
147 W 1.000** 13.968
148 V 1.000** 13.968
149 R 1.000** 13.968
150 D 1.000** 13.968
151 R 1.000** 13.968
152 I 1.000** 13.968
153 G 1.000** 13.968
154 E 1.000** 13.968
155 R 1.000** 13.968
156 D 1.000** 13.968
157 V 1.000** 13.968
158 A 1.000** 13.968
159 V 1.000** 13.968
160 S 1.000** 13.968
161 R 1.000** 13.968
162 A 1.000** 13.968
163 V 1.000** 13.968
164 A 1.000** 13.968
165 A 1.000** 13.968
166 L 1.000** 13.968
167 D 1.000** 13.968
168 K 1.000** 13.968
169 L 1.000** 13.968
170 T 1.000** 13.968
171 K 1.000** 13.968
172 W 1.000** 13.968
173 S 1.000** 13.968
174 I 1.000** 13.968
175 P 1.000** 13.968
176 L 1.000** 13.968
177 L 1.000** 13.968
178 R 1.000** 13.968
179 P 1.000** 13.968
180 G 1.000** 13.968
181 G 1.000** 13.968
182 Q 1.000** 13.968
183 I 1.000** 13.968
184 L 1.000** 13.968
185 A 1.000** 13.968
186 I 1.000** 13.968
187 K 1.000** 13.968
188 G 1.000** 13.968
189 E 1.000** 13.968
190 H 1.000** 13.968
191 V 1.000** 13.968
192 F 1.000** 13.968
193 D 1.000** 13.968
194 E 1.000** 13.968
195 I 1.000** 13.968
196 H 1.000** 13.968
197 Q 1.000** 13.968
198 H 1.000** 13.968
199 R 1.000** 13.968
200 R 1.000** 13.968
201 V 1.000** 13.968
202 M 1.000** 13.968
203 A 1.000** 13.968
204 S 1.000** 13.968
205 L 1.000** 13.968
206 G 1.000** 13.968
207 A 1.000** 13.968
208 V 1.000** 13.968
209 D 1.000** 13.968
210 V 1.000** 13.968
211 M 1.000** 13.968
212 V 1.000** 13.968
213 V 1.000** 13.968
214 V 1.000** 13.968
215 C 1.000** 13.968
216 G 1.000** 13.968
217 A 1.000** 13.968
218 N 1.000** 13.968
219 Y 1.000** 13.968
220 L 1.000** 13.968
221 C 1.000** 13.968
222 R 1.000** 13.968
223 P 1.000** 13.968
224 V 1.000** 13.968
225 T 1.000** 13.968
226 V 1.000** 13.968
227 V 1.000** 13.968
228 L 1.000** 13.968
229 T 1.000** 13.968
230 R 1.000** 13.968
231 C 1.000** 13.968
232 G 1.000** 13.968
233 Q 1.000** 13.968
234 Q 1.000** 13.968
235 M 1.000** 13.968
236 R 1.000** 13.968
237 H 1.000** 13.968
238 K 1.000** 13.968
239 P 1.000** 13.968
240 A 1.000** 13.968
241 R 1.000** 13.968
242 V 1.000** 13.968
243 G 1.000** 13.968
244 D 1.000** 13.968
245 R 1.000** 13.968
246 K 1.000** 13.968
247 T 1.000** 13.968
248 Q 1.000** 13.968
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010909047_1_2895_MLBR_RS13785)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -977.601994 Model 2: PositiveSelection -977.60194 Model 0: one-ratio -977.601946 Model 7: beta -977.602046 Model 8: beta&w>1 -977.601945 Model 0 vs 1 9.599999998499698E-5 Model 2 vs 1 1.0799999995469989E-4 Model 8 vs 7 2.0199999994474638E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
