--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Fri Nov 18 01:42:48 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/105/CG30271-PF/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2826.99 -2847.09 2 -2826.03 -2842.39 -------------------------------------- TOTAL -2826.40 -2846.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.006019 0.009274 0.811624 1.189277 1.004319 1476.02 1488.51 1.000 r(A<->C){all} 0.092153 0.000337 0.058252 0.128712 0.091092 747.90 922.65 1.000 r(A<->G){all} 0.171612 0.000763 0.117693 0.224880 0.170491 950.21 980.21 1.000 r(A<->T){all} 0.081748 0.000654 0.036707 0.131569 0.079744 703.63 764.41 1.000 r(C<->G){all} 0.071254 0.000184 0.047356 0.099208 0.070426 1128.76 1201.33 1.000 r(C<->T){all} 0.488384 0.001558 0.416168 0.567437 0.487702 911.30 941.30 1.001 r(G<->T){all} 0.094849 0.000416 0.055688 0.134208 0.093584 937.17 1033.83 1.000 pi(A){all} 0.240563 0.000217 0.210593 0.268612 0.239931 1046.64 1090.30 1.001 pi(C){all} 0.290600 0.000209 0.263007 0.318780 0.290298 1040.86 1182.79 1.000 pi(G){all} 0.306362 0.000230 0.277052 0.336315 0.306136 1366.16 1408.92 1.001 pi(T){all} 0.162474 0.000132 0.139735 0.183871 0.162357 976.29 1075.19 1.000 alpha{1,2} 0.140327 0.000315 0.108565 0.175374 0.138831 1060.91 1237.79 1.000 alpha{3} 2.913458 0.694472 1.573391 4.715483 2.786817 1140.77 1213.26 1.000 pinvar{all} 0.422813 0.001944 0.330373 0.505072 0.423858 1324.85 1382.94 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2660.988257 Model 2: PositiveSelection -2660.988257 Model 0: one-ratio -2666.629381 Model 3: discrete -2644.34978 Model 7: beta -2645.430377 Model 8: beta&w>1 -2645.431403 Model 0 vs 1 11.282248000000436 Model 2 vs 1 0.0 Model 8 vs 7 0.002051999999821419
>C1 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWDALCDESGVDNGAGGDASSKKLDIKVPPSVNGRKSL DDSLENTSELDTNDGILEELo >C2 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGGVDNGAGDDASSKKLDIKVPPSVNGRKSL DDSLENSSELDTNDGIFEELo >C3 MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGGVDNGAGGDASSKKLDIKVPPSVNGRKSL DDSLENTSELDTNDGIFEELo >C4 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDESGVDNGAGGDASSKKLDIKVPPSVNGRKSL DDSLENTSELDTNDGILEELo >C5 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALGDGSGLENGAGGDAGSKKLDIKVPPSVNGRKSL DDSLENTSELDTNDGILEELo >C6 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS LDDSLENTSELDTNDGILQEL >C7 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >C8 MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >C9 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDEGGVDNGAGGDAGSKKLDIKVPPSVNGRKSL DDSLENTSELDTNDGILQELo >C10 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGLENGAGGDASSKKLDIKVPPAVNGRKSL DDSLENTSELDTNDGILQELo >C11 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGVDSGAGGDAGSKKLDIKVPPSVNGRKSL DDSLENTSELDTNDGILQELo >C12 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGVDSGAVGDAGSKKLDIKVPPSVNGSKSL DDSLENTSELDTNEGILQELo CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=272 C1 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN C2 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN C3 MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN C4 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C5 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C6 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN C7 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C8 MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C9 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C10 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C11 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN C12 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN ****** **** *********************************.* ** C1 RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C2 RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C3 RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C4 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C5 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C6 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C7 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C8 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP C9 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C10 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP C11 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP C12 RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP **.*********************************.**:********** C1 SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH C2 SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH C3 SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH C4 SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH C5 GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH C6 HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH C7 SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH C8 SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH C9 SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH C10 SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH C11 SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH C12 SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH *:**********************:** ***********.********* C1 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C2 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C3 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C4 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C5 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C6 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C7 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C8 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C9 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C10 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C11 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV C12 WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV ************************************************** C1 PDAPRVSPDSATDWDALCDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS C2 PDAPRVSPDSATDWEALCDEGG-VDNGAGDDASSKKLDIKVPPSVNGRKS C3 PDAPRVSPDSATDWEALCDEGG-VDNGAGGDASSKKLDIKVPPSVNGRKS C4 PDAPRVSPDSATDWEALSDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS C5 PDAPRVSPDSATDWEALGDGSG-LENGAGGDAGSKKLDIKVPPSVNGRKS C6 PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS C7 PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS C8 PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS C9 PDAPRVSPDSATDWEALSDEGG-VDNGAGGDAGSKKLDIKVPPSVNGRKS C10 PDAPRVSPDSATDWEALSDDSG-LENGAGGDASSKKLDIKVPPAVNGRKS C11 PDAPRVSPDSATDWEALSDDSG-VDSGAGGDAGSKKLDIKVPPSVNGRKS C12 PDAPRVSPDSATDWEALSDDSG-VDSGAVGDAGSKKLDIKVPPSVNGSKS *:************:** * .* ::.** .**.********.*:*** ** C1 LDDSLENTSELDTNDGILEELo C2 LDDSLENSSELDTNDGIFEELo C3 LDDSLENTSELDTNDGIFEELo C4 LDDSLENTSELDTNDGILEELo C5 LDDSLENTSELDTNDGILEELo C6 LDDSLENTSELDTNDGILQEL- C7 LDDSLENTSELDTNDGILQEL- C8 LDDSLENTSELDTNDGILQEL- C9 LDDSLENTSELDTNDGILQELo C10 LDDSLENTSELDTNDGILQELo C11 LDDSLENTSELDTNDGILQELo C12 LDDSLENTSELDTNEGILQELo *******:******:**::** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 12 SEQUENCES [PROTEIN] Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C12 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 271 type PROTEIN Struct Unchecked Input File /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 271 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [36208] Library Relaxation: Multi_proc [72] Relaxation Summary: [36208]--->[36190] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/105/CG30271-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.688 Mb, Max= 31.686 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWDALCDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEELo >C2 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGG-VDNGAGDDASSKKLDIKVPPSVNGRKS LDDSLENSSELDTNDGIFEELo >C3 MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGIFEELo >C4 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEELo >C5 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALGDGSG-LENGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEELo >C6 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS LDDSLENTSELDTNDGILQEL- >C7 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL- >C8 MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL- >C9 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDEGG-VDNGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQELo >C10 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-LENGAGGDASSKKLDIKVPPAVNGRKS LDDSLENTSELDTNDGILQELo >C11 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-VDSGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQELo >C12 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-VDSGAVGDAGSKKLDIKVPPSVNGSKS LDDSLENTSELDTNEGILQELo FORMAT of file /tmp/tmp7490579226173488991aln Not Supported[FATAL:T-COFFEE] >C1 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWDALCDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEELo >C2 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGG-VDNGAGDDASSKKLDIKVPPSVNGRKS LDDSLENSSELDTNDGIFEELo >C3 MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGIFEELo >C4 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEELo >C5 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALGDGSG-LENGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEELo >C6 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS LDDSLENTSELDTNDGILQEL- >C7 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL- >C8 MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL- >C9 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDEGG-VDNGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQELo >C10 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-LENGAGGDASSKKLDIKVPPAVNGRKS LDDSLENTSELDTNDGILQELo >C11 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-VDSGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQELo >C12 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-VDSGAVGDAGSKKLDIKVPPSVNGSKS LDDSLENTSELDTNEGILQELo input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:272 S:99 BS:272 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # SEQ_INDEX C11 10 # SEQ_INDEX C12 11 # PW_SEQ_DISTANCES BOT 0 1 97.79 C1 C2 97.79 TOP 1 0 97.79 C2 C1 97.79 BOT 0 2 98.52 C1 C3 98.52 TOP 2 0 98.52 C3 C1 98.52 BOT 0 3 98.52 C1 C4 98.52 TOP 3 0 98.52 C4 C1 98.52 BOT 0 4 96.68 C1 C5 96.68 TOP 4 0 96.68 C5 C1 96.68 BOT 0 5 95.93 C1 C6 95.93 TOP 5 0 95.93 C6 C1 95.93 BOT 0 6 96.67 C1 C7 96.67 TOP 6 0 96.67 C7 C1 96.67 BOT 0 7 94.81 C1 C8 94.81 TOP 7 0 94.81 C8 C1 94.81 BOT 0 8 97.05 C1 C9 97.05 TOP 8 0 97.05 C9 C1 97.05 BOT 0 9 95.94 C1 C10 95.94 TOP 9 0 95.94 C10 C1 95.94 BOT 0 10 95.57 C1 C11 95.57 TOP 10 0 95.57 C11 C1 95.57 BOT 0 11 94.46 C1 C12 94.46 TOP 11 0 94.46 C12 C1 94.46 BOT 1 2 98.52 C2 C3 98.52 TOP 2 1 98.52 C3 C2 98.52 BOT 1 3 97.05 C2 C4 97.05 TOP 3 1 97.05 C4 C2 97.05 BOT 1 4 95.20 C2 C5 95.20 TOP 4 1 95.20 C5 C2 95.20 BOT 1 5 94.44 C2 C6 94.44 TOP 5 1 94.44 C6 C2 94.44 BOT 1 6 95.19 C2 C7 95.19 TOP 6 1 95.19 C7 C2 95.19 BOT 1 7 93.33 C2 C8 93.33 TOP 7 1 93.33 C8 C2 93.33 BOT 1 8 96.31 C2 C9 96.31 TOP 8 1 96.31 C9 C2 96.31 BOT 1 9 94.46 C2 C10 94.46 TOP 9 1 94.46 C10 C2 94.46 BOT 1 10 94.10 C2 C11 94.10 TOP 10 1 94.10 C11 C2 94.10 BOT 1 11 92.99 C2 C12 92.99 TOP 11 1 92.99 C12 C2 92.99 BOT 2 3 97.79 C3 C4 97.79 TOP 3 2 97.79 C4 C3 97.79 BOT 2 4 95.94 C3 C5 95.94 TOP 4 2 95.94 C5 C3 95.94 BOT 2 5 95.19 C3 C6 95.19 TOP 5 2 95.19 C6 C3 95.19 BOT 2 6 95.93 C3 C7 95.93 TOP 6 2 95.93 C7 C3 95.93 BOT 2 7 94.07 C3 C8 94.07 TOP 7 2 94.07 C8 C3 94.07 BOT 2 8 97.05 C3 C9 97.05 TOP 8 2 97.05 C9 C3 97.05 BOT 2 9 95.20 C3 C10 95.20 TOP 9 2 95.20 C10 C3 95.20 BOT 2 10 94.83 C3 C11 94.83 TOP 10 2 94.83 C11 C3 94.83 BOT 2 11 93.73 C3 C12 93.73 TOP 11 2 93.73 C12 C3 93.73 BOT 3 4 97.79 C4 C5 97.79 TOP 4 3 97.79 C5 C4 97.79 BOT 3 5 97.41 C4 C6 97.41 TOP 5 3 97.41 C6 C4 97.41 BOT 3 6 98.15 C4 C7 98.15 TOP 6 3 98.15 C7 C4 98.15 BOT 3 7 96.30 C4 C8 96.30 TOP 7 3 96.30 C8 C4 96.30 BOT 3 8 98.52 C4 C9 98.52 TOP 8 3 98.52 C9 C4 98.52 BOT 3 9 97.42 C4 C10 97.42 TOP 9 3 97.42 C10 C4 97.42 BOT 3 10 97.05 C4 C11 97.05 TOP 10 3 97.05 C11 C4 97.05 BOT 3 11 95.94 C4 C12 95.94 TOP 11 3 95.94 C12 C4 95.94 BOT 4 5 96.67 C5 C6 96.67 TOP 5 4 96.67 C6 C5 96.67 BOT 4 6 97.04 C5 C7 97.04 TOP 6 4 97.04 C7 C5 97.04 BOT 4 7 95.19 C5 C8 95.19 TOP 7 4 95.19 C8 C5 95.19 BOT 4 8 97.05 C5 C9 97.05 TOP 8 4 97.05 C9 C5 97.05 BOT 4 9 97.05 C5 C10 97.05 TOP 9 4 97.05 C10 C5 97.05 BOT 4 10 95.94 C5 C11 95.94 TOP 10 4 95.94 C11 C5 95.94 BOT 4 11 94.83 C5 C12 94.83 TOP 11 4 94.83 C12 C5 94.83 BOT 5 6 98.52 C6 C7 98.52 TOP 6 5 98.52 C7 C6 98.52 BOT 5 7 96.31 C6 C8 96.31 TOP 7 5 96.31 C8 C6 96.31 BOT 5 8 98.15 C6 C9 98.15 TOP 8 5 98.15 C9 C6 98.15 BOT 5 9 97.04 C6 C10 97.04 TOP 9 5 97.04 C10 C6 97.04 BOT 5 10 97.41 C6 C11 97.41 TOP 10 5 97.41 C11 C6 97.41 BOT 5 11 96.30 C6 C12 96.30 TOP 11 5 96.30 C12 C6 96.30 BOT 6 7 97.79 C7 C8 97.79 TOP 7 6 97.79 C8 C7 97.79 BOT 6 8 98.89 C7 C9 98.89 TOP 8 6 98.89 C9 C7 98.89 BOT 6 9 97.78 C7 C10 97.78 TOP 9 6 97.78 C10 C7 97.78 BOT 6 10 98.52 C7 C11 98.52 TOP 10 6 98.52 C11 C7 98.52 BOT 6 11 97.41 C7 C12 97.41 TOP 11 6 97.41 C12 C7 97.41 BOT 7 8 97.04 C8 C9 97.04 TOP 8 7 97.04 C9 C8 97.04 BOT 7 9 96.30 C8 C10 96.30 TOP 9 7 96.30 C10 C8 96.30 BOT 7 10 97.78 C8 C11 97.78 TOP 10 7 97.78 C11 C8 97.78 BOT 7 11 97.04 C8 C12 97.04 TOP 11 7 97.04 C12 C8 97.04 BOT 8 9 97.42 C9 C10 97.42 TOP 9 8 97.42 C10 C9 97.42 BOT 8 10 97.79 C9 C11 97.79 TOP 10 8 97.79 C11 C9 97.79 BOT 8 11 96.68 C9 C12 96.68 TOP 11 8 96.68 C12 C9 96.68 BOT 9 10 97.42 C10 C11 97.42 TOP 10 9 97.42 C11 C10 97.42 BOT 9 11 96.31 C10 C12 96.31 TOP 11 9 96.31 C12 C10 96.31 BOT 10 11 98.15 C11 C12 98.15 TOP 11 10 98.15 C12 C11 98.15 AVG 0 C1 * 96.54 AVG 1 C2 * 95.40 AVG 2 C3 * 96.07 AVG 3 C4 * 97.45 AVG 4 C5 * 96.31 AVG 5 C6 * 96.67 AVG 6 C7 * 97.44 AVG 7 C8 * 96.00 AVG 8 C9 * 97.45 AVG 9 C10 * 96.58 AVG 10 C11 * 96.78 AVG 11 C12 * 95.80 TOT TOT * 96.54 CLUSTAL W (1.83) multiple sequence alignment C1 ATGCCCATGAATGGACAGGCGGGTGGACAAAATGGACGCAAGCGTCGGGA C2 ATGCCCATGAATGGACAGGCGGGTGGGCAAAATGGACGCAAGCGTCGGGA C3 ATGCCCATGAATGGACAGGCGGGTGGCCAAAATATACGCAAGCGTCGGGA C4 ATGCCCATGAATGGACAGGCGGGTGGCCAAAATGGACGCAAGCGTCGGGA C5 ATGCCCATGAATGGACAGGCGGGTGGCCAAAATGGACGCAAGCGTCGGGA C6 ATGCCGATGAATGGACAGGCGGGTGGACAAAATGGACGCAAGCGTCGCGA C7 ATGCCGATGAATGGACAGGCGGGGGGTCAGAATGGACGCAAGCGGCGCGA C8 ATGCCGATGAATGGACAGGAGGGTGGACAAAATGGACGTAAGCGTCGCGA C9 ATGCCGATGAATGGACAGGCGGGTGGACAGAATGGACGCAAGCGTCGCGA C10 ATGCCGATGAATGGACAGACAGGTGGCCAAAATGGACGCAAGCGTCGCGA C11 ATGCCGATGAATGGACAGACGGGTGGACAAAATGGACGCAAGCGCCGCGA C12 ATGCCGATGAATGGACAGACGGGTGGACAAAATGGACGCAAGCGCCGTGA ***** ************...** ** **.***. *** ***** ** ** C1 CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG C2 CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG C3 CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG C4 CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG C5 CAACGAAGATTTCTCGGTGAAGCTATCCACCATCAGGATCTGGATACACG C6 TAACGAAGATTTCTCGGTGAAGTTATCCACTATTCGGATCTGGATCCACG C7 CAACGAAGATTTCTCGGTGAAGCTATCCACCATTCGGATCTGGATTCACG C8 CAACGAAGATTTCTCGGTGAAGCTATCCACCATTCGGATCTGGATTCACG C9 TAATGAAGATTTCTCGGTGAAGTTATCCACCATACGAATCTGGATTCACG C10 CAACGAAGATTTCTCGGTGAAGTTATCCACCATACGGATCTGGATCCACG C11 CAACGAAGATTTCTCGGTGAAGTTATCCACCATTCGGATCTGGATTCATG C12 TAATGAAGATTTCTCGGTAAAGTTATCCACCATTCGGATCTGGATTCACG ** **************.*** ******* ** .*.******** ** * C1 AGAAGGACATTGGCAAGTTGACGCGTATTTTATGGGGTGGCCAGGGCAAC C2 AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGGGGGCCAGGGCAAT C3 AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGGGGGCCAGGGCAAC C4 AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGGCAGGGCAAC C5 AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGCGGGCCAGGGAAAC C6 AGAAGGACATTGGCAAGCTGACGCGCATTTTGTGGGCGGGCATGGGCAAC C7 AGAAGGACATTGGCAAGCTGACGCGTATTCTGTGGGCGGGCCAGGGCAAC C8 AGAAGGACATTGGCAAGCTGACGCGTATCTTGTGGGCGGGCCAGGGCAAC C9 AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGCCAGGGAAAC C10 AGAAGGACATCGGCAAGCTGACTCGCATTTTGTGGGCGGGCCAGGGAAAT C11 AGAAGGACATCGGCAAGCTGACGCGCATTCTGTGGGCGGGCCAGGGCAAC C12 AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGCCAGGGCAAC ********** ****** **** ** ** *.**** ** .:***.** C1 AGACTATGCCAACAGGCCAGCAACAATGGTCGAGTGAAGCGCTTCCTCGC C2 CGCCTGTGCCAACAGGCCAGCAACAATGGTCGAGTAAAGCGCTTCCTGGC C3 CGCCTGTGCCAACAGGCCAGCAACAATGGTCGAGTGAAGCGCTTCCTGGC C4 CGACTGAGCCAACAGGCCAGCAACAATGGGCGAGTGAAGCGCTTCCTGGC C5 CGGCTGAGCCAACAGGCCAGCAACAATGGGCGAGTGAAGCGCTTCCTGGC C6 CGCCTCAGTCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC C7 CGCCTCAGCCAGCAGGCCAGCAACAACGGGCGTGTGAAGCGCTTCCTGGC C8 CGCCTCAGTCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC C9 CGTCTCAGTCAGCAAGCTAGTAACAATGGGCGTGTGAAGCGCTTCCTGGC C10 CGTTTGAGTCAACAAGCCAGCAACAATGGGCGTGTGAAGCGTTTCCTGGC C11 CGCCTCAGCCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC C12 CGGCTCAGCCAGCAGGCCAGCAACAATGGGCGGGTGAAGCGCTTCCTGGC .* * :* **.**.** ** ***** ** ** **.***** ***** ** C1 AGCCGTTCCCCATGTCATGAATGCCATCAAAGATCTGCACCAGGCGGTCA C2 CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA C3 CGCCGTTCCCCATGTCATGAATGCCATCAAAGATCTGCACCAGGCGGTCA C4 AGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA C5 CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA C6 CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCATCAGGCGGTAA C7 CGCCGTGCCCCACGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA C8 CGCCGTGCCCCATGTCATGAATGCCATCAAGGATCTGCATCAGGCGGTCA C9 CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA C10 CGCCGTGCCCCACGTCATGAATGCCATCAAAGATCTGCATCAGGCTGTCA C11 CGCCGTTCCCCATGTCATGAATGCGATCAAGGATCTGCACCAGGCCGTCA C12 CGCCGTGCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA .***** ***** *********** *****.******** ***** **.* C1 TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC C2 TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC C3 TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC C4 TCGACAACAATCTGGAGACGGTGCAGGCGCAACTGGAGCCACCGGTGCCC C5 TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC C6 TCGACAACAATCTGGAGACCGTTCAGGCACAGCTGGAGCCGCCGGTTCCC C7 TCGACAACAACCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCG C8 TCGACAACAGTCTGGAGACCGTTCAGGCCCAGTTGGAACCACCGGTTCCC C9 TTGACAACAATCTGGAAACAGTGCAAGCACAGCTGGAGCCTCCGGTTCCA C10 TCGACAACAATCTGGAGACCGTTCAGGCGCAACTGGAGCCGCCAGTGCCA C11 TCGACAACAGCCTGGAGACCGTGCAAGCGCAGCTGGAGCCACCGGTTCCC C12 TCGACAACAGCCTGGAGAGCGTGCAGGCGCAGCTGGAGCCCCCGGTGCCC * *******. *****.* ** **.** **. ****.** **.** ** C1 AGTGCACTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATACACAA C2 AGTGCGGTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATCCACAA C3 AGTGCGCTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATTCACAA C4 AGTGCACTGGTCACCTGCAAGGATGGCAACGGCTTGAACATCATCCACAA C5 GGCGCACTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATCCACAA C6 CACGCACTGGTCACCTGCAAGGATGGCAACGGCCTCAACATTATCCACAA C7 AGTGCCCTGGTCACCTGCAAGGACGGCAACGGCCTCAATATCATCCACAA C8 AGTGCCTTGGTCACCTGCAAGGACGGCAATGGCCTCAATATTATCCACAA C9 AGTGCCTTGGTTACCTGCAAGGACGGCAATGGCCTCAATATTATTCACAA C10 AGTGCCTTGGTTACTTGCAAGGATGGCAATGGCCTGAATATCATCCACAA C11 AGTGCTTTGGTCACCTGCAAGGACGGCAACGGCCTCAATATCATCCACAA C12 AGTGCTCTGGTAACGTGCAAGGACGGCAACGGGCTCAACATCATCCACAA . ** **** ** ******** ***** ** * ** ** ** ***** C1 GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAATACCTGGTGGGCATTT C2 GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT C3 GGCGGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT C4 GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT C5 GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT C6 GGCCGCCGGGCTGGGCCACACCAAGATCCTCGAGTATCTGGTGGGCATTT C7 GGCCGCCGGGCTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT C8 GGCCGCCGGACTGGGTCACACCAAGATCCTGGAGTATCTGGTGGGCATTT C9 GGCCGCAGGACTGGGTCACACCAAGATTCTAGAGTATCTGGTGGGCATTT C10 GGCCGCCGGCTTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT C11 GGCCGCCGGGCTGGGACACACCAAGATCCTTGAGAACCTGGTGGGCATTT C12 GGCCGCCGGGCTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT *** **.** **** *********.* ** **.:* ************* C1 GGCCCGAGGGCGCCCATGAGACGGACATTACCGGAAAGACGCCGCTCCAC C2 GGCCCGAGGGCGCCCATGAGACGGACATTACCGGAAAAACGCCGCTCCAC C3 GGCCCGAGGGCGCCCATGAGACGGACATCACCGGAAAGACGCCGCTCCAC C4 GGCCCGAGGGCGCCCACGAGACGGACATCACCGGCAAGACGCCGCTCCAC C5 GGCCCGAGGGCGCCCACGAGACGGACATCACCGGGAAGACGCCACTCCAC C6 GGCCCGAGGGCGCCCACGAGACGGACATTACCGGGAAGACGCCGCTCCAC C7 GGCCCGAGGGCGCCCACGAGACGGACATCACCGGCAAGACGCCGCTCCAC C8 GGCCCGAGGGCGCCCACGAGGTGGACATCACCGGGAAGACGCCGCTCCAC C9 GGCCCGAGGGCGCCCATGAAACAGACATCACCGGGAAGACGCCGCTTCAC C10 GGCCCGAGGGCGCCCACGAGACGGACATCACTGGCAAGACGCCGCTCCAC C11 GGCCGGAGGGAGCCCACGAGACGGACATCACCGGGAAGACACCGCTCCAC C12 GGCCGGAGGGGGCCCACGAGACGGACATCACCGGGAAGACGCCGCTCCAC **** ***** ***** **.. .***** ** ** **.**.**.** *** C1 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACACTGCTCACCCA C2 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA C3 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA C4 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA C5 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA C6 TGGGCCGCCAGTGCCAAGAACAACATGAGGTGCTACACGCTGCTCACTCA C7 TGGGCCGCCAGTGCCAAGAACAACATGCGGTGCTACACCCTGCTGACCCA C8 TGGGCCGCCAGTGCCAAGAACAACATGAGGTGCTACACCCTGCTGACCCA C9 TGGGCCGCCAGTGCCAAGAACAACATGAGATGCTACACTCTGCTCACCCA C10 TGGGCCGCCAGTGCCAAGAACAACATGCGCTGCTACACTCTGCTCACTCA C11 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA C12 TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA ***************************.* ******** ***** ** ** C1 AGCGGGTTGCGACGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCAT C2 AGCAGGCTGCGACGAGGAGGCCGTAGATTATAAAATGAAGACCCCCTCAT C3 AGCGGGCTGCGACGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCAT C4 AGCGGGCTGCGATGAGGAGGCGGTCGACTATAAAATGAAGACCCCCTCCT C5 GGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCTT C6 AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAAACTCCCTCGT C7 AGCGGGCTGCGACGAGGAGGCCGTGGATTATAAAATGAAAACTCCCTCGT C8 AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAAACTCCCTCGT C9 AGCGGGCTGTGATGAGGAGGCCGTCGATTATAAAATGAAGACTCCCTCAT C10 AGCGGGCTGCGACGAGGAGGCCGTCGACTATAAAATGAAGACACCTTCGT C11 AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAGACACCCTCGT C12 AGCGGGCTGCGATGAGGAGGCCGTCGACTATAAAATGAAGACACCCTCCT .**.** ** ** ******** ** ** ***********.** ** ** * C1 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C2 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C3 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C4 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C5 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C6 ACTACCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C7 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C8 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C9 ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C10 ACTATCGCCACAAGCCGCACGAAATCGAGCGGGCTTTCCTGGTTTATGTG C11 ACTATCGGCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG C12 ACTACCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG **** ** *********************** ** *************** C1 CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGACGCCTT C2 CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C3 CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C4 CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C5 CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGACTGGGAGGCCTT C6 CCGGATGCGCCGCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C7 CCGGATGCGCCCCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C8 CCGGAGGCGCCCCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C9 CCGGATGCGCCCCGTGTCTCCCCCGACAGTGCCACCGATTGGGAGGCCTT C10 CCGGATGCTCCGCGTGTTTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C11 CCGGATGCGCCGCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT C12 CCGGATGCGCCGCGTGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT ***** ** ** ** ** *********** ******** ***** ***** C1 GTGCGATGAGAGTGGA---GTGGACAACGGAGCGGGGGGCGATGCCAGCT C2 GTGCGATGAGGGTGGA---GTGGACAACGGAGCGGGAGACGATGCCAGCT C3 GTGCGATGAGGGTGGA---GTGGACAACGGAGCGGGCGGCGATGCCAGCT C4 GAGCGACGAGAGTGGA---GTGGACAATGGAGCTGGTGGCGATGCCAGCT C5 GGGCGACGGCAGTGGA---TTGGAGAACGGAGCGGGCGGCGATGCCGGCT C6 GAGCGATGACAGTGGCGCGGTGGACAACGGAGCGGGTGGAGATGCCGGCT C7 GAGCGACGACAGCGGAGCGGTGGACACCGGCGCGGGCGGGGATGCCGGCT C8 GAGCGATGACAGTGGAGTGGTGGACACCGGGGCGGCCGGGGATGCCGGCT C9 AAGCGATGAAGGTGGA---GTGGATAACGGTGCGGGAGGGGATGCCGGCT C10 GAGCGATGACAGTGGA---CTGGAGAACGGTGCTGGTGGGGATGCCAGCT C11 GAGCGATGACAGTGGA---GTGGACAGCGGTGCGGGCGGGGATGCCGGCT C12 GAGCGATGACAGTGGC---GTGGACAGTGGCGCGGTCGGCGATGCCGGCT . **** *. .* **. **** * ** ** * *. ******.*** C1 CCAAGAAACTGGACATCAAGGTGCCGCCTTCTGTGAATGGCCGAAAATCG C2 CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGCCGCAAATCG C3 CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGCCGCAAATCG C4 CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGACGCAAATCG C5 CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAACGGCCGCAAATCG C6 CCAAGAAACTGGACATCAAGGTGGCGCCGTCCGTGAACGGTCGCAAATCG C7 CCAAGAAACTGGACATCAAGGTCCCTCCGTCCGTGAACGGTCGCAAATCG C8 CCAAGAAACTGGACATCAAGGTCCCTCCGTCCGTGAATGGTCGCAAATCG C9 CCAAGAAACTGGACATCAAGGTGCCGCCGTCCGTGAACGGTCGCAAGTCG C10 CCAAGAAACTGGACATCAAGGTGCCGCCTGCGGTGAATGGTCGCAAATCG C11 CCAAGAAACTGGACATCAAGGTGCCGCCGTCGGTGAATGGCCGCAAATCG C12 CCAAGAAACTGGACATCAAGGTGCCGCCGTCGGTGAACGGTAGCAAATCG ********************** * ** * ***** ** .*.**.*** C1 CTGGACGACAGCCTTGAGAACACCTCGGAGCTAGACACCAACGACGGAAT C2 CTGGACGATAGCCTTGAGAACTCCTCGGAGCTGGACACCAACGACGGAAT C3 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGACGGAAT C4 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAATGACGGAAT C5 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACGAATGACGGAAT C6 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGATGGAAT C7 CTGGACGACAGCCTAGAGAACACCTCGGAGCTGGACACCAACGATGGAAT C8 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAATGATGGAAT C9 CTGGATGACAGCCTTGAGAACACCTCAGAGCTGGACACCAATGATGGAAT C10 CTGGATGACAGCCTCGAAAATACCTCGGAGCTGGACACCAACGATGGAAT C11 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGATGGAAT C12 CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGAGGGAAT ***** ** ***** **.** :****.*****.***** ** ** ***** C1 ATTGGAAGAGCTG--- C2 ATTCGAAGAGCTG--- C3 ATTCGAAGAGCTG--- C4 ATTGGAAGAGCTG--- C5 ATTGGAAGAGCTG--- C6 ATTGCAAGAGCTG--- C7 ATTGCAAGAGCTG--- C8 ATTGCAAGAGCTG--- C9 ATTGCAAGAGCTG--- C10 ATTGCAAGAGCTG--- C11 ATTGCAAGAGCTG--- C12 ATTGCAAGAGCTG--- *** ******** >C1 ATGCCCATGAATGGACAGGCGGGTGGACAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATTGGCAAGTTGACGCGTATTTTATGGGGTGGCCAGGGCAAC AGACTATGCCAACAGGCCAGCAACAATGGTCGAGTGAAGCGCTTCCTCGC AGCCGTTCCCCATGTCATGAATGCCATCAAAGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC AGTGCACTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATACACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAATACCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAGACGGACATTACCGGAAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACACTGCTCACCCA AGCGGGTTGCGACGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGACGCCTT GTGCGATGAGAGTGGA---GTGGACAACGGAGCGGGGGGCGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCTTCTGTGAATGGCCGAAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTAGACACCAACGACGGAAT ATTGGAAGAGCTG--- >C2 ATGCCCATGAATGGACAGGCGGGTGGGCAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGGGGGCCAGGGCAAT CGCCTGTGCCAACAGGCCAGCAACAATGGTCGAGTAAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC AGTGCGGTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATCCACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAGACGGACATTACCGGAAAAACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCAGGCTGCGACGAGGAGGCCGTAGATTATAAAATGAAGACCCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GTGCGATGAGGGTGGA---GTGGACAACGGAGCGGGAGACGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGCCGCAAATCG CTGGACGATAGCCTTGAGAACTCCTCGGAGCTGGACACCAACGACGGAAT ATTCGAAGAGCTG--- >C3 ATGCCCATGAATGGACAGGCGGGTGGCCAAAATATACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGGGGGCCAGGGCAAC CGCCTGTGCCAACAGGCCAGCAACAATGGTCGAGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAAGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC AGTGCGCTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATTCACAA GGCGGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAGACGGACATCACCGGAAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGACGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GTGCGATGAGGGTGGA---GTGGACAACGGAGCGGGCGGCGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGCCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGACGGAAT ATTCGAAGAGCTG--- >C4 ATGCCCATGAATGGACAGGCGGGTGGCCAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGGCAGGGCAAC CGACTGAGCCAACAGGCCAGCAACAATGGGCGAGTGAAGCGCTTCCTGGC AGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACGGTGCAGGCGCAACTGGAGCCACCGGTGCCC AGTGCACTGGTCACCTGCAAGGATGGCAACGGCTTGAACATCATCCACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACCGGCAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGATGAGGAGGCGGTCGACTATAAAATGAAGACCCCCTCCT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGACGAGAGTGGA---GTGGACAATGGAGCTGGTGGCGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGACGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAATGACGGAAT ATTGGAAGAGCTG--- >C5 ATGCCCATGAATGGACAGGCGGGTGGCCAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGCTATCCACCATCAGGATCTGGATACACG AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGCGGGCCAGGGAAAC CGGCTGAGCCAACAGGCCAGCAACAATGGGCGAGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC GGCGCACTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATCCACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACCGGGAAGACGCCACTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA GGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCTT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGACTGGGAGGCCTT GGGCGACGGCAGTGGA---TTGGAGAACGGAGCGGGCGGCGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAACGGCCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACGAATGACGGAAT ATTGGAAGAGCTG--- >C6 ATGCCGATGAATGGACAGGCGGGTGGACAAAATGGACGCAAGCGTCGCGA TAACGAAGATTTCTCGGTGAAGTTATCCACTATTCGGATCTGGATCCACG AGAAGGACATTGGCAAGCTGACGCGCATTTTGTGGGCGGGCATGGGCAAC CGCCTCAGTCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCATCAGGCGGTAA TCGACAACAATCTGGAGACCGTTCAGGCACAGCTGGAGCCGCCGGTTCCC CACGCACTGGTCACCTGCAAGGATGGCAACGGCCTCAACATTATCCACAA GGCCGCCGGGCTGGGCCACACCAAGATCCTCGAGTATCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATTACCGGGAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGAGGTGCTACACGCTGCTCACTCA AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAAACTCCCTCGT ACTACCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCGCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGCGCGGTGGACAACGGAGCGGGTGGAGATGCCGGCT CCAAGAAACTGGACATCAAGGTGGCGCCGTCCGTGAACGGTCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >C7 ATGCCGATGAATGGACAGGCGGGGGGTCAGAATGGACGCAAGCGGCGCGA CAACGAAGATTTCTCGGTGAAGCTATCCACCATTCGGATCTGGATTCACG AGAAGGACATTGGCAAGCTGACGCGTATTCTGTGGGCGGGCCAGGGCAAC CGCCTCAGCCAGCAGGCCAGCAACAACGGGCGTGTGAAGCGCTTCCTGGC CGCCGTGCCCCACGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAACCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCG AGTGCCCTGGTCACCTGCAAGGACGGCAACGGCCTCAATATCATCCACAA GGCCGCCGGGCTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACCGGCAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGGTGCTACACCCTGCTGACCCA AGCGGGCTGCGACGAGGAGGCCGTGGATTATAAAATGAAAACTCCCTCGT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCCCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGACGACAGCGGAGCGGTGGACACCGGCGCGGGCGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTCCCTCCGTCCGTGAACGGTCGCAAATCG CTGGACGACAGCCTAGAGAACACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >C8 ATGCCGATGAATGGACAGGAGGGTGGACAAAATGGACGTAAGCGTCGCGA CAACGAAGATTTCTCGGTGAAGCTATCCACCATTCGGATCTGGATTCACG AGAAGGACATTGGCAAGCTGACGCGTATCTTGTGGGCGGGCCAGGGCAAC CGCCTCAGTCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTGCCCCATGTCATGAATGCCATCAAGGATCTGCATCAGGCGGTCA TCGACAACAGTCTGGAGACCGTTCAGGCCCAGTTGGAACCACCGGTTCCC AGTGCCTTGGTCACCTGCAAGGACGGCAATGGCCTCAATATTATCCACAA GGCCGCCGGACTGGGTCACACCAAGATCCTGGAGTATCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGGTGGACATCACCGGGAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGAGGTGCTACACCCTGCTGACCCA AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAAACTCCCTCGT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGAGGCGCCCCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGAGTGGTGGACACCGGGGCGGCCGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTCCCTCCGTCCGTGAATGGTCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAATGATGGAAT ATTGCAAGAGCTG--- >C9 ATGCCGATGAATGGACAGGCGGGTGGACAGAATGGACGCAAGCGTCGCGA TAATGAAGATTTCTCGGTGAAGTTATCCACCATACGAATCTGGATTCACG AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGCCAGGGAAAC CGTCTCAGTCAGCAAGCTAGTAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TTGACAACAATCTGGAAACAGTGCAAGCACAGCTGGAGCCTCCGGTTCCA AGTGCCTTGGTTACCTGCAAGGACGGCAATGGCCTCAATATTATTCACAA GGCCGCAGGACTGGGTCACACCAAGATTCTAGAGTATCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAAACAGACATCACCGGGAAGACGCCGCTTCAC TGGGCCGCCAGTGCCAAGAACAACATGAGATGCTACACTCTGCTCACCCA AGCGGGCTGTGATGAGGAGGCCGTCGATTATAAAATGAAGACTCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCCCGTGTCTCCCCCGACAGTGCCACCGATTGGGAGGCCTT AAGCGATGAAGGTGGA---GTGGATAACGGTGCGGGAGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCCGTGAACGGTCGCAAGTCG CTGGATGACAGCCTTGAGAACACCTCAGAGCTGGACACCAATGATGGAAT ATTGCAAGAGCTG--- >C10 ATGCCGATGAATGGACAGACAGGTGGCCAAAATGGACGCAAGCGTCGCGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATACGGATCTGGATCCACG AGAAGGACATCGGCAAGCTGACTCGCATTTTGTGGGCGGGCCAGGGAAAT CGTTTGAGTCAACAAGCCAGCAACAATGGGCGTGTGAAGCGTTTCCTGGC CGCCGTGCCCCACGTCATGAATGCCATCAAAGATCTGCATCAGGCTGTCA TCGACAACAATCTGGAGACCGTTCAGGCGCAACTGGAGCCGCCAGTGCCA AGTGCCTTGGTTACTTGCAAGGATGGCAATGGCCTGAATATCATCCACAA GGCCGCCGGCTTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACTGGCAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGCTGCTACACTCTGCTCACTCA AGCGGGCTGCGACGAGGAGGCCGTCGACTATAAAATGAAGACACCTTCGT ACTATCGCCACAAGCCGCACGAAATCGAGCGGGCTTTCCTGGTTTATGTG CCGGATGCTCCGCGTGTTTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGA---CTGGAGAACGGTGCTGGTGGGGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCTGCGGTGAATGGTCGCAAATCG CTGGATGACAGCCTCGAAAATACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >C11 ATGCCGATGAATGGACAGACGGGTGGACAAAATGGACGCAAGCGCCGCGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATTCGGATCTGGATTCATG AGAAGGACATCGGCAAGCTGACGCGCATTCTGTGGGCGGGCCAGGGCAAC CGCCTCAGCCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCGATCAAGGATCTGCACCAGGCCGTCA TCGACAACAGCCTGGAGACCGTGCAAGCGCAGCTGGAGCCACCGGTTCCC AGTGCTTTGGTCACCTGCAAGGACGGCAACGGCCTCAATATCATCCACAA GGCCGCCGGGCTGGGACACACCAAGATCCTTGAGAACCTGGTGGGCATTT GGCCGGAGGGAGCCCACGAGACGGACATCACCGGGAAGACACCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAGACACCCTCGT ACTATCGGCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCGCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGA---GTGGACAGCGGTGCGGGCGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCGGTGAATGGCCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >C12 ATGCCGATGAATGGACAGACGGGTGGACAAAATGGACGCAAGCGCCGTGA TAATGAAGATTTCTCGGTAAAGTTATCCACCATTCGGATCTGGATTCACG AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGCCAGGGCAAC CGGCTCAGCCAGCAGGCCAGCAACAATGGGCGGGTGAAGCGCTTCCTGGC CGCCGTGCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAGCCTGGAGAGCGTGCAGGCGCAGCTGGAGCCCCCGGTGCCC AGTGCTCTGGTAACGTGCAAGGACGGCAACGGGCTCAACATCATCCACAA GGCCGCCGGGCTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT GGCCGGAGGGGGCCCACGAGACGGACATCACCGGGAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGATGAGGAGGCCGTCGACTATAAAATGAAGACACCCTCCT ACTACCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCGCGTGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGC---GTGGACAGTGGCGCGGTCGGCGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCGGTGAACGGTAGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGAGGGAAT ATTGCAAGAGCTG--- >C1 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWDALCDESGoVDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEEL >C2 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGGoVDNGAGDDASSKKLDIKVPPSVNGRKS LDDSLENSSELDTNDGIFEEL >C3 MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGGoVDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGIFEEL >C4 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDESGoVDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEEL >C5 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALGDGSGoLENGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEEL >C6 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS LDDSLENTSELDTNDGILQEL >C7 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >C8 MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >C9 MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDEGGoVDNGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >C10 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGoLENGAGGDASSKKLDIKVPPAVNGRKS LDDSLENTSELDTNDGILQEL >C11 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGoVDSGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >C12 MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGoVDSGAVGDAGSKKLDIKVPPSVNGSKS LDDSLENTSELDTNEGILQEL MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 12 taxa and 816 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Taxon 11 -> C11 Taxon 12 -> C12 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479432208 Setting output file names to "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 501585946 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 5313344058 Seed = 1028022967 Swapseed = 1479432208 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 33 unique site patterns Division 2 has 18 unique site patterns Division 3 has 128 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4059.115850 -- -24.979900 Chain 2 -- -4079.034855 -- -24.979900 Chain 3 -- -4089.232397 -- -24.979900 Chain 4 -- -4059.135449 -- -24.979900 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4083.441606 -- -24.979900 Chain 2 -- -4186.220447 -- -24.979900 Chain 3 -- -4172.822371 -- -24.979900 Chain 4 -- -4040.035018 -- -24.979900 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4059.116] (-4079.035) (-4089.232) (-4059.135) * [-4083.442] (-4186.220) (-4172.822) (-4040.035) 500 -- (-3018.115) (-3032.389) [-3004.991] (-3015.911) * (-3027.554) [-3008.073] (-3005.131) (-3032.897) -- 0:00:00 1000 -- (-2962.806) (-2944.887) [-2920.246] (-2912.223) * (-2961.388) [-2905.144] (-2912.775) (-2963.610) -- 0:00:00 1500 -- [-2856.641] (-2917.766) (-2880.694) (-2870.191) * (-2922.418) (-2874.439) [-2866.136] (-2951.258) -- 0:11:05 2000 -- (-2846.107) (-2873.573) (-2860.335) [-2845.497] * (-2850.837) (-2858.457) [-2849.330] (-2906.639) -- 0:08:19 2500 -- (-2838.609) (-2839.760) [-2855.757] (-2849.643) * (-2841.809) (-2862.370) [-2838.396] (-2882.812) -- 0:06:39 3000 -- [-2834.431] (-2844.676) (-2844.319) (-2827.944) * (-2838.860) [-2832.851] (-2838.551) (-2846.472) -- 0:05:32 3500 -- [-2832.865] (-2847.192) (-2834.393) (-2841.470) * (-2834.734) [-2835.859] (-2838.754) (-2831.632) -- 0:09:29 4000 -- (-2836.019) [-2834.175] (-2843.676) (-2838.171) * [-2834.217] (-2831.957) (-2845.881) (-2849.606) -- 0:08:18 4500 -- (-2835.589) (-2844.332) [-2830.005] (-2831.646) * (-2846.689) [-2837.290] (-2843.222) (-2840.898) -- 0:07:22 5000 -- (-2835.221) [-2828.979] (-2830.024) (-2828.681) * (-2834.669) [-2829.265] (-2846.543) (-2836.850) -- 0:09:57 Average standard deviation of split frequencies: 0.131993 5500 -- (-2849.227) [-2833.184] (-2832.210) (-2838.319) * [-2830.421] (-2836.547) (-2841.034) (-2839.108) -- 0:09:02 6000 -- (-2835.925) (-2833.191) (-2838.386) [-2828.878] * [-2837.891] (-2829.794) (-2845.296) (-2835.310) -- 0:08:17 6500 -- (-2831.625) (-2844.397) [-2833.584] (-2830.642) * (-2843.390) (-2831.692) (-2838.843) [-2831.242] -- 0:07:38 7000 -- (-2840.704) (-2837.913) (-2840.585) [-2830.057] * (-2834.802) [-2834.230] (-2843.559) (-2843.092) -- 0:09:27 7500 -- (-2834.757) [-2830.825] (-2836.940) (-2837.217) * [-2834.645] (-2845.538) (-2839.008) (-2831.300) -- 0:08:49 8000 -- [-2824.756] (-2843.402) (-2830.543) (-2828.055) * (-2834.241) (-2832.971) (-2841.145) [-2830.080] -- 0:08:16 8500 -- (-2840.702) (-2847.037) [-2837.389] (-2827.478) * (-2850.034) (-2837.798) (-2838.361) [-2831.037] -- 0:07:46 9000 -- (-2839.523) (-2835.267) [-2840.788] (-2828.580) * (-2837.142) (-2834.892) (-2830.269) [-2829.871] -- 0:09:10 9500 -- [-2832.873] (-2840.727) (-2829.495) (-2833.256) * (-2841.825) (-2839.797) (-2846.423) [-2843.355] -- 0:08:41 10000 -- (-2834.069) [-2827.524] (-2836.063) (-2827.156) * (-2835.170) (-2834.757) (-2838.010) [-2840.026] -- 0:08:15 Average standard deviation of split frequencies: 0.109433 10500 -- [-2829.594] (-2841.537) (-2833.835) (-2833.276) * [-2833.999] (-2826.677) (-2830.259) (-2842.734) -- 0:09:25 11000 -- [-2829.274] (-2835.685) (-2836.867) (-2841.672) * (-2841.103) (-2841.835) [-2833.884] (-2852.906) -- 0:08:59 11500 -- (-2836.727) [-2832.755] (-2845.337) (-2845.481) * (-2834.794) (-2838.649) [-2831.920] (-2829.881) -- 0:08:35 12000 -- (-2840.503) (-2834.665) [-2836.598] (-2843.077) * [-2830.170] (-2837.414) (-2838.663) (-2826.033) -- 0:09:36 12500 -- (-2831.163) (-2846.664) (-2839.312) [-2833.171] * (-2841.658) [-2828.067] (-2832.296) (-2830.755) -- 0:09:13 13000 -- (-2836.274) [-2833.146] (-2831.157) (-2838.448) * (-2838.096) (-2827.731) [-2835.657] (-2834.637) -- 0:08:51 13500 -- (-2845.818) (-2844.926) [-2834.791] (-2842.268) * (-2835.113) (-2829.477) [-2828.210] (-2832.013) -- 0:08:31 14000 -- [-2834.196] (-2829.171) (-2831.299) (-2844.723) * (-2826.804) [-2837.141] (-2837.984) (-2836.486) -- 0:09:23 14500 -- [-2840.676] (-2848.031) (-2827.725) (-2845.986) * (-2831.954) (-2834.509) (-2848.482) [-2833.419] -- 0:09:03 15000 -- (-2847.465) (-2838.865) [-2840.020] (-2835.922) * (-2836.340) (-2832.770) (-2834.815) [-2827.213] -- 0:08:45 Average standard deviation of split frequencies: 0.073657 15500 -- (-2835.530) [-2834.061] (-2835.486) (-2845.376) * (-2833.118) (-2833.432) [-2835.129] (-2839.483) -- 0:08:28 16000 -- (-2831.899) (-2836.703) (-2836.155) [-2837.947] * (-2840.872) (-2837.344) [-2829.568] (-2839.085) -- 0:09:13 16500 -- (-2834.924) (-2833.739) (-2836.401) [-2834.366] * (-2846.363) [-2832.326] (-2839.304) (-2849.580) -- 0:08:56 17000 -- (-2844.812) (-2834.626) [-2836.082] (-2837.344) * (-2841.730) (-2824.572) (-2829.988) [-2828.253] -- 0:08:40 17500 -- (-2833.699) (-2837.364) (-2827.977) [-2823.902] * (-2840.969) (-2839.870) (-2836.074) [-2839.075] -- 0:08:25 18000 -- (-2837.866) [-2833.259] (-2832.708) (-2832.624) * (-2843.719) (-2842.832) [-2833.443] (-2832.672) -- 0:09:05 18500 -- (-2836.498) (-2833.429) (-2831.849) [-2834.944] * (-2829.299) (-2842.239) (-2851.849) [-2832.784] -- 0:08:50 19000 -- (-2838.530) [-2830.874] (-2835.385) (-2833.681) * (-2842.423) [-2827.962] (-2834.786) (-2834.520) -- 0:08:36 19500 -- [-2829.976] (-2837.623) (-2847.457) (-2832.414) * (-2839.366) (-2831.929) [-2831.972] (-2830.382) -- 0:08:22 20000 -- (-2832.924) (-2842.779) (-2849.420) [-2827.022] * (-2838.669) (-2835.727) (-2831.551) [-2827.706] -- 0:08:59 Average standard deviation of split frequencies: 0.049221 20500 -- [-2831.219] (-2845.408) (-2836.346) (-2840.305) * (-2837.402) [-2833.362] (-2840.764) (-2834.699) -- 0:08:45 21000 -- (-2837.599) (-2835.390) (-2827.916) [-2831.973] * [-2836.960] (-2831.819) (-2832.823) (-2830.376) -- 0:08:32 21500 -- (-2846.777) (-2827.573) [-2829.540] (-2826.408) * (-2834.074) (-2833.219) [-2839.503] (-2828.660) -- 0:09:06 22000 -- [-2832.624] (-2830.738) (-2830.325) (-2836.583) * (-2840.608) (-2843.543) [-2833.585] (-2835.418) -- 0:08:53 22500 -- (-2847.480) [-2834.755] (-2832.010) (-2836.851) * (-2834.345) (-2844.488) [-2833.284] (-2837.944) -- 0:08:41 23000 -- (-2837.933) [-2840.235] (-2829.950) (-2831.703) * [-2834.881] (-2832.515) (-2837.464) (-2833.446) -- 0:08:29 23500 -- (-2830.204) (-2839.829) (-2834.826) [-2834.258] * (-2843.077) [-2834.435] (-2835.055) (-2837.304) -- 0:09:00 24000 -- (-2839.484) (-2836.997) [-2828.218] (-2850.079) * [-2827.312] (-2845.486) (-2844.950) (-2834.998) -- 0:08:48 24500 -- [-2835.510] (-2832.421) (-2843.212) (-2840.258) * (-2839.945) (-2829.484) [-2831.162] (-2838.908) -- 0:08:37 25000 -- (-2835.834) [-2828.171] (-2835.441) (-2847.430) * (-2827.227) (-2838.590) [-2841.295] (-2837.004) -- 0:08:26 Average standard deviation of split frequencies: 0.037216 25500 -- [-2828.248] (-2833.210) (-2840.737) (-2832.100) * (-2835.364) (-2856.426) [-2835.842] (-2833.930) -- 0:08:55 26000 -- (-2829.043) (-2838.570) (-2843.584) [-2835.334] * [-2830.583] (-2842.752) (-2828.011) (-2842.628) -- 0:08:44 26500 -- (-2828.673) (-2833.131) [-2836.330] (-2838.312) * (-2831.951) (-2834.842) [-2827.158] (-2848.124) -- 0:08:34 27000 -- (-2838.213) (-2836.330) (-2829.788) [-2829.530] * (-2835.418) (-2844.377) [-2835.746] (-2836.694) -- 0:08:24 27500 -- (-2850.311) (-2835.170) (-2833.683) [-2826.160] * (-2838.192) (-2833.996) (-2839.476) [-2830.130] -- 0:08:50 28000 -- (-2842.124) (-2833.941) [-2834.287] (-2845.447) * (-2840.873) [-2838.638] (-2842.065) (-2835.878) -- 0:08:40 28500 -- (-2840.741) [-2831.445] (-2836.603) (-2832.590) * (-2834.097) [-2843.537] (-2842.945) (-2850.896) -- 0:08:31 29000 -- (-2831.858) [-2829.677] (-2837.736) (-2833.605) * (-2838.562) [-2838.207] (-2840.389) (-2843.755) -- 0:08:22 29500 -- (-2837.003) (-2831.840) (-2834.253) [-2831.013] * [-2835.467] (-2854.309) (-2835.479) (-2843.440) -- 0:08:46 30000 -- (-2833.857) (-2827.074) (-2845.236) [-2834.735] * (-2844.105) [-2831.875] (-2837.755) (-2844.597) -- 0:08:37 Average standard deviation of split frequencies: 0.024019 30500 -- (-2831.830) [-2822.932] (-2827.244) (-2825.645) * (-2847.246) (-2835.016) [-2835.828] (-2835.636) -- 0:08:28 31000 -- (-2830.841) [-2833.308] (-2831.319) (-2834.946) * (-2848.014) [-2832.038] (-2832.638) (-2836.785) -- 0:08:51 31500 -- (-2847.784) (-2843.851) [-2839.813] (-2831.151) * (-2831.879) [-2839.840] (-2831.106) (-2842.980) -- 0:08:42 32000 -- (-2852.310) (-2839.861) (-2840.543) [-2825.148] * (-2829.914) (-2841.347) (-2838.427) [-2830.344] -- 0:08:34 32500 -- (-2841.719) (-2841.262) (-2838.034) [-2830.428] * (-2831.834) (-2844.556) (-2832.060) [-2839.791] -- 0:08:26 33000 -- (-2836.593) (-2831.660) (-2828.987) [-2831.223] * [-2835.985] (-2853.290) (-2827.334) (-2829.991) -- 0:08:47 33500 -- (-2837.431) (-2834.923) (-2837.373) [-2833.203] * (-2847.893) (-2837.078) (-2835.931) [-2830.456] -- 0:08:39 34000 -- (-2840.282) [-2839.884] (-2832.743) (-2845.171) * [-2839.587] (-2834.209) (-2832.416) (-2830.080) -- 0:08:31 34500 -- (-2833.661) (-2828.051) [-2837.404] (-2840.216) * (-2842.335) (-2831.722) [-2831.079] (-2829.717) -- 0:08:51 35000 -- (-2856.727) (-2844.285) (-2826.876) [-2835.200] * (-2830.879) [-2834.261] (-2830.328) (-2838.290) -- 0:08:43 Average standard deviation of split frequencies: 0.027062 35500 -- (-2829.506) (-2832.013) (-2826.268) [-2831.742] * (-2842.526) [-2834.013] (-2833.112) (-2835.686) -- 0:08:36 36000 -- [-2838.305] (-2838.242) (-2832.118) (-2844.303) * (-2827.914) (-2828.855) (-2843.155) [-2825.537] -- 0:08:28 36500 -- (-2840.826) (-2848.275) (-2836.351) [-2832.658] * (-2828.426) (-2831.892) (-2830.618) [-2831.528] -- 0:08:47 37000 -- (-2834.160) (-2839.015) (-2837.567) [-2840.594] * (-2831.129) [-2831.677] (-2831.813) (-2829.307) -- 0:08:40 37500 -- (-2838.695) (-2839.015) (-2827.472) [-2832.155] * (-2839.995) [-2836.033] (-2838.718) (-2834.011) -- 0:08:33 38000 -- (-2837.495) (-2826.585) [-2832.600] (-2836.007) * (-2844.225) (-2830.209) (-2847.962) [-2834.016] -- 0:08:51 38500 -- (-2847.225) (-2845.203) [-2837.660] (-2832.303) * (-2840.535) [-2836.344] (-2839.107) (-2836.815) -- 0:08:44 39000 -- (-2844.806) (-2837.942) (-2829.264) [-2836.831] * [-2833.727] (-2834.955) (-2830.371) (-2835.175) -- 0:08:37 39500 -- (-2832.732) (-2831.280) (-2829.927) [-2828.918] * (-2831.949) (-2830.197) (-2844.757) [-2832.345] -- 0:08:54 40000 -- (-2841.418) (-2835.503) [-2829.791] (-2831.600) * [-2829.779] (-2835.800) (-2836.230) (-2835.847) -- 0:08:48 Average standard deviation of split frequencies: 0.026275 40500 -- (-2843.272) (-2839.844) (-2835.847) [-2837.485] * (-2841.217) (-2838.258) (-2837.171) [-2828.445] -- 0:08:41 41000 -- (-2826.801) [-2833.784] (-2849.551) (-2830.967) * (-2838.107) (-2839.866) [-2837.332] (-2838.591) -- 0:08:34 41500 -- [-2834.148] (-2837.306) (-2849.765) (-2827.356) * (-2834.729) [-2831.458] (-2835.048) (-2841.125) -- 0:08:51 42000 -- [-2834.529] (-2829.787) (-2838.038) (-2833.405) * (-2835.638) [-2846.479] (-2837.230) (-2841.185) -- 0:08:44 42500 -- [-2828.886] (-2834.903) (-2842.809) (-2835.221) * (-2838.784) (-2835.846) [-2835.423] (-2830.786) -- 0:08:38 43000 -- (-2837.823) [-2840.448] (-2833.165) (-2838.572) * [-2835.762] (-2842.788) (-2839.024) (-2827.783) -- 0:08:31 43500 -- (-2845.464) (-2830.421) [-2837.201] (-2836.862) * (-2845.217) [-2835.405] (-2838.411) (-2827.603) -- 0:08:47 44000 -- (-2833.080) (-2842.716) (-2826.237) [-2836.711] * (-2839.932) (-2833.644) (-2836.127) [-2830.837] -- 0:08:41 44500 -- (-2836.844) (-2832.079) (-2835.348) [-2831.162] * (-2848.226) [-2839.028] (-2839.766) (-2834.637) -- 0:08:35 45000 -- (-2843.691) [-2832.894] (-2833.342) (-2830.529) * [-2837.590] (-2834.415) (-2845.720) (-2825.382) -- 0:08:50 Average standard deviation of split frequencies: 0.021960 45500 -- (-2850.186) [-2834.979] (-2830.768) (-2843.397) * (-2839.424) (-2835.572) [-2825.608] (-2830.097) -- 0:08:44 46000 -- (-2837.811) (-2836.833) (-2833.227) [-2831.699] * (-2831.862) (-2832.502) [-2827.883] (-2834.866) -- 0:08:38 46500 -- (-2840.759) (-2830.956) (-2834.052) [-2832.100] * (-2837.101) (-2834.566) [-2829.739] (-2832.712) -- 0:08:32 47000 -- (-2839.795) (-2837.378) (-2836.230) [-2830.683] * (-2833.123) (-2847.395) [-2832.172] (-2832.830) -- 0:08:47 47500 -- (-2829.365) (-2849.484) [-2833.193] (-2840.477) * (-2836.033) (-2846.382) (-2842.148) [-2833.634] -- 0:08:41 48000 -- (-2839.857) (-2832.143) [-2831.752] (-2839.851) * (-2846.112) (-2844.249) (-2837.942) [-2829.556] -- 0:08:35 48500 -- [-2837.315] (-2828.259) (-2834.515) (-2834.759) * [-2835.637] (-2826.453) (-2839.853) (-2843.977) -- 0:08:30 49000 -- (-2846.968) [-2829.693] (-2832.350) (-2844.754) * (-2846.372) (-2833.788) [-2830.557] (-2839.116) -- 0:08:44 49500 -- (-2843.768) (-2832.070) [-2838.816] (-2841.620) * (-2834.444) (-2832.183) [-2831.619] (-2843.451) -- 0:08:38 50000 -- (-2835.209) (-2835.694) [-2827.375] (-2838.533) * [-2830.927] (-2828.357) (-2847.912) (-2845.073) -- 0:08:33 Average standard deviation of split frequencies: 0.021266 50500 -- (-2830.687) (-2860.387) [-2827.306] (-2848.635) * (-2828.764) [-2837.657] (-2846.163) (-2843.162) -- 0:08:46 51000 -- (-2841.583) (-2841.052) [-2824.914] (-2833.319) * (-2838.237) [-2833.963] (-2852.258) (-2835.924) -- 0:08:41 51500 -- (-2838.929) (-2841.352) (-2832.422) [-2828.163] * (-2842.742) (-2839.218) (-2835.600) [-2827.915] -- 0:08:35 52000 -- (-2842.364) (-2841.464) (-2830.417) [-2837.335] * (-2831.616) (-2830.967) (-2846.650) [-2836.395] -- 0:08:30 52500 -- [-2831.161] (-2834.519) (-2842.291) (-2834.235) * [-2834.334] (-2835.715) (-2834.296) (-2835.400) -- 0:08:43 53000 -- (-2843.620) (-2837.538) [-2825.860] (-2836.927) * [-2827.698] (-2837.327) (-2847.935) (-2834.326) -- 0:08:38 53500 -- (-2844.298) (-2839.391) (-2829.381) [-2828.675] * [-2831.857] (-2826.113) (-2846.455) (-2833.602) -- 0:08:33 54000 -- (-2846.657) [-2836.075] (-2838.626) (-2831.480) * (-2843.443) (-2825.156) (-2838.471) [-2835.467] -- 0:08:45 54500 -- [-2837.294] (-2833.263) (-2835.502) (-2865.996) * [-2833.025] (-2831.051) (-2838.250) (-2826.566) -- 0:08:40 55000 -- (-2837.864) (-2833.499) [-2839.159] (-2838.638) * (-2832.971) (-2843.158) (-2833.642) [-2828.377] -- 0:08:35 Average standard deviation of split frequencies: 0.023450 55500 -- (-2846.904) [-2838.396] (-2833.330) (-2843.382) * (-2836.928) [-2840.314] (-2831.262) (-2835.700) -- 0:08:30 56000 -- (-2831.115) (-2832.747) (-2834.534) [-2830.290] * (-2838.103) (-2842.138) (-2835.050) [-2823.468] -- 0:08:42 56500 -- (-2833.748) (-2836.354) (-2835.673) [-2833.044] * (-2842.689) (-2840.540) (-2837.457) [-2831.346] -- 0:08:37 57000 -- (-2834.764) [-2835.619] (-2827.246) (-2842.050) * (-2835.902) [-2832.548] (-2832.248) (-2833.833) -- 0:08:32 57500 -- [-2835.382] (-2845.457) (-2838.178) (-2833.232) * (-2836.348) (-2834.553) [-2837.175] (-2834.300) -- 0:08:44 58000 -- (-2838.419) (-2834.826) [-2826.511] (-2835.058) * (-2835.710) (-2840.713) [-2829.786] (-2838.568) -- 0:08:39 58500 -- (-2836.723) (-2841.200) (-2828.481) [-2834.997] * [-2832.818] (-2840.344) (-2838.071) (-2832.827) -- 0:08:35 59000 -- (-2829.567) (-2843.835) [-2837.363] (-2840.301) * [-2834.383] (-2839.033) (-2839.795) (-2830.985) -- 0:08:46 59500 -- (-2848.267) (-2835.394) [-2831.658] (-2831.568) * (-2840.790) [-2834.166] (-2832.994) (-2831.699) -- 0:08:41 60000 -- (-2837.281) (-2842.106) [-2829.072] (-2833.100) * (-2847.480) [-2827.178] (-2830.984) (-2828.009) -- 0:08:37 Average standard deviation of split frequencies: 0.023829 60500 -- (-2846.909) [-2826.712] (-2830.271) (-2845.386) * [-2834.393] (-2834.629) (-2832.535) (-2825.201) -- 0:08:47 61000 -- [-2830.253] (-2830.456) (-2835.037) (-2843.614) * (-2833.003) [-2830.753] (-2837.150) (-2836.939) -- 0:08:43 61500 -- (-2842.482) [-2835.012] (-2835.050) (-2835.376) * (-2837.906) [-2831.645] (-2825.424) (-2830.600) -- 0:08:38 62000 -- [-2834.571] (-2833.686) (-2838.231) (-2831.443) * [-2835.235] (-2842.014) (-2834.015) (-2843.291) -- 0:08:34 62500 -- (-2839.559) (-2833.377) [-2839.913] (-2839.159) * [-2831.008] (-2848.592) (-2832.546) (-2854.223) -- 0:08:45 63000 -- (-2843.016) (-2836.391) (-2834.566) [-2826.621] * [-2831.161] (-2830.317) (-2837.787) (-2841.449) -- 0:08:40 63500 -- [-2837.509] (-2837.909) (-2834.300) (-2833.520) * [-2834.106] (-2841.177) (-2837.907) (-2834.267) -- 0:08:36 64000 -- (-2835.617) (-2835.871) [-2827.861] (-2839.176) * (-2829.127) (-2839.041) (-2840.061) [-2825.433] -- 0:08:46 64500 -- (-2834.111) [-2833.209] (-2844.625) (-2844.735) * (-2837.164) [-2827.159] (-2831.372) (-2843.779) -- 0:08:42 65000 -- (-2830.280) [-2829.914] (-2840.503) (-2843.123) * (-2829.525) (-2833.033) (-2832.892) [-2832.713] -- 0:08:37 Average standard deviation of split frequencies: 0.026189 65500 -- (-2832.347) [-2835.774] (-2822.109) (-2839.129) * (-2831.826) (-2833.552) [-2832.023] (-2832.457) -- 0:08:33 66000 -- (-2848.836) [-2828.545] (-2838.231) (-2830.694) * (-2837.688) (-2857.334) [-2832.384] (-2839.617) -- 0:08:43 66500 -- (-2835.523) (-2836.113) [-2828.546] (-2835.614) * (-2835.405) (-2838.030) (-2836.037) [-2826.655] -- 0:08:39 67000 -- [-2827.887] (-2837.425) (-2830.290) (-2829.986) * (-2830.666) (-2838.513) (-2835.483) [-2828.726] -- 0:08:35 67500 -- (-2843.701) (-2841.830) (-2833.293) [-2834.077] * (-2834.915) [-2834.217] (-2834.089) (-2850.529) -- 0:08:31 68000 -- (-2833.100) [-2838.293] (-2837.085) (-2845.274) * (-2841.823) (-2833.459) (-2840.400) [-2829.023] -- 0:08:40 68500 -- (-2842.500) [-2840.566] (-2826.663) (-2837.376) * (-2834.788) (-2837.926) [-2835.996] (-2836.260) -- 0:08:36 69000 -- (-2832.635) (-2828.176) (-2836.335) [-2836.915] * (-2838.748) (-2841.812) [-2831.892] (-2833.443) -- 0:08:32 69500 -- (-2833.821) (-2834.496) [-2832.302] (-2838.179) * [-2832.860] (-2831.672) (-2838.750) (-2828.404) -- 0:08:28 70000 -- (-2848.802) (-2835.502) (-2839.379) [-2832.996] * (-2832.176) (-2826.828) (-2836.795) [-2840.620] -- 0:08:38 Average standard deviation of split frequencies: 0.024599 70500 -- [-2836.470] (-2838.090) (-2839.653) (-2837.910) * (-2832.636) (-2845.758) [-2828.567] (-2837.575) -- 0:08:34 71000 -- (-2840.653) (-2837.482) (-2833.053) [-2831.022] * (-2842.922) (-2833.054) (-2831.758) [-2834.147] -- 0:08:30 71500 -- (-2834.742) (-2849.845) [-2832.778] (-2826.218) * [-2828.897] (-2834.963) (-2838.315) (-2835.566) -- 0:08:39 72000 -- (-2837.426) (-2835.814) (-2830.636) [-2830.405] * (-2849.307) (-2834.610) [-2838.960] (-2840.724) -- 0:08:35 72500 -- [-2829.677] (-2829.151) (-2838.240) (-2838.712) * [-2833.642] (-2832.487) (-2837.277) (-2832.589) -- 0:08:31 73000 -- (-2847.289) (-2841.202) [-2832.138] (-2830.143) * (-2846.009) (-2834.361) [-2838.889] (-2834.942) -- 0:08:27 73500 -- (-2838.446) (-2833.773) (-2833.517) [-2824.736] * (-2844.014) [-2826.681] (-2843.503) (-2834.353) -- 0:08:36 74000 -- (-2831.586) (-2835.508) (-2837.667) [-2829.589] * (-2841.385) (-2841.854) (-2844.224) [-2832.610] -- 0:08:33 74500 -- (-2838.880) (-2851.719) [-2835.438] (-2834.205) * (-2839.755) (-2830.627) [-2837.740] (-2839.795) -- 0:08:29 75000 -- (-2834.010) (-2834.547) (-2834.796) [-2827.009] * (-2839.498) (-2830.933) (-2835.631) [-2830.336] -- 0:08:38 Average standard deviation of split frequencies: 0.029773 75500 -- (-2831.282) [-2839.311] (-2834.419) (-2834.221) * [-2828.576] (-2835.902) (-2849.940) (-2828.558) -- 0:08:34 76000 -- (-2836.733) (-2834.756) (-2844.183) [-2831.803] * [-2836.975] (-2843.785) (-2829.408) (-2840.491) -- 0:08:30 76500 -- (-2830.301) (-2849.432) (-2836.865) [-2840.290] * (-2832.640) (-2848.973) [-2840.484] (-2841.181) -- 0:08:27 77000 -- (-2834.299) (-2836.700) [-2830.013] (-2838.371) * [-2835.107] (-2837.731) (-2836.108) (-2834.699) -- 0:08:35 77500 -- [-2831.536] (-2832.158) (-2834.214) (-2837.586) * [-2824.293] (-2840.493) (-2838.225) (-2834.784) -- 0:08:31 78000 -- (-2839.852) [-2836.335] (-2844.399) (-2829.784) * (-2833.150) (-2834.506) [-2834.855] (-2839.497) -- 0:08:28 78500 -- [-2840.880] (-2840.150) (-2838.173) (-2842.118) * (-2835.710) (-2833.609) [-2828.210] (-2830.608) -- 0:08:24 79000 -- (-2836.253) [-2830.253] (-2836.566) (-2850.036) * (-2836.789) (-2830.880) [-2832.900] (-2834.926) -- 0:08:32 79500 -- (-2829.187) [-2837.892] (-2830.922) (-2832.099) * (-2830.072) (-2836.807) (-2839.854) [-2830.501] -- 0:08:29 80000 -- (-2840.381) (-2840.588) (-2837.370) [-2835.765] * [-2830.828] (-2837.179) (-2846.469) (-2837.477) -- 0:08:26 Average standard deviation of split frequencies: 0.027661 80500 -- (-2852.090) (-2838.677) (-2829.493) [-2828.979] * [-2829.054] (-2832.017) (-2826.728) (-2837.062) -- 0:08:22 81000 -- (-2843.505) (-2840.730) (-2836.616) [-2827.965] * (-2846.106) [-2830.031] (-2842.107) (-2841.234) -- 0:08:30 81500 -- (-2833.183) [-2837.427] (-2836.666) (-2832.539) * (-2841.505) [-2828.116] (-2831.977) (-2828.256) -- 0:08:27 82000 -- (-2841.911) (-2844.371) (-2836.078) [-2838.708] * (-2843.665) (-2837.717) [-2835.571] (-2832.147) -- 0:08:23 82500 -- [-2835.421] (-2844.325) (-2828.439) (-2833.710) * (-2835.882) (-2830.122) (-2844.525) [-2827.713] -- 0:08:20 83000 -- (-2852.932) [-2837.016] (-2829.743) (-2831.661) * (-2839.161) (-2833.565) [-2832.664] (-2838.191) -- 0:08:28 83500 -- (-2836.808) (-2832.789) [-2836.617] (-2838.338) * [-2840.977] (-2836.232) (-2837.222) (-2833.394) -- 0:08:24 84000 -- (-2844.514) (-2835.139) (-2829.869) [-2834.366] * (-2836.657) (-2853.342) (-2840.246) [-2847.050] -- 0:08:21 84500 -- [-2837.910] (-2841.405) (-2843.803) (-2828.338) * (-2837.078) (-2834.704) [-2829.872] (-2834.446) -- 0:08:29 85000 -- (-2833.118) (-2833.466) (-2837.487) [-2837.064] * (-2832.934) (-2835.244) [-2834.196] (-2830.912) -- 0:08:25 Average standard deviation of split frequencies: 0.028435 85500 -- (-2841.964) (-2836.179) (-2848.798) [-2832.583] * (-2836.357) (-2832.382) [-2830.289] (-2828.653) -- 0:08:22 86000 -- (-2823.898) [-2830.770] (-2838.099) (-2839.653) * (-2830.691) [-2828.935] (-2839.933) (-2833.598) -- 0:08:19 86500 -- (-2839.491) (-2835.194) [-2833.573] (-2835.808) * (-2832.046) [-2835.130] (-2837.348) (-2835.140) -- 0:08:26 87000 -- [-2832.713] (-2840.978) (-2841.256) (-2833.982) * (-2835.141) (-2833.042) [-2832.182] (-2837.193) -- 0:08:23 87500 -- [-2832.380] (-2839.519) (-2847.304) (-2840.370) * (-2839.687) [-2843.289] (-2838.976) (-2839.515) -- 0:08:20 88000 -- (-2833.659) (-2843.327) (-2833.009) [-2834.805] * (-2834.266) (-2839.238) [-2833.694] (-2841.915) -- 0:08:17 88500 -- (-2832.804) [-2838.274] (-2838.670) (-2833.138) * (-2838.302) (-2839.991) (-2837.396) [-2835.414] -- 0:08:24 89000 -- (-2843.171) (-2838.326) [-2834.898] (-2835.594) * (-2838.414) (-2837.488) (-2836.403) [-2833.836] -- 0:08:21 89500 -- (-2837.710) (-2836.685) [-2833.415] (-2835.463) * (-2830.386) (-2834.102) [-2826.905] (-2834.833) -- 0:08:18 90000 -- (-2826.777) (-2833.006) (-2829.986) [-2829.911] * (-2834.911) (-2835.827) (-2835.325) [-2831.726] -- 0:08:15 Average standard deviation of split frequencies: 0.025997 90500 -- (-2836.264) (-2836.332) [-2836.720] (-2828.966) * (-2836.455) [-2834.049] (-2839.602) (-2846.667) -- 0:08:22 91000 -- [-2827.293] (-2842.176) (-2839.429) (-2834.791) * (-2833.371) (-2832.827) (-2835.859) [-2842.849] -- 0:08:19 91500 -- (-2831.084) (-2839.356) [-2833.210] (-2836.970) * (-2831.490) [-2826.276] (-2835.889) (-2841.641) -- 0:08:16 92000 -- [-2831.741] (-2838.312) (-2831.710) (-2831.485) * (-2834.152) [-2834.993] (-2833.774) (-2838.329) -- 0:08:13 92500 -- (-2834.272) (-2831.699) (-2829.749) [-2839.777] * (-2836.939) [-2828.454] (-2834.794) (-2840.979) -- 0:08:20 93000 -- (-2845.681) (-2835.409) (-2831.942) [-2827.112] * [-2833.369] (-2834.231) (-2836.350) (-2833.662) -- 0:08:17 93500 -- (-2835.288) (-2826.462) (-2841.260) [-2827.628] * (-2841.721) (-2832.254) [-2837.560] (-2828.558) -- 0:08:14 94000 -- [-2830.903] (-2834.916) (-2836.537) (-2824.514) * [-2838.328] (-2842.810) (-2839.545) (-2826.541) -- 0:08:11 94500 -- [-2837.330] (-2842.656) (-2841.939) (-2837.792) * (-2836.826) [-2838.160] (-2838.175) (-2827.258) -- 0:08:18 95000 -- [-2834.203] (-2833.496) (-2839.924) (-2840.848) * (-2838.167) [-2828.024] (-2844.063) (-2831.410) -- 0:08:15 Average standard deviation of split frequencies: 0.027928 95500 -- (-2842.609) (-2834.457) (-2839.424) [-2830.574] * (-2831.099) [-2833.002] (-2842.973) (-2841.743) -- 0:08:12 96000 -- (-2832.367) [-2833.041] (-2830.276) (-2834.519) * (-2846.331) (-2832.424) (-2834.311) [-2834.242] -- 0:08:09 96500 -- (-2833.589) (-2834.549) [-2835.439] (-2843.601) * (-2833.647) (-2832.537) (-2835.616) [-2834.277] -- 0:08:16 97000 -- [-2841.288] (-2839.935) (-2834.228) (-2832.741) * (-2829.063) (-2832.391) [-2830.980] (-2846.325) -- 0:08:13 97500 -- [-2833.010] (-2833.851) (-2827.433) (-2836.140) * (-2825.762) [-2830.005] (-2827.781) (-2835.720) -- 0:08:10 98000 -- (-2831.894) [-2831.125] (-2841.172) (-2850.933) * (-2836.794) [-2828.015] (-2840.253) (-2827.921) -- 0:08:07 98500 -- (-2832.133) [-2825.911] (-2838.723) (-2839.040) * (-2844.707) (-2837.692) (-2848.184) [-2828.539] -- 0:08:14 99000 -- [-2828.541] (-2835.427) (-2835.542) (-2840.417) * (-2835.521) (-2837.507) [-2835.904] (-2833.113) -- 0:08:11 99500 -- (-2828.153) (-2830.328) [-2826.712] (-2837.477) * (-2840.506) (-2834.571) [-2826.702] (-2836.971) -- 0:08:08 100000 -- (-2837.479) (-2838.280) [-2826.063] (-2835.002) * (-2828.576) (-2845.568) (-2846.805) [-2832.102] -- 0:08:06 Average standard deviation of split frequencies: 0.026926 100500 -- (-2841.115) [-2840.763] (-2839.073) (-2828.344) * (-2828.336) (-2825.868) (-2838.697) [-2826.753] -- 0:08:12 101000 -- (-2835.269) (-2828.380) (-2828.336) [-2832.822] * (-2851.230) [-2832.638] (-2830.031) (-2837.356) -- 0:08:09 101500 -- (-2834.917) (-2833.823) [-2832.911] (-2845.512) * (-2848.288) (-2838.210) [-2836.194] (-2862.139) -- 0:08:06 102000 -- (-2829.310) (-2831.709) (-2837.159) [-2830.925] * (-2835.937) (-2830.315) [-2827.091] (-2843.174) -- 0:08:04 102500 -- (-2832.613) (-2829.454) [-2831.492] (-2830.515) * (-2830.183) [-2832.137] (-2833.685) (-2831.995) -- 0:08:10 103000 -- [-2837.573] (-2833.078) (-2837.620) (-2827.592) * (-2839.706) (-2831.800) [-2830.580] (-2839.036) -- 0:08:07 103500 -- (-2834.022) (-2835.129) (-2829.478) [-2836.583] * (-2837.061) (-2838.111) (-2841.641) [-2832.590] -- 0:08:05 104000 -- [-2826.297] (-2830.634) (-2832.498) (-2837.381) * (-2843.036) (-2832.970) [-2829.996] (-2836.530) -- 0:08:02 104500 -- [-2828.909] (-2832.407) (-2836.091) (-2835.305) * (-2829.572) [-2827.013] (-2830.868) (-2846.579) -- 0:08:08 105000 -- (-2835.875) (-2839.685) (-2834.578) [-2836.693] * [-2828.024] (-2828.761) (-2830.581) (-2837.891) -- 0:08:05 Average standard deviation of split frequencies: 0.027517 105500 -- (-2838.423) [-2840.358] (-2844.802) (-2849.397) * (-2837.613) [-2826.409] (-2838.788) (-2843.906) -- 0:08:03 106000 -- (-2835.546) (-2835.512) [-2840.931] (-2830.220) * (-2834.835) [-2830.202] (-2843.114) (-2838.184) -- 0:08:00 106500 -- [-2830.616] (-2834.879) (-2848.906) (-2825.959) * (-2833.681) [-2836.141] (-2846.939) (-2837.426) -- 0:08:06 107000 -- (-2835.791) (-2839.414) (-2839.263) [-2830.397] * (-2833.393) [-2833.244] (-2831.954) (-2827.534) -- 0:08:04 107500 -- [-2841.098] (-2831.070) (-2837.382) (-2836.933) * [-2831.917] (-2832.031) (-2840.169) (-2834.505) -- 0:08:01 108000 -- (-2833.908) (-2843.938) (-2840.242) [-2827.683] * (-2831.382) (-2834.681) (-2836.627) [-2834.853] -- 0:07:59 108500 -- (-2835.294) (-2827.918) [-2834.270] (-2836.304) * (-2836.560) (-2835.992) (-2831.984) [-2824.181] -- 0:08:04 109000 -- [-2837.006] (-2835.510) (-2838.296) (-2853.975) * (-2832.041) (-2834.668) (-2827.430) [-2830.165] -- 0:08:02 109500 -- [-2828.451] (-2832.361) (-2855.989) (-2837.806) * (-2835.169) (-2847.441) [-2829.898] (-2837.298) -- 0:07:59 110000 -- (-2832.417) [-2826.114] (-2844.955) (-2838.669) * (-2839.311) (-2832.725) [-2831.373] (-2833.814) -- 0:07:57 Average standard deviation of split frequencies: 0.025292 110500 -- (-2836.972) [-2829.755] (-2844.610) (-2842.277) * (-2837.030) (-2834.453) (-2836.751) [-2833.264] -- 0:08:02 111000 -- (-2842.022) [-2831.397] (-2842.036) (-2843.285) * (-2831.953) (-2836.646) [-2830.084] (-2831.392) -- 0:08:00 111500 -- (-2843.837) [-2841.792] (-2834.885) (-2832.607) * (-2835.323) (-2844.227) (-2834.785) [-2836.730] -- 0:07:58 112000 -- [-2830.149] (-2835.440) (-2836.017) (-2825.880) * [-2834.037] (-2836.987) (-2837.336) (-2838.415) -- 0:08:03 112500 -- (-2844.966) (-2833.847) (-2835.765) [-2829.088] * (-2835.023) (-2839.454) [-2828.793] (-2835.356) -- 0:08:01 113000 -- (-2831.471) (-2841.488) (-2835.456) [-2830.862] * (-2829.154) (-2829.955) (-2840.143) [-2827.922] -- 0:07:58 113500 -- [-2831.069] (-2832.860) (-2831.752) (-2827.569) * (-2832.853) (-2834.359) (-2837.984) [-2830.743] -- 0:07:56 114000 -- [-2836.110] (-2836.899) (-2829.171) (-2844.888) * (-2841.880) (-2843.258) (-2833.630) [-2838.984] -- 0:08:01 114500 -- [-2831.988] (-2834.597) (-2826.278) (-2835.903) * [-2842.493] (-2834.787) (-2838.126) (-2833.082) -- 0:07:59 115000 -- (-2828.719) (-2833.602) [-2828.816] (-2841.638) * [-2832.368] (-2833.997) (-2844.377) (-2831.852) -- 0:07:57 Average standard deviation of split frequencies: 0.024129 115500 -- (-2834.487) [-2844.174] (-2826.925) (-2829.397) * (-2838.577) (-2838.583) [-2834.993] (-2838.873) -- 0:07:54 116000 -- (-2839.190) [-2841.854] (-2843.737) (-2838.226) * (-2845.957) [-2833.504] (-2839.683) (-2829.615) -- 0:08:00 116500 -- (-2836.171) (-2838.720) [-2835.932] (-2844.633) * (-2834.681) (-2836.781) (-2839.897) [-2832.906] -- 0:07:57 117000 -- (-2836.842) [-2840.696] (-2830.257) (-2847.915) * (-2833.697) (-2833.256) [-2834.916] (-2838.922) -- 0:07:55 117500 -- (-2830.438) (-2832.597) [-2833.455] (-2842.751) * (-2832.903) [-2831.389] (-2832.814) (-2835.532) -- 0:07:53 118000 -- (-2832.776) (-2841.890) (-2837.370) [-2834.625] * (-2845.751) [-2831.756] (-2834.999) (-2840.473) -- 0:07:58 118500 -- (-2837.794) (-2833.622) [-2829.758] (-2832.605) * [-2838.729] (-2842.049) (-2838.842) (-2840.950) -- 0:07:56 119000 -- (-2832.393) (-2829.511) [-2827.306] (-2838.395) * (-2824.014) (-2841.802) (-2835.626) [-2842.883] -- 0:07:53 119500 -- (-2835.617) [-2832.190] (-2832.613) (-2830.065) * [-2826.586] (-2832.614) (-2837.632) (-2841.292) -- 0:07:51 120000 -- (-2832.904) (-2846.266) (-2836.810) [-2837.985] * [-2832.342] (-2827.799) (-2848.777) (-2830.373) -- 0:07:56 Average standard deviation of split frequencies: 0.022463 120500 -- (-2833.659) (-2835.439) [-2836.369] (-2837.383) * (-2837.458) (-2831.780) (-2839.549) [-2826.986] -- 0:07:54 121000 -- (-2829.313) (-2828.767) (-2839.598) [-2842.291] * (-2844.512) [-2828.344] (-2834.170) (-2840.461) -- 0:07:52 121500 -- [-2827.365] (-2832.199) (-2835.396) (-2838.348) * (-2833.473) (-2830.644) [-2828.066] (-2842.468) -- 0:07:49 122000 -- (-2828.586) (-2835.103) (-2835.782) [-2847.340] * (-2828.634) (-2830.304) [-2836.263] (-2839.119) -- 0:07:54 122500 -- (-2831.785) [-2829.583] (-2848.135) (-2829.278) * [-2831.990] (-2833.185) (-2836.593) (-2854.199) -- 0:07:52 123000 -- (-2832.557) (-2826.352) (-2841.316) [-2830.670] * (-2839.751) (-2837.323) [-2834.378] (-2835.476) -- 0:07:50 123500 -- (-2840.841) [-2827.626] (-2838.418) (-2834.667) * (-2836.264) (-2837.653) (-2836.261) [-2827.497] -- 0:07:48 124000 -- (-2837.788) [-2829.719] (-2841.670) (-2839.046) * (-2834.059) (-2841.474) (-2848.875) [-2841.423] -- 0:07:53 124500 -- [-2827.226] (-2838.128) (-2833.690) (-2842.352) * (-2830.670) (-2838.229) [-2838.740] (-2846.591) -- 0:07:51 125000 -- (-2833.795) [-2827.990] (-2845.540) (-2839.244) * [-2839.589] (-2827.908) (-2829.855) (-2831.714) -- 0:07:49 Average standard deviation of split frequencies: 0.020811 125500 -- (-2835.552) (-2827.548) (-2831.126) [-2832.975] * (-2852.657) (-2828.703) [-2825.189] (-2840.876) -- 0:07:46 126000 -- (-2830.136) (-2831.935) (-2838.382) [-2829.098] * [-2827.918] (-2831.370) (-2828.297) (-2834.091) -- 0:07:51 126500 -- (-2831.334) (-2839.121) [-2831.533] (-2836.363) * [-2829.803] (-2835.855) (-2845.316) (-2834.796) -- 0:07:49 127000 -- [-2836.760] (-2827.355) (-2853.509) (-2841.864) * (-2828.756) (-2829.399) (-2837.227) [-2826.053] -- 0:07:47 127500 -- (-2837.999) [-2829.818] (-2833.162) (-2834.728) * (-2836.148) (-2837.976) [-2827.433] (-2831.302) -- 0:07:45 128000 -- (-2836.512) [-2832.017] (-2831.539) (-2831.002) * (-2831.589) (-2839.339) (-2835.685) [-2830.250] -- 0:07:50 128500 -- (-2835.339) [-2826.968] (-2830.447) (-2832.494) * (-2843.781) (-2833.834) [-2830.516] (-2842.098) -- 0:07:47 129000 -- (-2828.094) (-2837.043) (-2841.548) [-2843.104] * (-2842.694) (-2830.779) (-2831.249) [-2835.438] -- 0:07:45 129500 -- [-2832.547] (-2839.458) (-2835.747) (-2844.626) * [-2831.919] (-2832.798) (-2837.443) (-2835.047) -- 0:07:43 130000 -- (-2837.927) (-2842.780) [-2837.184] (-2835.549) * (-2831.779) (-2827.846) (-2849.160) [-2836.090] -- 0:07:48 Average standard deviation of split frequencies: 0.023675 130500 -- (-2832.587) (-2844.445) [-2831.603] (-2833.812) * (-2841.013) (-2837.109) [-2833.407] (-2836.814) -- 0:07:46 131000 -- (-2834.485) (-2841.912) [-2844.530] (-2838.855) * (-2832.316) (-2829.876) [-2832.667] (-2838.663) -- 0:07:44 131500 -- (-2829.007) [-2844.250] (-2836.648) (-2833.890) * (-2827.656) (-2839.105) (-2835.149) [-2833.070] -- 0:07:48 132000 -- (-2835.081) [-2829.291] (-2846.085) (-2845.904) * (-2836.677) (-2832.316) [-2828.927] (-2832.788) -- 0:07:46 132500 -- (-2841.030) [-2841.981] (-2843.142) (-2842.161) * (-2843.446) (-2839.670) [-2834.774] (-2838.373) -- 0:07:44 133000 -- (-2843.475) (-2835.958) (-2834.653) [-2828.576] * (-2836.233) [-2834.246] (-2834.989) (-2845.384) -- 0:07:42 133500 -- (-2841.460) (-2831.211) (-2838.842) [-2837.670] * (-2835.281) (-2834.711) (-2832.097) [-2830.903] -- 0:07:47 134000 -- (-2840.510) (-2828.170) (-2829.541) [-2827.254] * (-2829.544) (-2834.648) [-2831.034] (-2842.721) -- 0:07:45 134500 -- (-2839.732) (-2851.984) [-2826.356] (-2830.381) * [-2834.526] (-2834.670) (-2838.687) (-2840.403) -- 0:07:43 135000 -- (-2843.169) (-2824.330) (-2829.120) [-2836.215] * (-2834.026) (-2832.363) [-2829.359] (-2839.890) -- 0:07:41 Average standard deviation of split frequencies: 0.024047 135500 -- (-2841.627) (-2835.889) (-2836.704) [-2834.407] * [-2837.998] (-2835.750) (-2829.046) (-2837.239) -- 0:07:45 136000 -- (-2832.290) (-2838.326) [-2827.357] (-2829.709) * (-2845.169) (-2838.214) [-2835.887] (-2832.308) -- 0:07:43 136500 -- (-2837.372) (-2832.525) (-2844.833) [-2834.771] * (-2835.920) [-2836.602] (-2841.430) (-2838.156) -- 0:07:41 137000 -- (-2840.223) (-2833.914) (-2847.225) [-2830.916] * (-2845.019) (-2840.039) [-2833.224] (-2838.910) -- 0:07:39 137500 -- (-2837.793) (-2843.126) (-2838.008) [-2838.583] * (-2846.320) (-2832.185) [-2833.216] (-2829.282) -- 0:07:44 138000 -- (-2821.901) (-2836.154) [-2831.473] (-2850.877) * (-2834.504) (-2833.722) [-2844.125] (-2830.278) -- 0:07:42 138500 -- (-2838.770) (-2842.908) [-2836.246] (-2836.032) * (-2838.035) [-2843.007] (-2842.318) (-2832.648) -- 0:07:40 139000 -- (-2831.629) (-2839.931) (-2830.155) [-2834.046] * (-2833.537) (-2838.044) (-2840.592) [-2832.869] -- 0:07:38 139500 -- (-2835.807) (-2836.672) [-2834.691] (-2833.735) * (-2837.646) (-2829.423) [-2836.040] (-2833.547) -- 0:07:42 140000 -- (-2845.994) (-2840.917) (-2831.852) [-2833.329] * (-2835.211) (-2836.897) (-2837.841) [-2835.496] -- 0:07:40 Average standard deviation of split frequencies: 0.020317 140500 -- (-2842.472) (-2828.679) (-2837.165) [-2828.356] * (-2846.292) (-2841.961) (-2834.591) [-2832.844] -- 0:07:38 141000 -- [-2830.816] (-2829.456) (-2847.495) (-2835.268) * (-2830.135) (-2834.398) (-2835.623) [-2837.326] -- 0:07:36 141500 -- (-2830.195) (-2829.075) (-2844.332) [-2832.278] * (-2839.806) [-2834.771] (-2837.395) (-2832.375) -- 0:07:41 142000 -- (-2832.093) (-2830.278) (-2840.118) [-2825.445] * [-2834.141] (-2835.763) (-2834.005) (-2832.494) -- 0:07:39 142500 -- [-2835.347] (-2837.642) (-2832.407) (-2833.732) * (-2839.134) (-2842.288) (-2839.113) [-2824.542] -- 0:07:37 143000 -- [-2833.312] (-2840.887) (-2832.240) (-2834.907) * (-2839.680) (-2832.992) (-2846.295) [-2829.132] -- 0:07:35 143500 -- (-2828.878) (-2839.207) (-2834.513) [-2831.946] * (-2839.227) [-2835.210] (-2844.709) (-2844.765) -- 0:07:39 144000 -- (-2835.592) (-2833.051) (-2837.251) [-2838.225] * (-2830.980) (-2840.921) (-2849.439) [-2834.944] -- 0:07:37 144500 -- (-2838.254) (-2837.234) [-2832.038] (-2833.469) * [-2832.768] (-2839.550) (-2840.723) (-2836.483) -- 0:07:35 145000 -- (-2838.949) [-2837.136] (-2837.200) (-2837.169) * (-2834.737) (-2829.650) (-2849.198) [-2834.232] -- 0:07:34 Average standard deviation of split frequencies: 0.022400 145500 -- (-2835.338) (-2836.640) [-2837.594] (-2839.924) * [-2836.729] (-2835.314) (-2840.329) (-2840.306) -- 0:07:38 146000 -- (-2833.953) (-2837.455) (-2835.684) [-2829.877] * (-2838.969) (-2839.739) [-2829.312] (-2829.976) -- 0:07:36 146500 -- (-2828.363) (-2838.643) [-2831.773] (-2838.766) * (-2838.086) (-2834.756) [-2833.592] (-2839.762) -- 0:07:34 147000 -- [-2834.056] (-2852.803) (-2847.446) (-2839.684) * (-2841.318) (-2844.634) [-2829.388] (-2837.578) -- 0:07:32 147500 -- [-2836.056] (-2849.279) (-2833.155) (-2837.770) * (-2839.298) [-2835.831] (-2839.132) (-2831.809) -- 0:07:36 148000 -- [-2833.565] (-2846.395) (-2834.943) (-2828.982) * (-2847.100) (-2834.659) (-2832.379) [-2825.411] -- 0:07:34 148500 -- (-2829.648) (-2837.868) [-2833.114] (-2838.013) * [-2835.586] (-2828.497) (-2834.943) (-2828.985) -- 0:07:32 149000 -- [-2833.275] (-2836.583) (-2827.005) (-2829.212) * [-2832.806] (-2833.615) (-2837.169) (-2839.553) -- 0:07:31 149500 -- [-2829.975] (-2833.674) (-2839.726) (-2829.661) * (-2841.670) [-2838.152] (-2828.326) (-2841.577) -- 0:07:35 150000 -- (-2832.137) [-2831.669] (-2831.112) (-2839.008) * [-2828.963] (-2843.275) (-2832.479) (-2838.227) -- 0:07:33 Average standard deviation of split frequencies: 0.024639 150500 -- (-2846.253) (-2834.938) (-2829.586) [-2833.804] * (-2825.888) (-2837.565) [-2828.963] (-2847.935) -- 0:07:31 151000 -- (-2840.576) (-2834.152) (-2838.509) [-2836.024] * (-2826.451) (-2832.079) [-2838.786] (-2844.858) -- 0:07:29 151500 -- (-2840.469) (-2827.750) (-2845.306) [-2824.153] * (-2835.609) [-2831.277] (-2833.932) (-2837.961) -- 0:07:33 152000 -- (-2834.380) [-2828.142] (-2848.738) (-2835.884) * (-2834.008) (-2843.309) [-2837.700] (-2838.936) -- 0:07:31 152500 -- (-2830.290) (-2832.960) (-2835.166) [-2834.186] * (-2822.637) (-2832.444) (-2836.780) [-2834.413] -- 0:07:30 153000 -- (-2834.235) (-2845.353) [-2842.580] (-2834.050) * [-2835.211] (-2828.193) (-2832.523) (-2830.191) -- 0:07:28 153500 -- (-2845.799) [-2833.614] (-2831.845) (-2835.265) * [-2827.693] (-2837.015) (-2842.582) (-2836.655) -- 0:07:32 154000 -- (-2838.753) (-2834.521) [-2832.734] (-2833.748) * (-2839.272) [-2831.746] (-2835.339) (-2828.595) -- 0:07:30 154500 -- [-2840.282] (-2829.109) (-2842.071) (-2842.897) * [-2827.039] (-2836.126) (-2832.471) (-2843.518) -- 0:07:28 155000 -- (-2835.657) (-2832.755) [-2829.283] (-2844.502) * (-2839.991) (-2834.677) [-2833.507] (-2837.574) -- 0:07:32 Average standard deviation of split frequencies: 0.023797 155500 -- (-2831.349) (-2838.483) (-2845.376) [-2832.289] * (-2845.316) (-2843.813) (-2832.710) [-2836.565] -- 0:07:30 156000 -- (-2833.894) (-2835.980) (-2853.587) [-2838.081] * [-2835.786] (-2827.530) (-2845.269) (-2839.924) -- 0:07:29 156500 -- [-2829.561] (-2835.189) (-2839.947) (-2843.167) * (-2835.021) (-2830.881) [-2831.038] (-2838.379) -- 0:07:27 157000 -- (-2831.392) [-2839.967] (-2845.313) (-2834.998) * (-2830.897) (-2837.479) [-2830.883] (-2842.638) -- 0:07:31 157500 -- (-2845.348) (-2833.633) (-2833.406) [-2830.667] * (-2837.817) (-2834.924) (-2836.848) [-2833.181] -- 0:07:29 158000 -- (-2848.527) (-2829.651) (-2829.068) [-2836.331] * [-2843.575] (-2840.525) (-2841.566) (-2834.633) -- 0:07:27 158500 -- (-2831.997) [-2834.172] (-2835.301) (-2834.559) * (-2837.795) [-2827.827] (-2846.889) (-2840.031) -- 0:07:25 159000 -- (-2838.682) (-2836.635) [-2830.020] (-2833.672) * [-2834.921] (-2830.501) (-2835.441) (-2835.926) -- 0:07:29 159500 -- (-2832.504) (-2842.607) [-2832.261] (-2838.079) * (-2842.276) (-2837.991) (-2840.822) [-2826.303] -- 0:07:27 160000 -- [-2822.478] (-2838.451) (-2838.994) (-2832.527) * (-2832.245) [-2833.567] (-2833.538) (-2834.296) -- 0:07:26 Average standard deviation of split frequencies: 0.023656 160500 -- [-2833.020] (-2836.180) (-2847.105) (-2829.218) * [-2834.935] (-2841.529) (-2835.372) (-2840.136) -- 0:07:24 161000 -- (-2834.510) (-2844.222) [-2830.449] (-2836.021) * (-2834.061) (-2849.230) [-2827.966] (-2833.420) -- 0:07:28 161500 -- (-2844.042) (-2835.215) [-2832.815] (-2832.623) * (-2846.473) (-2842.151) (-2825.777) [-2828.548] -- 0:07:26 162000 -- (-2835.048) (-2834.402) [-2828.201] (-2834.993) * (-2839.166) (-2833.156) (-2830.485) [-2827.393] -- 0:07:24 162500 -- (-2851.281) [-2843.297] (-2835.140) (-2836.282) * (-2837.658) (-2825.246) (-2843.087) [-2833.755] -- 0:07:23 163000 -- (-2841.436) [-2835.641] (-2839.468) (-2836.309) * [-2832.949] (-2834.738) (-2832.436) (-2827.543) -- 0:07:26 163500 -- (-2840.703) (-2834.215) [-2838.260] (-2827.967) * [-2834.602] (-2827.836) (-2840.338) (-2843.622) -- 0:07:25 164000 -- (-2848.348) (-2834.763) [-2835.405] (-2831.108) * (-2834.705) (-2832.723) (-2841.353) [-2826.804] -- 0:07:23 164500 -- (-2843.801) [-2827.794] (-2846.831) (-2838.830) * (-2832.748) [-2833.787] (-2832.899) (-2840.054) -- 0:07:21 165000 -- (-2833.034) [-2826.311] (-2837.973) (-2833.189) * (-2837.013) (-2835.867) [-2834.902] (-2842.613) -- 0:07:25 Average standard deviation of split frequencies: 0.023052 165500 -- (-2841.511) [-2834.458] (-2848.759) (-2836.265) * (-2842.694) [-2829.903] (-2846.835) (-2839.158) -- 0:07:23 166000 -- (-2839.765) (-2829.426) (-2833.360) [-2833.000] * (-2839.063) [-2835.375] (-2828.471) (-2829.172) -- 0:07:22 166500 -- (-2836.914) (-2839.641) [-2831.605] (-2832.538) * (-2842.602) (-2831.601) (-2836.289) [-2829.600] -- 0:07:20 167000 -- (-2842.191) (-2833.588) [-2827.302] (-2844.333) * (-2827.556) (-2830.998) (-2841.691) [-2833.915] -- 0:07:23 167500 -- (-2843.126) (-2828.678) (-2825.723) [-2830.396] * (-2840.172) [-2833.641] (-2855.363) (-2826.584) -- 0:07:22 168000 -- [-2846.381] (-2831.329) (-2830.651) (-2840.619) * (-2849.643) (-2832.616) [-2828.359] (-2834.891) -- 0:07:20 168500 -- (-2829.596) [-2831.191] (-2844.005) (-2847.662) * (-2835.050) (-2829.901) (-2854.751) [-2831.509] -- 0:07:19 169000 -- (-2842.910) [-2831.944] (-2844.558) (-2832.887) * [-2827.956] (-2831.125) (-2843.353) (-2842.897) -- 0:07:22 169500 -- (-2832.145) (-2838.484) (-2859.816) [-2834.631] * (-2834.660) [-2833.038] (-2831.063) (-2827.437) -- 0:07:20 170000 -- (-2826.631) (-2853.192) (-2841.961) [-2844.888] * [-2831.574] (-2833.550) (-2828.336) (-2839.771) -- 0:07:19 Average standard deviation of split frequencies: 0.021772 170500 -- (-2828.510) (-2848.088) [-2831.294] (-2836.614) * [-2831.818] (-2830.693) (-2831.325) (-2843.302) -- 0:07:17 171000 -- (-2838.792) (-2849.380) (-2832.247) [-2830.679] * [-2829.910] (-2837.576) (-2828.327) (-2833.730) -- 0:07:21 171500 -- [-2829.274] (-2840.494) (-2827.168) (-2833.188) * (-2824.805) [-2823.487] (-2828.455) (-2840.100) -- 0:07:19 172000 -- (-2837.706) (-2841.276) [-2833.695] (-2842.534) * [-2831.569] (-2830.603) (-2838.210) (-2847.731) -- 0:07:18 172500 -- [-2838.097] (-2835.488) (-2832.965) (-2838.967) * (-2837.494) [-2830.486] (-2831.928) (-2838.877) -- 0:07:16 173000 -- (-2842.509) (-2840.004) (-2833.683) [-2830.720] * (-2832.262) (-2834.117) [-2833.765] (-2841.780) -- 0:07:19 173500 -- (-2842.789) [-2839.652] (-2831.049) (-2830.233) * [-2833.031] (-2828.174) (-2832.068) (-2837.796) -- 0:07:18 174000 -- (-2836.625) (-2836.877) [-2831.914] (-2836.504) * (-2836.025) (-2841.484) [-2825.229] (-2836.713) -- 0:07:16 174500 -- (-2840.168) [-2845.069] (-2829.097) (-2849.395) * [-2828.623] (-2825.624) (-2830.135) (-2839.579) -- 0:07:15 175000 -- [-2837.936] (-2837.384) (-2829.394) (-2848.732) * [-2830.000] (-2829.927) (-2826.974) (-2841.802) -- 0:07:18 Average standard deviation of split frequencies: 0.021112 175500 -- (-2842.185) (-2838.640) (-2831.097) [-2829.266] * [-2831.562] (-2829.210) (-2845.812) (-2836.095) -- 0:07:16 176000 -- (-2839.983) (-2835.097) [-2831.773] (-2835.139) * [-2832.608] (-2848.033) (-2836.057) (-2827.502) -- 0:07:15 176500 -- (-2846.498) [-2838.802] (-2843.309) (-2846.041) * (-2836.196) [-2838.056] (-2839.324) (-2836.635) -- 0:07:13 177000 -- (-2829.560) [-2828.687] (-2856.014) (-2839.724) * (-2840.175) (-2837.240) [-2826.123] (-2839.432) -- 0:07:17 177500 -- (-2836.730) (-2834.910) (-2849.300) [-2835.145] * (-2840.736) (-2837.168) [-2823.242] (-2842.492) -- 0:07:15 178000 -- (-2830.118) (-2837.523) [-2828.797] (-2841.187) * (-2828.656) (-2828.874) [-2828.146] (-2835.346) -- 0:07:14 178500 -- (-2838.598) (-2833.170) [-2826.120] (-2835.583) * [-2831.520] (-2836.739) (-2839.107) (-2835.128) -- 0:07:12 179000 -- (-2829.356) (-2839.767) [-2836.073] (-2829.747) * (-2832.487) (-2840.797) (-2830.022) [-2834.364] -- 0:07:15 179500 -- (-2838.049) (-2837.111) (-2828.091) [-2828.154] * (-2859.725) (-2836.326) [-2828.399] (-2840.837) -- 0:07:14 180000 -- (-2844.774) (-2833.297) (-2830.874) [-2827.502] * (-2834.662) [-2843.687] (-2839.715) (-2847.092) -- 0:07:12 Average standard deviation of split frequencies: 0.021795 180500 -- (-2838.472) [-2834.283] (-2831.584) (-2837.991) * [-2828.764] (-2835.078) (-2837.798) (-2836.411) -- 0:07:11 181000 -- (-2836.147) (-2833.300) (-2831.245) [-2831.018] * (-2832.980) [-2830.059] (-2837.769) (-2833.695) -- 0:07:14 181500 -- (-2841.100) (-2853.867) [-2845.679] (-2829.160) * (-2835.641) [-2839.830] (-2848.195) (-2834.153) -- 0:07:12 182000 -- (-2846.814) (-2836.767) (-2835.410) [-2833.290] * [-2833.903] (-2829.854) (-2839.256) (-2838.947) -- 0:07:11 182500 -- (-2837.590) (-2829.358) [-2829.268] (-2837.783) * (-2828.506) [-2832.703] (-2837.165) (-2828.092) -- 0:07:14 183000 -- (-2840.544) (-2840.866) (-2833.544) [-2839.480] * (-2831.619) [-2837.317] (-2839.561) (-2841.057) -- 0:07:13 183500 -- (-2838.308) (-2835.414) [-2833.463] (-2845.767) * (-2838.978) [-2845.105] (-2841.107) (-2843.929) -- 0:07:11 184000 -- (-2831.244) (-2853.140) [-2831.332] (-2842.289) * (-2840.914) [-2841.518] (-2830.122) (-2841.682) -- 0:07:10 184500 -- (-2825.952) (-2833.421) (-2839.948) [-2833.754] * (-2836.191) (-2843.958) [-2831.547] (-2840.105) -- 0:07:13 185000 -- (-2834.315) (-2831.929) [-2827.701] (-2841.114) * [-2829.152] (-2835.784) (-2837.298) (-2827.805) -- 0:07:11 Average standard deviation of split frequencies: 0.022214 185500 -- (-2835.720) [-2831.986] (-2836.697) (-2845.246) * (-2834.342) (-2843.360) (-2834.461) [-2833.728] -- 0:07:10 186000 -- [-2831.224] (-2828.047) (-2830.569) (-2847.323) * (-2844.522) (-2835.738) [-2835.065] (-2843.812) -- 0:07:08 186500 -- (-2833.460) [-2833.428] (-2836.226) (-2834.289) * (-2840.548) (-2839.480) [-2834.944] (-2833.725) -- 0:07:11 187000 -- (-2833.932) (-2833.007) (-2844.162) [-2828.855] * (-2841.757) (-2825.565) (-2838.135) [-2838.128] -- 0:07:10 187500 -- (-2835.032) [-2833.227] (-2841.323) (-2828.977) * [-2840.751] (-2838.290) (-2835.654) (-2829.682) -- 0:07:09 188000 -- [-2835.215] (-2838.963) (-2840.653) (-2835.902) * (-2837.626) (-2835.769) [-2843.869] (-2837.153) -- 0:07:07 188500 -- (-2832.772) (-2845.048) (-2843.392) [-2824.949] * (-2840.056) (-2838.759) [-2846.134] (-2844.825) -- 0:07:10 189000 -- (-2834.693) (-2838.047) [-2831.653] (-2836.440) * [-2833.840] (-2846.423) (-2838.743) (-2845.326) -- 0:07:09 189500 -- (-2834.310) [-2834.243] (-2828.005) (-2835.030) * (-2828.720) (-2835.472) (-2848.325) [-2832.408] -- 0:07:07 190000 -- [-2835.354] (-2833.255) (-2833.352) (-2834.752) * [-2839.149] (-2843.677) (-2830.540) (-2828.811) -- 0:07:06 Average standard deviation of split frequencies: 0.021961 190500 -- (-2841.121) [-2831.040] (-2839.540) (-2829.220) * (-2836.889) (-2835.095) (-2837.101) [-2827.567] -- 0:07:09 191000 -- [-2831.349] (-2838.652) (-2841.940) (-2827.549) * (-2831.565) (-2852.817) [-2828.560] (-2848.017) -- 0:07:07 191500 -- (-2830.408) [-2827.061] (-2840.317) (-2826.440) * [-2832.065] (-2842.486) (-2829.107) (-2843.314) -- 0:07:06 192000 -- (-2836.550) (-2835.069) (-2843.644) [-2829.386] * (-2833.286) [-2834.557] (-2832.691) (-2837.300) -- 0:07:05 192500 -- (-2833.229) [-2827.333] (-2841.320) (-2841.356) * (-2838.400) (-2833.022) [-2835.899] (-2834.452) -- 0:07:07 193000 -- (-2834.185) (-2835.084) (-2844.113) [-2837.347] * (-2836.319) (-2839.384) (-2839.682) [-2833.971] -- 0:07:06 193500 -- (-2830.171) [-2825.750] (-2835.286) (-2843.963) * (-2840.651) [-2831.452] (-2845.775) (-2828.881) -- 0:07:05 194000 -- (-2830.407) (-2834.871) [-2833.839] (-2837.687) * [-2830.712] (-2831.151) (-2846.955) (-2831.460) -- 0:07:03 194500 -- (-2827.304) (-2839.572) [-2837.767] (-2834.215) * (-2832.700) (-2834.781) [-2834.617] (-2833.795) -- 0:07:06 195000 -- [-2831.190] (-2833.367) (-2839.839) (-2830.081) * [-2826.772] (-2837.587) (-2829.999) (-2845.228) -- 0:07:05 Average standard deviation of split frequencies: 0.020090 195500 -- (-2832.105) (-2849.025) [-2841.522] (-2833.253) * (-2846.632) (-2832.167) (-2840.912) [-2836.728] -- 0:07:03 196000 -- [-2832.898] (-2842.483) (-2837.344) (-2836.312) * (-2847.504) (-2839.235) (-2837.380) [-2823.056] -- 0:07:02 196500 -- (-2837.472) [-2833.600] (-2840.375) (-2836.832) * (-2842.966) (-2834.624) [-2834.156] (-2836.832) -- 0:07:05 197000 -- (-2847.854) [-2830.637] (-2843.328) (-2827.464) * [-2832.661] (-2838.503) (-2832.433) (-2843.154) -- 0:07:03 197500 -- (-2837.168) [-2839.468] (-2840.777) (-2835.465) * (-2833.821) (-2839.140) (-2830.979) [-2828.508] -- 0:07:02 198000 -- [-2828.257] (-2834.165) (-2833.659) (-2844.744) * [-2835.008] (-2843.713) (-2837.390) (-2839.780) -- 0:07:01 198500 -- [-2830.728] (-2844.076) (-2840.380) (-2833.938) * (-2838.194) (-2843.799) (-2830.722) [-2835.025] -- 0:07:03 199000 -- (-2830.576) (-2839.569) [-2833.999] (-2834.654) * (-2839.178) [-2833.214] (-2839.312) (-2839.347) -- 0:07:02 199500 -- [-2829.875] (-2840.308) (-2828.762) (-2840.904) * (-2839.134) (-2836.393) (-2828.245) [-2836.311] -- 0:07:01 200000 -- (-2835.831) [-2838.254] (-2840.047) (-2840.598) * [-2838.338] (-2844.241) (-2826.566) (-2834.303) -- 0:07:00 Average standard deviation of split frequencies: 0.022464 200500 -- [-2827.724] (-2836.008) (-2845.703) (-2829.735) * (-2835.370) [-2835.203] (-2832.605) (-2831.886) -- 0:07:02 201000 -- (-2837.022) (-2831.002) [-2829.340] (-2840.597) * (-2834.903) [-2829.195] (-2841.768) (-2826.954) -- 0:07:01 201500 -- (-2833.404) [-2833.977] (-2835.395) (-2836.471) * (-2834.359) (-2829.442) (-2838.711) [-2831.456] -- 0:07:00 202000 -- (-2835.444) (-2838.082) (-2839.341) [-2829.441] * (-2836.557) (-2828.139) (-2833.565) [-2825.546] -- 0:06:58 202500 -- [-2828.081] (-2846.380) (-2834.955) (-2832.700) * [-2834.982] (-2833.805) (-2830.230) (-2827.024) -- 0:07:01 203000 -- (-2832.148) (-2834.366) [-2831.400] (-2836.309) * (-2836.408) (-2839.892) (-2836.678) [-2835.116] -- 0:07:00 203500 -- (-2832.891) (-2841.880) (-2827.858) [-2833.902] * (-2833.790) (-2843.677) [-2826.766] (-2828.639) -- 0:06:58 204000 -- (-2845.228) [-2834.815] (-2838.409) (-2831.263) * (-2836.328) (-2853.757) (-2835.319) [-2835.069] -- 0:06:57 204500 -- (-2851.901) (-2837.226) (-2835.276) [-2827.202] * [-2828.728] (-2839.542) (-2837.867) (-2837.892) -- 0:07:00 205000 -- (-2837.208) [-2837.632] (-2828.815) (-2843.325) * (-2835.784) [-2839.302] (-2831.277) (-2834.746) -- 0:06:58 Average standard deviation of split frequencies: 0.018307 205500 -- [-2831.833] (-2848.463) (-2828.353) (-2838.210) * (-2833.200) (-2845.343) (-2832.173) [-2835.787] -- 0:06:57 206000 -- (-2836.504) (-2835.029) [-2831.168] (-2847.464) * (-2833.286) [-2837.199] (-2843.454) (-2841.534) -- 0:06:56 206500 -- (-2836.501) (-2833.885) [-2834.176] (-2845.241) * (-2841.751) [-2830.425] (-2832.549) (-2839.085) -- 0:06:58 207000 -- [-2824.624] (-2834.598) (-2837.708) (-2834.638) * (-2837.832) (-2832.624) (-2833.724) [-2833.105] -- 0:06:57 207500 -- (-2841.558) [-2826.232] (-2846.969) (-2833.908) * (-2833.917) [-2829.705] (-2830.981) (-2837.648) -- 0:06:56 208000 -- (-2834.712) (-2826.445) (-2835.611) [-2828.944] * (-2831.785) (-2844.912) [-2825.187] (-2836.382) -- 0:06:55 208500 -- (-2835.392) (-2832.742) [-2837.123] (-2835.608) * (-2837.033) (-2839.214) (-2834.603) [-2831.137] -- 0:06:57 209000 -- (-2836.193) (-2843.498) [-2826.046] (-2830.502) * (-2839.746) (-2844.560) (-2834.429) [-2834.941] -- 0:06:56 209500 -- (-2836.066) (-2836.079) (-2832.998) [-2838.570] * (-2840.450) (-2839.018) (-2838.917) [-2831.945] -- 0:06:55 210000 -- (-2850.086) (-2836.030) [-2827.599] (-2838.398) * (-2835.259) (-2833.348) [-2834.006] (-2834.525) -- 0:06:53 Average standard deviation of split frequencies: 0.017507 210500 -- (-2846.551) [-2833.673] (-2836.607) (-2836.469) * (-2844.156) [-2834.584] (-2831.206) (-2841.517) -- 0:06:56 211000 -- [-2833.985] (-2836.458) (-2839.622) (-2838.817) * [-2834.751] (-2842.268) (-2839.564) (-2841.191) -- 0:06:55 211500 -- (-2841.436) (-2840.652) (-2844.200) [-2837.009] * (-2834.404) (-2844.455) [-2833.638] (-2834.896) -- 0:06:53 212000 -- (-2829.960) [-2827.386] (-2838.979) (-2832.443) * (-2839.929) [-2833.651] (-2838.551) (-2839.352) -- 0:06:52 212500 -- (-2829.318) (-2840.397) (-2836.811) [-2830.738] * (-2834.085) (-2843.859) (-2827.797) [-2825.415] -- 0:06:55 213000 -- (-2829.362) [-2833.439] (-2845.899) (-2843.632) * (-2832.647) (-2844.330) (-2835.892) [-2826.131] -- 0:06:53 213500 -- (-2828.094) [-2839.844] (-2833.332) (-2842.968) * (-2833.347) (-2843.077) (-2847.896) [-2836.193] -- 0:06:52 214000 -- (-2847.480) [-2837.689] (-2837.339) (-2834.127) * (-2832.898) (-2853.286) [-2828.774] (-2835.795) -- 0:06:51 214500 -- (-2846.222) [-2833.705] (-2835.680) (-2835.641) * (-2845.111) (-2839.786) [-2835.838] (-2829.844) -- 0:06:53 215000 -- (-2833.517) (-2830.648) [-2825.570] (-2832.557) * (-2838.250) [-2833.535] (-2835.246) (-2835.821) -- 0:06:52 Average standard deviation of split frequencies: 0.018414 215500 -- (-2832.686) (-2831.329) [-2834.686] (-2835.734) * (-2839.119) [-2832.889] (-2835.919) (-2833.144) -- 0:06:51 216000 -- [-2830.550] (-2835.447) (-2837.177) (-2828.096) * (-2837.015) [-2833.755] (-2845.367) (-2838.914) -- 0:06:53 216500 -- (-2830.404) (-2852.484) [-2837.956] (-2830.717) * (-2832.405) (-2839.559) [-2837.544] (-2841.959) -- 0:06:52 217000 -- [-2829.383] (-2838.400) (-2838.540) (-2837.775) * (-2842.410) [-2832.386] (-2841.437) (-2843.383) -- 0:06:51 217500 -- (-2836.643) (-2835.504) (-2828.247) [-2835.786] * (-2836.964) [-2826.959] (-2831.415) (-2841.099) -- 0:06:50 218000 -- (-2833.815) (-2830.149) (-2830.679) [-2840.533] * [-2830.622] (-2833.308) (-2849.203) (-2834.132) -- 0:06:52 218500 -- [-2835.403] (-2831.099) (-2830.762) (-2835.966) * (-2834.161) (-2829.580) (-2842.007) [-2830.624] -- 0:06:51 219000 -- [-2838.770] (-2842.712) (-2832.907) (-2849.207) * (-2831.478) [-2831.396] (-2841.050) (-2830.844) -- 0:06:50 219500 -- (-2832.069) [-2832.784] (-2845.701) (-2835.801) * (-2835.051) (-2835.855) [-2833.478] (-2829.981) -- 0:06:48 220000 -- (-2832.187) (-2839.606) (-2839.632) [-2837.582] * (-2845.057) (-2830.065) (-2835.681) [-2830.426] -- 0:06:51 Average standard deviation of split frequencies: 0.016957 220500 -- [-2834.890] (-2826.969) (-2843.178) (-2838.956) * (-2840.815) [-2833.150] (-2837.760) (-2836.119) -- 0:06:50 221000 -- (-2836.618) [-2828.614] (-2832.482) (-2849.155) * [-2833.945] (-2828.857) (-2832.471) (-2841.268) -- 0:06:48 221500 -- (-2845.397) (-2838.338) [-2832.168] (-2828.055) * (-2848.063) (-2836.023) [-2830.847] (-2839.672) -- 0:06:47 222000 -- (-2843.149) [-2830.264] (-2834.940) (-2832.999) * (-2832.393) (-2833.067) (-2838.711) [-2837.971] -- 0:06:50 222500 -- (-2839.482) (-2834.341) [-2836.280] (-2833.250) * [-2830.003] (-2838.667) (-2840.121) (-2839.010) -- 0:06:48 223000 -- (-2830.779) [-2825.363] (-2840.442) (-2848.406) * (-2827.475) (-2848.641) [-2829.211] (-2832.732) -- 0:06:47 223500 -- [-2828.009] (-2830.991) (-2841.732) (-2832.483) * [-2829.758] (-2845.600) (-2837.194) (-2833.819) -- 0:06:46 224000 -- [-2824.236] (-2833.512) (-2843.413) (-2833.817) * (-2842.715) [-2828.476] (-2844.835) (-2833.690) -- 0:06:48 224500 -- [-2830.605] (-2835.144) (-2841.953) (-2833.175) * (-2840.275) (-2845.438) (-2840.374) [-2838.745] -- 0:06:47 225000 -- (-2835.367) (-2829.944) [-2832.358] (-2842.884) * (-2836.900) (-2845.825) [-2834.101] (-2853.697) -- 0:06:46 Average standard deviation of split frequencies: 0.016035 225500 -- (-2847.825) (-2826.944) (-2829.676) [-2834.489] * (-2835.616) (-2841.332) [-2836.132] (-2835.628) -- 0:06:45 226000 -- (-2830.011) [-2838.924] (-2835.265) (-2827.287) * (-2834.018) (-2839.653) [-2833.931] (-2840.024) -- 0:06:47 226500 -- (-2835.574) (-2838.962) [-2826.868] (-2836.548) * (-2835.369) (-2839.488) (-2828.749) [-2825.770] -- 0:06:46 227000 -- (-2842.570) (-2833.545) (-2838.928) [-2833.430] * [-2836.038] (-2838.448) (-2835.823) (-2840.241) -- 0:06:45 227500 -- (-2847.198) (-2828.844) [-2829.240] (-2834.274) * (-2839.102) (-2848.984) [-2839.235] (-2835.762) -- 0:06:44 228000 -- [-2831.374] (-2835.107) (-2833.116) (-2830.055) * (-2825.915) (-2831.206) [-2838.657] (-2846.929) -- 0:06:46 228500 -- [-2832.715] (-2836.280) (-2841.237) (-2838.655) * (-2843.291) (-2835.500) [-2826.705] (-2839.850) -- 0:06:45 229000 -- (-2831.704) (-2833.470) (-2843.435) [-2828.094] * (-2835.902) (-2831.056) [-2827.070] (-2851.042) -- 0:06:44 229500 -- [-2838.289] (-2841.107) (-2842.358) (-2841.958) * (-2839.144) [-2829.791] (-2830.149) (-2844.364) -- 0:06:42 230000 -- (-2844.617) (-2841.792) (-2833.544) [-2834.710] * (-2839.263) (-2826.102) [-2830.308] (-2831.146) -- 0:06:45 Average standard deviation of split frequencies: 0.014944 230500 -- (-2832.799) (-2834.901) [-2827.187] (-2840.600) * (-2837.124) (-2835.963) (-2833.280) [-2828.515] -- 0:06:43 231000 -- (-2839.240) (-2835.435) [-2832.747] (-2836.252) * (-2833.043) [-2837.191] (-2834.609) (-2846.134) -- 0:06:42 231500 -- (-2842.132) (-2837.090) (-2831.065) [-2833.805] * (-2834.974) (-2844.118) (-2831.480) [-2845.975] -- 0:06:41 232000 -- [-2832.689] (-2848.967) (-2838.821) (-2842.001) * [-2833.571] (-2840.563) (-2832.341) (-2844.174) -- 0:06:43 232500 -- (-2835.273) (-2837.013) [-2831.710] (-2835.125) * (-2839.812) (-2832.551) (-2846.644) [-2835.040] -- 0:06:42 233000 -- [-2835.349] (-2854.140) (-2836.014) (-2835.424) * (-2838.431) (-2836.392) (-2839.678) [-2830.397] -- 0:06:41 233500 -- (-2834.535) [-2830.550] (-2843.834) (-2846.967) * [-2836.784] (-2830.754) (-2832.795) (-2835.095) -- 0:06:40 234000 -- (-2838.172) [-2835.646] (-2844.325) (-2838.730) * (-2835.144) [-2826.420] (-2836.106) (-2847.079) -- 0:06:42 234500 -- (-2844.616) (-2825.302) (-2836.078) [-2828.641] * (-2833.415) (-2834.223) [-2833.233] (-2848.097) -- 0:06:41 235000 -- [-2830.736] (-2833.150) (-2835.270) (-2831.588) * (-2839.908) [-2832.335] (-2836.160) (-2842.367) -- 0:06:40 Average standard deviation of split frequencies: 0.014687 235500 -- (-2837.923) (-2832.948) [-2832.689] (-2829.619) * (-2848.251) [-2833.739] (-2828.629) (-2829.428) -- 0:06:39 236000 -- [-2838.415] (-2830.760) (-2837.950) (-2832.826) * (-2838.791) (-2852.563) [-2828.465] (-2840.769) -- 0:06:41 236500 -- (-2841.366) (-2843.153) (-2844.622) [-2827.459] * (-2836.572) [-2841.197] (-2837.914) (-2836.985) -- 0:06:40 237000 -- (-2836.635) (-2831.956) (-2838.349) [-2832.139] * (-2833.687) (-2841.644) [-2833.577] (-2835.602) -- 0:06:39 237500 -- (-2834.365) (-2839.525) [-2837.339] (-2829.377) * (-2839.587) (-2834.588) (-2840.234) [-2834.084] -- 0:06:38 238000 -- (-2831.689) (-2841.641) (-2837.949) [-2828.375] * (-2842.658) [-2834.597] (-2834.839) (-2831.009) -- 0:06:40 238500 -- (-2844.375) (-2840.077) (-2831.587) [-2835.789] * (-2832.292) (-2837.812) [-2827.384] (-2832.202) -- 0:06:39 239000 -- (-2839.814) [-2829.625] (-2838.368) (-2835.795) * (-2833.719) [-2842.160] (-2829.864) (-2836.126) -- 0:06:38 239500 -- (-2840.279) [-2833.860] (-2836.949) (-2834.566) * (-2833.697) (-2852.265) [-2831.070] (-2834.635) -- 0:06:36 240000 -- (-2847.316) (-2829.387) (-2837.435) [-2833.883] * (-2836.619) (-2837.094) (-2826.033) [-2827.798] -- 0:06:39 Average standard deviation of split frequencies: 0.014748 240500 -- [-2833.677] (-2847.025) (-2848.206) (-2842.181) * (-2837.148) (-2839.073) [-2831.802] (-2834.648) -- 0:06:37 241000 -- (-2842.521) (-2848.112) [-2837.580] (-2833.978) * (-2841.338) [-2839.402] (-2838.911) (-2835.719) -- 0:06:36 241500 -- (-2837.664) (-2837.883) [-2835.794] (-2836.088) * (-2831.481) [-2833.084] (-2834.815) (-2836.462) -- 0:06:38 242000 -- (-2833.490) (-2833.241) [-2834.710] (-2838.326) * (-2831.765) [-2832.354] (-2838.664) (-2835.929) -- 0:06:37 242500 -- (-2834.355) (-2842.346) [-2830.344] (-2839.852) * (-2833.083) (-2827.740) [-2836.512] (-2830.609) -- 0:06:36 243000 -- [-2825.643] (-2835.871) (-2834.409) (-2834.691) * (-2837.048) (-2835.164) [-2839.462] (-2837.101) -- 0:06:35 243500 -- [-2829.789] (-2831.029) (-2846.967) (-2842.825) * (-2840.630) [-2831.327] (-2834.104) (-2838.422) -- 0:06:37 244000 -- [-2830.589] (-2830.469) (-2839.994) (-2839.477) * (-2838.918) (-2837.852) [-2826.854] (-2844.433) -- 0:06:36 244500 -- (-2829.347) [-2837.824] (-2834.301) (-2839.677) * (-2846.743) (-2832.926) (-2840.365) [-2830.043] -- 0:06:35 245000 -- (-2835.654) (-2829.240) (-2834.135) [-2837.168] * [-2833.708] (-2827.788) (-2843.765) (-2827.730) -- 0:06:34 Average standard deviation of split frequencies: 0.013865 245500 -- [-2832.796] (-2831.460) (-2839.232) (-2837.557) * (-2837.353) [-2830.574] (-2830.125) (-2839.492) -- 0:06:36 246000 -- (-2836.427) (-2834.065) [-2834.964] (-2827.474) * (-2828.946) [-2831.546] (-2847.335) (-2836.197) -- 0:06:35 246500 -- (-2834.442) (-2837.567) [-2829.271] (-2843.679) * (-2843.426) (-2837.421) [-2840.046] (-2836.051) -- 0:06:34 247000 -- (-2848.424) (-2827.618) [-2830.125] (-2830.108) * (-2835.861) (-2829.099) [-2831.913] (-2841.164) -- 0:06:33 247500 -- (-2844.232) [-2835.716] (-2837.530) (-2838.492) * (-2834.783) [-2828.999] (-2832.808) (-2832.890) -- 0:06:35 248000 -- (-2860.769) (-2839.783) [-2827.862] (-2836.691) * [-2830.543] (-2834.485) (-2836.687) (-2836.317) -- 0:06:34 248500 -- (-2847.891) [-2838.867] (-2832.043) (-2847.541) * (-2834.604) [-2827.516] (-2831.505) (-2839.651) -- 0:06:33 249000 -- (-2839.705) (-2833.672) [-2830.497] (-2843.519) * [-2836.451] (-2833.070) (-2838.592) (-2844.438) -- 0:06:35 249500 -- (-2843.636) (-2832.188) [-2835.920] (-2832.777) * [-2828.802] (-2848.060) (-2844.504) (-2839.006) -- 0:06:34 250000 -- (-2843.029) (-2834.980) [-2833.959] (-2829.419) * [-2830.287] (-2832.834) (-2848.433) (-2834.676) -- 0:06:33 Average standard deviation of split frequencies: 0.012832 250500 -- (-2846.991) (-2837.717) [-2829.499] (-2833.590) * [-2823.616] (-2833.149) (-2840.077) (-2834.815) -- 0:06:31 251000 -- (-2837.863) (-2834.080) [-2824.104] (-2836.537) * [-2831.292] (-2832.412) (-2846.430) (-2840.286) -- 0:06:33 251500 -- [-2843.029] (-2836.898) (-2837.785) (-2836.700) * (-2831.316) (-2834.727) (-2853.892) [-2831.037] -- 0:06:32 252000 -- [-2833.514] (-2837.285) (-2836.990) (-2838.698) * (-2842.203) [-2819.270] (-2847.713) (-2842.152) -- 0:06:31 252500 -- (-2831.004) [-2833.243] (-2839.504) (-2836.521) * [-2837.227] (-2834.159) (-2861.636) (-2837.337) -- 0:06:30 253000 -- [-2832.656] (-2830.629) (-2839.661) (-2845.310) * [-2832.034] (-2832.145) (-2835.473) (-2840.185) -- 0:06:32 253500 -- (-2841.785) (-2833.413) (-2839.085) [-2838.692] * (-2853.131) (-2837.275) [-2831.361] (-2850.523) -- 0:06:31 254000 -- (-2843.510) (-2832.168) (-2836.900) [-2833.335] * (-2837.548) [-2825.350] (-2826.007) (-2831.375) -- 0:06:30 254500 -- [-2830.539] (-2833.043) (-2843.966) (-2834.519) * (-2839.995) (-2831.364) (-2832.837) [-2835.177] -- 0:06:29 255000 -- [-2830.644] (-2853.299) (-2832.072) (-2833.711) * (-2834.990) (-2834.388) (-2833.069) [-2834.014] -- 0:06:31 Average standard deviation of split frequencies: 0.013005 255500 -- (-2838.439) (-2833.315) [-2832.187] (-2833.149) * [-2830.056] (-2825.969) (-2829.896) (-2854.555) -- 0:06:30 256000 -- (-2830.700) (-2834.707) (-2842.144) [-2836.151] * (-2840.437) [-2829.992] (-2840.021) (-2838.442) -- 0:06:29 256500 -- (-2831.651) (-2836.054) [-2835.906] (-2836.525) * (-2844.407) [-2829.814] (-2837.839) (-2842.330) -- 0:06:28 257000 -- (-2832.820) (-2838.509) (-2830.921) [-2829.208] * (-2833.559) [-2835.268] (-2837.562) (-2846.217) -- 0:06:30 257500 -- [-2831.167] (-2845.584) (-2838.218) (-2838.364) * (-2834.349) (-2830.561) [-2829.770] (-2834.100) -- 0:06:29 258000 -- (-2840.088) [-2831.157] (-2837.451) (-2834.040) * (-2840.932) [-2825.868] (-2846.182) (-2829.598) -- 0:06:28 258500 -- (-2834.874) [-2828.254] (-2845.659) (-2829.930) * (-2834.327) [-2831.011] (-2839.709) (-2834.923) -- 0:06:30 259000 -- [-2831.603] (-2834.962) (-2842.134) (-2834.900) * [-2830.829] (-2833.284) (-2833.343) (-2843.007) -- 0:06:29 259500 -- (-2834.550) (-2841.537) (-2844.894) [-2840.590] * (-2839.269) [-2834.253] (-2834.712) (-2847.769) -- 0:06:28 260000 -- [-2829.188] (-2839.515) (-2835.325) (-2837.053) * (-2837.281) (-2836.035) [-2837.234] (-2826.673) -- 0:06:27 Average standard deviation of split frequencies: 0.012094 260500 -- [-2826.863] (-2838.905) (-2825.279) (-2829.271) * [-2837.610] (-2836.463) (-2838.055) (-2830.918) -- 0:06:28 261000 -- [-2839.418] (-2843.509) (-2838.366) (-2832.723) * (-2831.656) (-2830.592) (-2835.948) [-2830.206] -- 0:06:27 261500 -- (-2839.353) (-2838.045) (-2836.963) [-2829.200] * (-2829.644) (-2830.485) [-2830.229] (-2829.159) -- 0:06:26 262000 -- (-2845.707) [-2833.688] (-2835.059) (-2840.477) * (-2831.738) (-2835.803) [-2826.907] (-2830.801) -- 0:06:25 262500 -- (-2845.002) [-2842.261] (-2828.319) (-2838.155) * (-2838.106) [-2824.337] (-2839.436) (-2828.076) -- 0:06:27 263000 -- (-2837.826) [-2829.396] (-2835.172) (-2841.364) * [-2841.126] (-2830.117) (-2843.640) (-2834.608) -- 0:06:26 263500 -- (-2836.645) (-2833.044) [-2831.156] (-2841.891) * (-2839.750) (-2828.105) (-2838.953) [-2834.373] -- 0:06:25 264000 -- (-2830.401) (-2828.284) (-2843.541) [-2832.856] * (-2840.936) (-2834.809) [-2833.952] (-2839.927) -- 0:06:24 264500 -- (-2837.475) [-2834.427] (-2841.078) (-2836.389) * [-2830.097] (-2841.159) (-2830.633) (-2836.788) -- 0:06:26 265000 -- (-2848.662) (-2826.717) (-2845.436) [-2837.505] * (-2832.995) [-2838.291] (-2835.074) (-2836.043) -- 0:06:25 Average standard deviation of split frequencies: 0.012295 265500 -- (-2840.708) [-2841.974] (-2829.901) (-2836.294) * (-2829.117) (-2841.039) (-2839.110) [-2835.275] -- 0:06:24 266000 -- (-2842.838) (-2832.675) [-2836.534] (-2832.920) * (-2839.044) (-2834.740) [-2834.818] (-2839.012) -- 0:06:23 266500 -- [-2835.366] (-2839.164) (-2837.628) (-2835.155) * (-2834.944) [-2833.656] (-2832.727) (-2832.847) -- 0:06:25 267000 -- (-2835.775) [-2832.369] (-2840.461) (-2833.399) * (-2837.049) (-2837.933) [-2836.992] (-2844.815) -- 0:06:24 267500 -- (-2830.948) (-2840.903) [-2832.696] (-2843.999) * [-2830.007] (-2835.421) (-2836.026) (-2842.570) -- 0:06:23 268000 -- (-2828.858) (-2847.464) [-2832.819] (-2834.939) * [-2825.376] (-2837.236) (-2834.782) (-2835.557) -- 0:06:22 268500 -- (-2838.364) [-2832.919] (-2835.236) (-2834.328) * (-2836.121) (-2837.578) (-2844.553) [-2834.033] -- 0:06:24 269000 -- (-2838.872) [-2832.311] (-2842.740) (-2832.931) * (-2841.359) (-2833.921) (-2838.675) [-2832.387] -- 0:06:23 269500 -- [-2833.888] (-2831.473) (-2847.607) (-2829.317) * (-2835.096) [-2830.083] (-2834.835) (-2843.089) -- 0:06:22 270000 -- (-2830.288) (-2843.501) [-2826.114] (-2831.208) * (-2850.062) (-2838.043) (-2841.586) [-2833.029] -- 0:06:21 Average standard deviation of split frequencies: 0.013498 270500 -- [-2840.824] (-2846.074) (-2834.983) (-2832.797) * (-2836.513) (-2830.883) [-2834.924] (-2826.388) -- 0:06:22 271000 -- (-2836.131) (-2837.258) [-2834.843] (-2834.737) * (-2844.782) [-2831.600] (-2842.024) (-2835.571) -- 0:06:21 271500 -- (-2839.146) [-2838.401] (-2841.841) (-2829.389) * (-2837.821) (-2837.569) (-2840.109) [-2836.498] -- 0:06:21 272000 -- (-2830.207) (-2844.248) (-2836.111) [-2829.292] * (-2839.739) [-2840.919] (-2850.697) (-2838.666) -- 0:06:20 272500 -- (-2829.504) (-2850.046) (-2840.527) [-2832.977] * (-2829.081) [-2830.902] (-2830.864) (-2833.148) -- 0:06:21 273000 -- (-2832.200) (-2834.557) [-2830.293] (-2830.287) * (-2829.276) (-2858.172) (-2843.693) [-2828.801] -- 0:06:20 273500 -- (-2845.082) (-2833.495) (-2831.225) [-2823.939] * (-2833.051) (-2836.333) [-2836.845] (-2827.577) -- 0:06:19 274000 -- (-2827.813) [-2836.149] (-2839.843) (-2840.546) * (-2838.707) (-2846.179) (-2844.718) [-2830.642] -- 0:06:18 274500 -- [-2829.282] (-2830.572) (-2839.939) (-2843.637) * (-2829.890) (-2845.880) [-2826.107] (-2832.910) -- 0:06:20 275000 -- (-2830.115) [-2835.981] (-2837.797) (-2847.247) * [-2825.359] (-2838.970) (-2833.431) (-2837.589) -- 0:06:19 Average standard deviation of split frequencies: 0.015692 275500 -- [-2829.805] (-2835.935) (-2846.293) (-2840.492) * [-2828.664] (-2844.818) (-2834.607) (-2832.751) -- 0:06:18 276000 -- (-2828.043) [-2836.448] (-2839.429) (-2837.862) * (-2832.074) (-2831.136) (-2843.067) [-2829.847] -- 0:06:17 276500 -- (-2833.627) [-2833.786] (-2838.309) (-2830.309) * (-2836.223) (-2833.902) (-2833.788) [-2827.884] -- 0:06:19 277000 -- (-2833.656) [-2828.697] (-2826.890) (-2840.534) * [-2836.224] (-2835.946) (-2828.495) (-2831.748) -- 0:06:18 277500 -- (-2843.891) (-2829.968) [-2830.549] (-2838.411) * [-2829.621] (-2842.126) (-2829.557) (-2836.640) -- 0:06:17 278000 -- (-2848.576) (-2836.897) [-2831.132] (-2839.447) * [-2834.705] (-2833.799) (-2840.111) (-2831.707) -- 0:06:16 278500 -- (-2842.455) (-2832.409) (-2835.944) [-2831.069] * [-2827.537] (-2830.488) (-2833.970) (-2839.057) -- 0:06:18 279000 -- (-2840.438) (-2833.617) (-2840.133) [-2829.403] * (-2832.930) [-2831.173] (-2834.298) (-2836.675) -- 0:06:17 279500 -- (-2838.959) (-2836.687) [-2831.793] (-2833.592) * (-2835.983) (-2833.661) (-2833.970) [-2836.198] -- 0:06:16 280000 -- (-2841.886) [-2831.636] (-2832.712) (-2837.358) * (-2836.054) (-2826.578) [-2827.204] (-2837.837) -- 0:06:15 Average standard deviation of split frequencies: 0.016901 280500 -- (-2837.115) [-2838.072] (-2832.635) (-2828.414) * (-2845.448) [-2832.776] (-2830.650) (-2843.334) -- 0:06:17 281000 -- (-2838.588) [-2824.484] (-2834.610) (-2836.497) * (-2832.069) [-2833.844] (-2842.949) (-2828.450) -- 0:06:16 281500 -- (-2833.785) [-2834.503] (-2834.533) (-2833.089) * (-2834.438) (-2837.265) [-2839.647] (-2834.595) -- 0:06:15 282000 -- (-2830.205) (-2833.305) (-2832.280) [-2838.688] * [-2837.800] (-2831.094) (-2838.766) (-2831.952) -- 0:06:16 282500 -- (-2836.292) (-2830.952) [-2829.412] (-2847.181) * (-2842.090) [-2828.251] (-2836.026) (-2833.107) -- 0:06:15 283000 -- [-2832.207] (-2830.888) (-2834.376) (-2831.286) * (-2834.283) [-2841.259] (-2832.594) (-2833.771) -- 0:06:14 283500 -- (-2833.525) [-2828.196] (-2845.365) (-2830.674) * (-2830.160) (-2828.508) (-2830.252) [-2827.311] -- 0:06:14 284000 -- (-2826.202) [-2836.556] (-2834.081) (-2835.657) * (-2835.510) [-2836.143] (-2829.222) (-2830.806) -- 0:06:15 284500 -- (-2823.004) [-2835.302] (-2835.060) (-2849.116) * [-2827.090] (-2843.912) (-2836.927) (-2837.414) -- 0:06:14 285000 -- [-2838.524] (-2832.845) (-2851.249) (-2836.216) * (-2835.979) (-2842.330) [-2842.687] (-2828.291) -- 0:06:13 Average standard deviation of split frequencies: 0.015998 285500 -- [-2835.140] (-2835.912) (-2836.163) (-2856.421) * [-2835.909] (-2834.643) (-2837.404) (-2833.283) -- 0:06:12 286000 -- [-2827.455] (-2838.859) (-2835.203) (-2835.397) * [-2836.807] (-2842.531) (-2836.348) (-2836.372) -- 0:06:14 286500 -- (-2836.263) (-2838.774) (-2849.574) [-2828.816] * (-2845.799) (-2842.684) [-2832.620] (-2845.905) -- 0:06:13 287000 -- [-2831.347] (-2833.103) (-2843.099) (-2830.750) * (-2844.618) [-2831.100] (-2844.440) (-2832.222) -- 0:06:12 287500 -- (-2828.753) [-2830.861] (-2834.261) (-2834.879) * (-2836.421) (-2833.195) (-2829.925) [-2835.852] -- 0:06:11 288000 -- (-2835.417) (-2831.430) (-2838.901) [-2838.719] * (-2836.524) (-2837.803) [-2830.616] (-2836.196) -- 0:06:13 288500 -- (-2832.613) [-2844.376] (-2834.699) (-2840.647) * (-2840.416) [-2834.647] (-2825.439) (-2830.632) -- 0:06:12 289000 -- (-2837.047) (-2838.310) [-2825.584] (-2840.666) * [-2844.471] (-2827.399) (-2836.383) (-2847.144) -- 0:06:11 289500 -- (-2831.104) (-2831.241) [-2834.617] (-2837.771) * [-2829.859] (-2825.263) (-2834.012) (-2844.544) -- 0:06:10 290000 -- [-2832.134] (-2836.762) (-2836.675) (-2843.076) * (-2835.968) (-2842.419) [-2829.205] (-2836.382) -- 0:06:12 Average standard deviation of split frequencies: 0.015359 290500 -- (-2828.305) (-2835.991) (-2830.650) [-2836.757] * [-2830.093] (-2834.575) (-2838.491) (-2836.307) -- 0:06:11 291000 -- (-2834.032) (-2831.843) [-2831.897] (-2832.095) * [-2837.344] (-2835.921) (-2831.141) (-2840.682) -- 0:06:10 291500 -- (-2826.755) (-2859.880) (-2832.246) [-2835.887] * (-2835.978) (-2842.831) [-2841.533] (-2832.098) -- 0:06:09 292000 -- (-2830.484) (-2836.572) [-2829.789] (-2840.777) * (-2847.871) [-2839.133] (-2831.690) (-2838.323) -- 0:06:10 292500 -- (-2826.635) (-2844.512) (-2837.240) [-2831.950] * (-2837.638) [-2830.887] (-2830.286) (-2840.074) -- 0:06:10 293000 -- (-2832.957) (-2833.477) (-2825.588) [-2839.048] * (-2833.987) (-2833.898) (-2830.344) [-2830.564] -- 0:06:09 293500 -- (-2836.955) [-2828.517] (-2831.405) (-2847.092) * (-2829.589) (-2842.760) [-2828.453] (-2841.004) -- 0:06:08 294000 -- (-2833.467) (-2832.634) [-2834.747] (-2849.817) * [-2829.966] (-2836.524) (-2844.184) (-2827.955) -- 0:06:09 294500 -- (-2833.179) (-2839.110) [-2829.633] (-2833.025) * (-2828.524) (-2830.853) (-2848.173) [-2827.846] -- 0:06:08 295000 -- (-2830.798) (-2836.210) (-2837.259) [-2833.484] * (-2841.750) (-2837.848) (-2833.688) [-2832.782] -- 0:06:08 Average standard deviation of split frequencies: 0.014831 295500 -- (-2838.454) (-2830.255) [-2832.532] (-2844.332) * (-2838.427) [-2832.748] (-2834.819) (-2837.676) -- 0:06:07 296000 -- (-2842.860) (-2836.163) (-2829.285) [-2834.602] * (-2835.675) (-2834.001) [-2832.955] (-2848.038) -- 0:06:08 296500 -- (-2844.680) (-2831.757) (-2830.373) [-2833.096] * (-2833.720) [-2829.705] (-2837.006) (-2833.906) -- 0:06:07 297000 -- (-2835.853) (-2841.957) [-2833.253] (-2842.248) * (-2846.788) (-2833.020) [-2836.728] (-2839.171) -- 0:06:06 297500 -- (-2831.678) (-2831.575) (-2840.158) [-2834.966] * (-2836.788) [-2827.544] (-2843.933) (-2838.783) -- 0:06:06 298000 -- [-2831.329] (-2832.592) (-2830.997) (-2829.206) * (-2851.895) [-2832.623] (-2842.546) (-2838.413) -- 0:06:07 298500 -- (-2831.959) [-2831.066] (-2833.518) (-2827.533) * (-2842.732) (-2831.688) [-2829.849] (-2830.911) -- 0:06:06 299000 -- (-2836.895) (-2833.388) (-2829.655) [-2836.114] * (-2831.530) [-2841.267] (-2833.409) (-2838.662) -- 0:06:05 299500 -- (-2825.797) (-2842.814) [-2828.993] (-2839.027) * [-2836.380] (-2838.699) (-2838.369) (-2840.172) -- 0:06:04 300000 -- (-2832.428) [-2829.313] (-2828.963) (-2834.852) * (-2840.251) [-2828.164] (-2837.213) (-2831.699) -- 0:06:06 Average standard deviation of split frequencies: 0.014797 300500 -- (-2837.055) [-2836.361] (-2829.107) (-2835.002) * [-2839.088] (-2837.624) (-2853.100) (-2837.211) -- 0:06:05 301000 -- (-2832.995) (-2832.750) [-2832.554] (-2833.123) * (-2833.528) (-2831.282) [-2831.798] (-2831.931) -- 0:06:04 301500 -- (-2833.532) (-2832.791) (-2824.548) [-2835.689] * (-2830.553) [-2833.886] (-2836.172) (-2839.162) -- 0:06:03 302000 -- (-2837.335) (-2837.483) [-2832.404] (-2834.064) * (-2835.196) (-2839.403) [-2830.387] (-2835.877) -- 0:06:05 302500 -- (-2844.905) [-2838.918] (-2830.791) (-2845.895) * (-2841.544) (-2837.079) [-2829.329] (-2831.338) -- 0:06:04 303000 -- (-2836.426) [-2836.839] (-2827.650) (-2847.868) * (-2830.807) (-2831.954) [-2837.448] (-2834.188) -- 0:06:03 303500 -- [-2839.690] (-2838.649) (-2834.704) (-2842.165) * [-2828.221] (-2836.157) (-2833.864) (-2845.130) -- 0:06:02 304000 -- [-2834.666] (-2832.012) (-2827.533) (-2851.256) * (-2835.647) [-2841.841] (-2835.814) (-2852.639) -- 0:06:04 304500 -- (-2840.393) (-2831.692) [-2830.819] (-2830.922) * (-2844.252) [-2827.695] (-2836.867) (-2831.851) -- 0:06:03 305000 -- [-2829.223] (-2827.868) (-2837.954) (-2846.370) * (-2844.452) (-2838.692) (-2826.453) [-2827.961] -- 0:06:02 Average standard deviation of split frequencies: 0.015309 305500 -- [-2828.050] (-2834.947) (-2838.667) (-2836.778) * (-2846.692) (-2840.715) (-2838.307) [-2838.977] -- 0:06:01 306000 -- (-2838.142) (-2838.699) (-2832.589) [-2831.077] * (-2836.571) (-2838.015) (-2839.454) [-2833.075] -- 0:06:02 306500 -- [-2831.599] (-2833.397) (-2838.348) (-2838.601) * (-2837.801) (-2830.005) [-2840.217] (-2832.412) -- 0:06:02 307000 -- (-2845.525) (-2839.574) (-2836.483) [-2832.977] * (-2839.484) (-2839.254) [-2833.073] (-2837.934) -- 0:06:01 307500 -- (-2836.989) (-2833.190) (-2840.377) [-2823.075] * (-2830.877) (-2839.197) (-2845.482) [-2833.080] -- 0:06:02 308000 -- (-2847.917) [-2835.392] (-2850.182) (-2827.578) * (-2830.378) (-2839.700) [-2831.330] (-2840.730) -- 0:06:01 308500 -- (-2842.505) [-2828.598] (-2837.754) (-2841.508) * (-2836.767) (-2836.366) [-2834.232] (-2832.868) -- 0:06:00 309000 -- (-2831.194) (-2832.459) [-2837.281] (-2834.701) * (-2836.175) (-2832.742) (-2832.376) [-2838.554] -- 0:06:00 309500 -- [-2834.630] (-2837.748) (-2842.909) (-2832.852) * (-2833.553) (-2837.773) [-2827.637] (-2849.060) -- 0:06:01 310000 -- (-2831.976) [-2837.824] (-2842.295) (-2841.437) * [-2829.529] (-2834.382) (-2844.169) (-2844.673) -- 0:06:00 Average standard deviation of split frequencies: 0.014795 310500 -- (-2827.557) [-2838.694] (-2843.570) (-2850.033) * (-2834.011) (-2822.853) [-2829.097] (-2834.994) -- 0:05:59 311000 -- (-2830.102) (-2843.468) [-2824.026] (-2843.229) * (-2847.172) [-2830.916] (-2836.449) (-2846.015) -- 0:05:58 311500 -- [-2838.263] (-2837.696) (-2838.602) (-2826.711) * (-2838.387) [-2827.843] (-2825.671) (-2840.456) -- 0:06:00 312000 -- (-2843.635) [-2833.545] (-2829.446) (-2833.746) * (-2839.859) [-2831.559] (-2833.106) (-2844.297) -- 0:05:59 312500 -- (-2838.045) (-2837.784) [-2824.655] (-2845.467) * [-2835.975] (-2834.172) (-2839.697) (-2836.855) -- 0:05:58 313000 -- (-2852.411) (-2827.348) [-2826.282] (-2829.918) * (-2829.571) (-2829.276) [-2840.059] (-2847.291) -- 0:05:57 313500 -- (-2842.968) (-2837.967) (-2826.508) [-2827.202] * [-2839.730] (-2827.290) (-2827.816) (-2840.622) -- 0:05:59 314000 -- (-2834.110) (-2849.712) [-2831.463] (-2832.197) * [-2825.643] (-2839.042) (-2842.371) (-2833.017) -- 0:05:58 314500 -- [-2840.819] (-2855.665) (-2836.264) (-2829.429) * (-2834.666) (-2835.152) [-2831.618] (-2835.120) -- 0:05:57 315000 -- (-2834.983) (-2850.420) (-2831.927) [-2834.039] * [-2834.871] (-2834.108) (-2842.941) (-2836.793) -- 0:05:56 Average standard deviation of split frequencies: 0.015571 315500 -- [-2829.545] (-2844.054) (-2831.309) (-2833.765) * [-2832.435] (-2840.781) (-2834.955) (-2830.266) -- 0:05:57 316000 -- (-2828.316) (-2831.890) (-2837.602) [-2831.152] * (-2838.237) (-2838.466) (-2832.640) [-2838.524] -- 0:05:57 316500 -- (-2835.448) (-2830.001) [-2834.275] (-2834.407) * (-2831.787) (-2840.554) [-2833.890] (-2829.880) -- 0:05:56 317000 -- (-2841.358) [-2836.962] (-2826.412) (-2832.551) * (-2835.419) (-2838.301) [-2834.457] (-2837.993) -- 0:05:55 317500 -- [-2837.888] (-2840.801) (-2831.902) (-2834.029) * [-2835.603] (-2833.219) (-2835.994) (-2846.487) -- 0:05:56 318000 -- (-2826.442) (-2828.616) [-2831.239] (-2836.206) * (-2839.933) (-2843.645) (-2839.423) [-2830.699] -- 0:05:56 318500 -- (-2836.516) [-2836.112] (-2834.574) (-2847.538) * (-2832.991) (-2838.890) (-2830.428) [-2839.191] -- 0:05:55 319000 -- (-2836.824) [-2832.645] (-2841.340) (-2832.492) * (-2837.035) (-2836.805) [-2835.083] (-2835.123) -- 0:05:54 319500 -- (-2836.814) (-2829.628) (-2835.009) [-2826.862] * [-2837.079] (-2830.570) (-2838.514) (-2836.939) -- 0:05:55 320000 -- (-2851.107) (-2846.905) [-2830.287] (-2843.862) * (-2833.454) (-2830.209) [-2834.031] (-2837.067) -- 0:05:54 Average standard deviation of split frequencies: 0.016538 320500 -- (-2838.124) (-2842.867) [-2834.751] (-2836.586) * (-2833.152) [-2838.301] (-2835.282) (-2837.321) -- 0:05:54 321000 -- (-2841.020) [-2833.334] (-2835.334) (-2833.576) * (-2835.608) (-2840.215) [-2831.184] (-2838.132) -- 0:05:53 321500 -- [-2830.873] (-2835.657) (-2836.592) (-2831.168) * [-2835.274] (-2843.681) (-2832.035) (-2835.712) -- 0:05:54 322000 -- (-2830.605) (-2831.771) (-2829.620) [-2832.691] * (-2839.494) (-2829.194) [-2832.086] (-2837.733) -- 0:05:53 322500 -- (-2848.501) [-2827.792] (-2840.110) (-2832.706) * [-2828.334] (-2834.940) (-2832.842) (-2842.869) -- 0:05:52 323000 -- (-2844.210) [-2828.710] (-2834.995) (-2829.547) * (-2833.311) (-2832.193) (-2846.339) [-2828.828] -- 0:05:52 323500 -- [-2826.986] (-2830.955) (-2834.175) (-2834.039) * [-2831.150] (-2828.345) (-2841.302) (-2839.094) -- 0:05:53 324000 -- (-2830.936) (-2831.564) (-2837.479) [-2830.020] * [-2826.527] (-2832.093) (-2842.896) (-2848.276) -- 0:05:52 324500 -- (-2838.868) (-2839.993) [-2835.047] (-2829.488) * [-2834.524] (-2831.203) (-2837.589) (-2833.229) -- 0:05:51 325000 -- (-2830.908) (-2834.666) (-2837.927) [-2836.987] * (-2840.602) (-2832.166) (-2835.149) [-2837.074] -- 0:05:50 Average standard deviation of split frequencies: 0.014653 325500 -- [-2830.314] (-2837.350) (-2833.826) (-2828.136) * (-2835.552) (-2841.049) (-2830.325) [-2839.855] -- 0:05:52 326000 -- [-2830.384] (-2831.551) (-2845.257) (-2836.212) * [-2829.653] (-2841.562) (-2834.494) (-2843.431) -- 0:05:51 326500 -- (-2839.980) (-2832.081) [-2834.922] (-2830.857) * (-2833.878) [-2829.973] (-2836.680) (-2835.795) -- 0:05:50 327000 -- (-2835.034) (-2838.383) [-2830.343] (-2832.099) * (-2846.225) [-2834.544] (-2836.602) (-2831.596) -- 0:05:49 327500 -- (-2846.145) (-2834.816) [-2827.724] (-2844.025) * (-2833.755) (-2838.566) [-2840.520] (-2830.545) -- 0:05:51 328000 -- (-2853.389) [-2833.125] (-2835.551) (-2843.032) * (-2831.170) [-2840.769] (-2845.020) (-2830.920) -- 0:05:50 328500 -- (-2846.022) [-2835.639] (-2834.943) (-2835.084) * [-2833.604] (-2829.577) (-2829.122) (-2831.561) -- 0:05:49 329000 -- (-2827.589) (-2826.783) [-2833.003] (-2833.184) * [-2831.939] (-2838.144) (-2832.074) (-2839.681) -- 0:05:48 329500 -- (-2833.250) (-2839.103) (-2831.518) [-2831.614] * (-2835.176) [-2826.526] (-2840.303) (-2845.585) -- 0:05:50 330000 -- (-2829.936) (-2844.606) (-2837.136) [-2826.545] * [-2828.038] (-2826.640) (-2835.081) (-2840.358) -- 0:05:49 Average standard deviation of split frequencies: 0.014066 330500 -- (-2834.502) (-2834.484) [-2830.956] (-2829.439) * (-2827.053) [-2826.186] (-2837.129) (-2840.121) -- 0:05:48 331000 -- (-2846.682) (-2843.778) (-2832.229) [-2839.917] * (-2843.546) (-2831.742) [-2841.269] (-2830.666) -- 0:05:47 331500 -- (-2843.115) (-2831.810) (-2834.437) [-2831.563] * (-2828.546) (-2831.684) (-2836.064) [-2830.858] -- 0:05:48 332000 -- [-2835.012] (-2835.311) (-2834.177) (-2841.576) * (-2836.993) (-2833.140) (-2835.729) [-2834.013] -- 0:05:48 332500 -- (-2834.590) (-2834.924) [-2834.291] (-2849.728) * (-2839.057) (-2830.676) (-2836.426) [-2832.613] -- 0:05:47 333000 -- (-2839.234) (-2834.122) [-2829.769] (-2833.495) * [-2836.705] (-2837.373) (-2840.865) (-2833.535) -- 0:05:48 333500 -- [-2843.186] (-2834.158) (-2832.606) (-2842.541) * (-2834.868) [-2828.469] (-2842.067) (-2834.165) -- 0:05:47 334000 -- (-2839.548) (-2840.564) (-2832.427) [-2839.793] * (-2825.230) [-2825.203] (-2834.546) (-2839.253) -- 0:05:46 334500 -- (-2848.154) [-2839.274] (-2839.796) (-2841.188) * (-2834.479) [-2827.469] (-2832.966) (-2837.940) -- 0:05:46 335000 -- (-2840.099) (-2837.790) [-2837.703] (-2839.666) * (-2835.777) [-2833.455] (-2829.397) (-2848.400) -- 0:05:47 Average standard deviation of split frequencies: 0.013562 335500 -- (-2833.731) (-2851.273) (-2835.919) [-2836.366] * (-2836.977) (-2844.483) [-2834.883] (-2838.643) -- 0:05:46 336000 -- (-2838.830) (-2831.192) (-2836.019) [-2831.324] * (-2833.277) [-2834.568] (-2842.443) (-2831.073) -- 0:05:45 336500 -- (-2834.270) (-2843.873) (-2834.919) [-2830.935] * [-2831.888] (-2834.322) (-2835.587) (-2831.541) -- 0:05:45 337000 -- (-2834.419) (-2836.692) (-2840.673) [-2827.977] * [-2835.792] (-2831.250) (-2830.365) (-2854.934) -- 0:05:46 337500 -- (-2852.353) (-2829.363) (-2848.364) [-2831.461] * (-2836.953) (-2828.399) [-2834.131] (-2854.127) -- 0:05:45 338000 -- (-2843.007) [-2836.969] (-2841.189) (-2838.220) * [-2839.412] (-2827.469) (-2841.086) (-2839.699) -- 0:05:44 338500 -- (-2833.808) (-2840.923) (-2839.847) [-2828.171] * [-2829.869] (-2833.885) (-2841.925) (-2839.453) -- 0:05:43 339000 -- [-2834.011] (-2837.087) (-2838.651) (-2829.621) * [-2830.052] (-2840.262) (-2835.942) (-2839.340) -- 0:05:45 339500 -- (-2834.786) (-2847.104) (-2830.228) [-2831.728] * (-2829.327) [-2826.345] (-2841.052) (-2842.489) -- 0:05:44 340000 -- (-2843.499) (-2833.109) (-2836.106) [-2829.771] * [-2830.585] (-2825.576) (-2839.272) (-2837.320) -- 0:05:43 Average standard deviation of split frequencies: 0.014207 340500 -- (-2848.131) [-2834.431] (-2836.395) (-2833.383) * (-2842.117) (-2847.796) (-2839.855) [-2831.458] -- 0:05:42 341000 -- [-2831.923] (-2837.988) (-2834.568) (-2844.108) * (-2847.118) (-2845.777) (-2838.529) [-2833.796] -- 0:05:43 341500 -- (-2846.882) (-2835.455) [-2837.011] (-2845.903) * (-2843.939) (-2846.625) [-2832.234] (-2847.359) -- 0:05:43 342000 -- [-2832.066] (-2837.047) (-2829.571) (-2857.438) * (-2833.842) (-2836.948) (-2837.483) [-2836.160] -- 0:05:42 342500 -- (-2837.647) (-2836.339) [-2835.641] (-2849.201) * (-2844.647) (-2833.584) (-2843.963) [-2832.050] -- 0:05:41 343000 -- (-2833.598) (-2835.419) [-2832.354] (-2842.917) * (-2848.124) (-2838.183) (-2831.438) [-2828.954] -- 0:05:42 343500 -- (-2828.720) (-2836.745) [-2832.944] (-2851.717) * [-2829.727] (-2832.457) (-2835.981) (-2834.536) -- 0:05:42 344000 -- (-2832.331) (-2830.419) [-2834.336] (-2830.034) * (-2832.930) (-2828.673) [-2831.904] (-2836.810) -- 0:05:41 344500 -- (-2831.087) (-2835.018) [-2826.433] (-2853.644) * (-2833.950) [-2833.657] (-2830.862) (-2839.273) -- 0:05:40 345000 -- (-2834.601) [-2827.157] (-2832.013) (-2844.074) * (-2832.511) (-2837.619) (-2834.991) [-2834.238] -- 0:05:41 Average standard deviation of split frequencies: 0.014805 345500 -- (-2830.002) [-2835.205] (-2834.842) (-2835.237) * (-2833.717) [-2849.259] (-2835.936) (-2839.692) -- 0:05:40 346000 -- (-2836.403) [-2829.129] (-2842.828) (-2851.046) * [-2828.207] (-2830.830) (-2843.912) (-2833.657) -- 0:05:40 346500 -- [-2843.924] (-2825.327) (-2840.035) (-2840.762) * [-2840.443] (-2835.996) (-2840.355) (-2839.220) -- 0:05:39 347000 -- (-2833.394) (-2837.008) [-2828.035] (-2827.883) * (-2838.809) [-2829.954] (-2840.936) (-2832.188) -- 0:05:40 347500 -- (-2839.798) (-2834.401) [-2831.774] (-2829.196) * [-2839.048] (-2826.831) (-2844.361) (-2844.360) -- 0:05:39 348000 -- [-2828.451] (-2832.483) (-2843.030) (-2832.987) * (-2840.067) [-2828.129] (-2843.918) (-2837.173) -- 0:05:39 348500 -- (-2834.572) (-2832.886) (-2835.493) [-2833.426] * (-2843.569) (-2843.405) (-2823.690) [-2826.631] -- 0:05:38 349000 -- (-2836.885) [-2839.496] (-2832.551) (-2843.455) * (-2835.784) (-2837.451) [-2839.733] (-2833.377) -- 0:05:39 349500 -- [-2831.500] (-2841.708) (-2837.822) (-2841.483) * [-2829.475] (-2838.979) (-2848.028) (-2836.597) -- 0:05:38 350000 -- (-2832.791) (-2838.822) [-2833.968] (-2838.132) * (-2825.002) (-2831.208) [-2832.003] (-2832.150) -- 0:05:37 Average standard deviation of split frequencies: 0.014787 350500 -- [-2829.015] (-2838.201) (-2833.015) (-2829.547) * [-2835.613] (-2839.345) (-2846.760) (-2841.255) -- 0:05:37 351000 -- (-2832.564) (-2832.199) [-2829.522] (-2843.929) * (-2836.150) (-2846.275) [-2836.057] (-2835.643) -- 0:05:38 351500 -- (-2838.887) (-2831.538) [-2838.060] (-2836.579) * (-2837.063) (-2834.505) (-2831.669) [-2834.922] -- 0:05:37 352000 -- (-2833.425) [-2841.841] (-2831.393) (-2840.681) * (-2834.486) (-2834.406) (-2840.195) [-2840.241] -- 0:05:36 352500 -- [-2830.501] (-2845.797) (-2829.365) (-2842.539) * (-2835.299) (-2840.305) (-2849.297) [-2833.489] -- 0:05:36 353000 -- (-2831.766) (-2837.959) (-2836.579) [-2833.177] * (-2832.178) [-2829.236] (-2837.807) (-2838.669) -- 0:05:37 353500 -- (-2831.499) [-2839.823] (-2840.571) (-2840.055) * (-2843.917) (-2839.945) (-2833.862) [-2826.020] -- 0:05:36 354000 -- (-2830.827) (-2837.488) [-2827.140] (-2835.816) * [-2829.612] (-2853.816) (-2836.875) (-2828.386) -- 0:05:35 354500 -- (-2846.670) (-2842.189) [-2826.514] (-2843.305) * (-2838.292) (-2844.138) [-2835.523] (-2843.838) -- 0:05:35 355000 -- [-2835.436] (-2833.177) (-2835.224) (-2843.304) * (-2835.308) (-2838.878) (-2842.068) [-2826.190] -- 0:05:36 Average standard deviation of split frequencies: 0.014654 355500 -- (-2826.882) [-2836.023] (-2835.070) (-2837.922) * [-2834.795] (-2843.228) (-2839.909) (-2830.034) -- 0:05:35 356000 -- (-2841.608) [-2824.241] (-2834.769) (-2845.679) * (-2839.844) (-2848.139) [-2836.459] (-2835.370) -- 0:05:34 356500 -- (-2834.993) (-2825.597) [-2827.322] (-2835.830) * (-2832.446) [-2835.250] (-2836.093) (-2839.553) -- 0:05:35 357000 -- (-2833.293) [-2829.089] (-2831.585) (-2834.180) * (-2837.490) [-2827.761] (-2831.358) (-2839.235) -- 0:05:35 357500 -- [-2834.086] (-2830.624) (-2836.504) (-2834.634) * (-2843.859) [-2832.049] (-2839.437) (-2833.090) -- 0:05:34 358000 -- (-2834.286) (-2841.420) [-2827.544] (-2837.045) * (-2841.075) (-2837.568) (-2828.050) [-2840.269] -- 0:05:33 358500 -- (-2836.204) [-2836.342] (-2843.992) (-2840.537) * (-2829.012) (-2830.660) [-2829.944] (-2836.724) -- 0:05:34 359000 -- (-2840.812) [-2834.847] (-2845.148) (-2832.924) * [-2839.050] (-2842.762) (-2828.456) (-2839.991) -- 0:05:33 359500 -- (-2835.164) [-2838.929] (-2838.474) (-2837.109) * [-2830.823] (-2831.869) (-2840.835) (-2839.363) -- 0:05:33 360000 -- (-2837.581) (-2827.830) (-2854.161) [-2832.524] * (-2838.188) (-2834.132) [-2826.434] (-2825.094) -- 0:05:32 Average standard deviation of split frequencies: 0.014552 360500 -- (-2844.937) [-2830.283] (-2840.954) (-2849.843) * (-2839.743) (-2838.871) [-2830.659] (-2837.872) -- 0:05:33 361000 -- [-2831.892] (-2827.680) (-2837.554) (-2840.798) * (-2840.407) (-2844.273) (-2829.885) [-2834.787] -- 0:05:32 361500 -- (-2841.194) (-2831.602) [-2828.896] (-2831.790) * (-2826.404) (-2840.387) [-2834.026] (-2839.600) -- 0:05:32 362000 -- (-2831.365) (-2834.497) [-2830.215] (-2829.913) * [-2833.478] (-2843.781) (-2834.700) (-2838.749) -- 0:05:31 362500 -- (-2830.001) (-2833.822) (-2829.922) [-2827.899] * (-2837.735) [-2833.433] (-2832.432) (-2840.700) -- 0:05:32 363000 -- (-2828.232) (-2840.679) (-2838.333) [-2831.601] * (-2838.213) (-2831.793) (-2834.110) [-2838.286] -- 0:05:31 363500 -- (-2829.824) (-2841.449) (-2832.161) [-2835.009] * (-2837.937) (-2840.146) [-2831.916] (-2826.304) -- 0:05:30 364000 -- [-2828.544] (-2841.375) (-2839.248) (-2830.762) * (-2838.613) (-2838.204) (-2834.355) [-2832.682] -- 0:05:30 364500 -- [-2836.208] (-2839.650) (-2839.484) (-2833.520) * (-2831.387) (-2834.543) (-2831.884) [-2834.900] -- 0:05:31 365000 -- (-2833.028) (-2849.354) (-2836.977) [-2829.301] * (-2846.647) (-2840.270) [-2836.066] (-2832.283) -- 0:05:30 Average standard deviation of split frequencies: 0.014698 365500 -- [-2836.951] (-2835.308) (-2830.508) (-2839.498) * (-2837.503) (-2845.312) (-2831.775) [-2836.954] -- 0:05:29 366000 -- [-2834.052] (-2841.465) (-2823.026) (-2831.313) * (-2836.917) [-2837.713] (-2839.469) (-2838.654) -- 0:05:29 366500 -- (-2841.143) [-2838.780] (-2828.599) (-2833.146) * (-2837.155) (-2840.796) (-2831.695) [-2832.663] -- 0:05:30 367000 -- [-2835.818] (-2838.532) (-2830.311) (-2828.296) * (-2836.950) (-2836.426) (-2829.471) [-2827.248] -- 0:05:29 367500 -- (-2840.639) (-2840.769) (-2834.284) [-2826.632] * (-2838.852) (-2837.059) (-2833.147) [-2832.377] -- 0:05:28 368000 -- (-2833.144) (-2848.590) (-2838.784) [-2829.715] * (-2828.740) [-2832.839] (-2832.488) (-2830.680) -- 0:05:28 368500 -- [-2836.980] (-2841.895) (-2847.990) (-2835.111) * [-2837.125] (-2831.054) (-2828.220) (-2839.164) -- 0:05:29 369000 -- (-2844.100) [-2835.234] (-2838.669) (-2837.460) * (-2840.813) (-2837.604) [-2828.356] (-2835.853) -- 0:05:28 369500 -- (-2833.903) [-2831.239] (-2833.416) (-2827.444) * [-2837.447] (-2836.545) (-2837.448) (-2838.279) -- 0:05:27 370000 -- (-2829.144) [-2830.985] (-2842.213) (-2842.195) * (-2832.832) (-2834.113) [-2832.591] (-2837.948) -- 0:05:26 Average standard deviation of split frequencies: 0.015007 370500 -- (-2836.642) [-2825.257] (-2831.523) (-2840.190) * (-2829.415) (-2843.957) (-2848.152) [-2830.241] -- 0:05:27 371000 -- (-2840.903) (-2826.321) [-2827.118] (-2829.176) * (-2831.603) (-2838.601) [-2837.095] (-2842.937) -- 0:05:27 371500 -- [-2828.790] (-2835.146) (-2838.856) (-2829.059) * (-2845.799) (-2835.629) [-2837.916] (-2834.677) -- 0:05:26 372000 -- (-2833.154) (-2846.395) (-2847.453) [-2835.666] * (-2824.595) [-2833.713] (-2836.393) (-2848.771) -- 0:05:25 372500 -- [-2840.066] (-2832.178) (-2839.628) (-2834.649) * [-2828.512] (-2833.112) (-2836.662) (-2840.100) -- 0:05:26 373000 -- (-2840.140) (-2837.341) (-2845.680) [-2832.744] * (-2839.567) (-2829.695) (-2833.440) [-2823.340] -- 0:05:26 373500 -- (-2835.932) [-2830.822] (-2828.946) (-2830.435) * (-2834.843) (-2848.135) (-2830.253) [-2830.519] -- 0:05:25 374000 -- (-2828.352) [-2833.509] (-2833.989) (-2840.076) * (-2835.170) [-2833.010] (-2835.763) (-2828.413) -- 0:05:24 374500 -- (-2840.517) [-2829.647] (-2835.017) (-2835.664) * (-2840.310) (-2826.430) [-2839.979] (-2845.646) -- 0:05:25 375000 -- (-2850.274) (-2833.223) (-2839.556) [-2835.240] * [-2826.946] (-2829.415) (-2836.444) (-2832.266) -- 0:05:24 Average standard deviation of split frequencies: 0.015630 375500 -- (-2832.117) (-2832.525) (-2828.675) [-2822.587] * (-2834.051) (-2837.897) (-2841.073) [-2834.000] -- 0:05:24 376000 -- (-2840.389) [-2830.118] (-2832.629) (-2829.243) * (-2838.667) [-2840.391] (-2840.433) (-2830.515) -- 0:05:23 376500 -- [-2832.650] (-2836.046) (-2834.439) (-2832.226) * (-2835.156) (-2834.444) (-2842.135) [-2834.913] -- 0:05:24 377000 -- (-2843.257) (-2838.460) [-2828.462] (-2832.974) * (-2836.165) (-2831.538) (-2845.074) [-2825.578] -- 0:05:23 377500 -- [-2837.803] (-2833.696) (-2854.284) (-2826.302) * (-2847.422) (-2843.310) [-2827.689] (-2833.760) -- 0:05:23 378000 -- (-2838.300) (-2841.479) (-2846.581) [-2830.336] * (-2841.533) (-2825.619) [-2831.248] (-2836.026) -- 0:05:22 378500 -- (-2841.791) [-2829.164] (-2840.030) (-2831.618) * (-2841.476) (-2829.474) [-2834.219] (-2827.881) -- 0:05:23 379000 -- (-2842.972) (-2839.606) (-2838.808) [-2834.089] * (-2843.096) (-2829.749) (-2832.313) [-2837.603] -- 0:05:22 379500 -- (-2835.854) [-2833.296] (-2842.760) (-2834.276) * (-2836.776) (-2843.932) [-2826.278] (-2841.155) -- 0:05:22 380000 -- (-2834.951) (-2843.338) [-2828.565] (-2825.642) * (-2840.580) (-2842.898) [-2834.040] (-2836.123) -- 0:05:23 Average standard deviation of split frequencies: 0.015108 380500 -- (-2847.709) (-2834.626) [-2824.555] (-2835.567) * [-2828.900] (-2834.249) (-2830.428) (-2836.386) -- 0:05:22 381000 -- (-2836.576) (-2835.975) [-2834.167] (-2836.001) * (-2840.107) [-2832.628] (-2844.371) (-2835.613) -- 0:05:21 381500 -- (-2837.080) [-2840.055] (-2843.591) (-2834.017) * (-2843.479) (-2842.464) (-2835.689) [-2832.130] -- 0:05:21 382000 -- [-2831.991] (-2839.925) (-2849.668) (-2829.087) * (-2843.484) (-2844.684) (-2849.667) [-2838.631] -- 0:05:21 382500 -- [-2825.858] (-2830.656) (-2836.381) (-2837.849) * (-2837.822) [-2836.709] (-2841.207) (-2824.998) -- 0:05:21 383000 -- (-2838.822) [-2832.005] (-2839.474) (-2832.234) * [-2835.344] (-2829.750) (-2840.699) (-2833.701) -- 0:05:20 383500 -- (-2834.240) [-2824.227] (-2838.475) (-2834.003) * (-2832.270) (-2833.072) (-2832.605) [-2827.322] -- 0:05:19 384000 -- (-2839.740) (-2837.471) [-2835.176] (-2837.979) * [-2829.778] (-2840.068) (-2834.146) (-2835.449) -- 0:05:20 384500 -- (-2835.718) (-2833.894) [-2839.162] (-2850.816) * (-2840.143) (-2845.760) (-2840.107) [-2835.134] -- 0:05:20 385000 -- (-2837.819) [-2831.769] (-2839.312) (-2852.251) * (-2841.068) (-2837.361) [-2830.084] (-2830.772) -- 0:05:19 Average standard deviation of split frequencies: 0.013515 385500 -- (-2845.461) (-2843.994) [-2833.746] (-2846.807) * (-2837.096) (-2853.271) [-2829.017] (-2844.922) -- 0:05:18 386000 -- (-2853.452) (-2838.406) [-2829.539] (-2837.884) * (-2837.515) (-2851.161) (-2830.930) [-2833.264] -- 0:05:19 386500 -- (-2836.746) (-2838.919) [-2830.710] (-2834.374) * (-2831.153) (-2837.555) [-2836.556] (-2833.918) -- 0:05:19 387000 -- [-2833.155] (-2832.681) (-2838.426) (-2845.364) * (-2842.377) (-2829.961) (-2836.206) [-2832.093] -- 0:05:18 387500 -- (-2845.508) [-2836.130] (-2826.968) (-2842.837) * (-2832.948) [-2839.015] (-2837.599) (-2832.580) -- 0:05:17 388000 -- (-2833.171) (-2851.252) (-2829.895) [-2830.770] * (-2830.830) (-2832.544) [-2833.780] (-2833.006) -- 0:05:18 388500 -- (-2835.806) (-2826.832) (-2839.787) [-2835.809] * (-2840.688) [-2826.432] (-2857.672) (-2832.159) -- 0:05:17 389000 -- [-2826.999] (-2830.336) (-2844.577) (-2840.900) * (-2840.921) [-2833.336] (-2837.841) (-2835.598) -- 0:05:17 389500 -- (-2829.564) (-2831.722) (-2833.074) [-2832.742] * (-2837.176) [-2827.559] (-2828.209) (-2836.175) -- 0:05:16 390000 -- [-2833.472] (-2843.831) (-2829.995) (-2835.482) * (-2839.275) [-2834.061] (-2836.959) (-2842.176) -- 0:05:17 Average standard deviation of split frequencies: 0.012147 390500 -- (-2845.938) (-2844.141) [-2831.211] (-2840.022) * [-2839.050] (-2840.965) (-2830.662) (-2834.110) -- 0:05:16 391000 -- (-2836.276) (-2838.270) (-2848.263) [-2837.559] * (-2836.624) [-2831.266] (-2834.475) (-2829.521) -- 0:05:16 391500 -- (-2839.378) [-2828.724] (-2835.534) (-2829.185) * (-2840.858) (-2831.493) (-2834.406) [-2833.338] -- 0:05:15 392000 -- (-2858.407) (-2831.128) [-2831.198] (-2840.145) * (-2840.727) (-2838.936) [-2828.853] (-2831.232) -- 0:05:16 392500 -- (-2841.210) [-2835.588] (-2836.148) (-2829.791) * (-2840.073) [-2828.306] (-2833.077) (-2830.031) -- 0:05:15 393000 -- (-2840.675) [-2833.011] (-2838.722) (-2830.970) * (-2841.866) (-2838.353) (-2839.437) [-2832.606] -- 0:05:15 393500 -- (-2844.997) (-2830.600) [-2837.401] (-2839.621) * (-2831.343) (-2833.523) (-2829.673) [-2834.625] -- 0:05:14 394000 -- (-2842.542) (-2834.001) [-2831.018] (-2839.539) * (-2831.496) (-2829.361) [-2835.166] (-2835.260) -- 0:05:15 394500 -- [-2837.623] (-2832.673) (-2833.622) (-2829.053) * (-2835.634) (-2831.568) (-2838.304) [-2829.467] -- 0:05:14 395000 -- (-2841.916) (-2832.158) [-2836.470] (-2831.945) * (-2840.957) [-2830.333] (-2837.285) (-2834.603) -- 0:05:13 Average standard deviation of split frequencies: 0.012063 395500 -- (-2843.233) (-2837.439) [-2836.103] (-2836.190) * (-2838.104) (-2837.051) [-2833.029] (-2829.142) -- 0:05:13 396000 -- [-2835.903] (-2827.264) (-2839.617) (-2836.556) * [-2830.782] (-2839.004) (-2841.162) (-2832.982) -- 0:05:14 396500 -- (-2833.498) [-2828.266] (-2851.688) (-2844.061) * (-2829.785) (-2828.943) [-2833.052] (-2830.613) -- 0:05:13 397000 -- (-2831.736) (-2827.759) [-2837.921] (-2842.285) * [-2829.020] (-2837.149) (-2837.052) (-2836.659) -- 0:05:12 397500 -- [-2831.064] (-2831.786) (-2842.563) (-2839.483) * [-2831.147] (-2843.263) (-2841.899) (-2831.923) -- 0:05:12 398000 -- (-2833.210) (-2839.885) [-2834.315] (-2852.070) * [-2837.376] (-2832.554) (-2843.196) (-2833.936) -- 0:05:13 398500 -- (-2841.075) [-2825.611] (-2841.534) (-2841.311) * (-2840.710) [-2834.371] (-2839.992) (-2838.152) -- 0:05:12 399000 -- (-2833.409) [-2828.405] (-2834.411) (-2845.571) * [-2831.455] (-2839.106) (-2838.580) (-2828.949) -- 0:05:11 399500 -- [-2828.361] (-2848.555) (-2831.554) (-2833.886) * [-2832.544] (-2835.658) (-2835.164) (-2836.551) -- 0:05:12 400000 -- [-2832.841] (-2839.987) (-2831.343) (-2833.961) * [-2833.738] (-2842.711) (-2831.550) (-2839.494) -- 0:05:12 Average standard deviation of split frequencies: 0.013236 400500 -- (-2829.666) (-2840.365) [-2832.175] (-2837.447) * [-2831.777] (-2850.577) (-2827.934) (-2835.239) -- 0:05:11 401000 -- (-2833.103) (-2842.597) [-2840.088] (-2833.302) * [-2832.681] (-2833.662) (-2837.981) (-2830.750) -- 0:05:10 401500 -- (-2833.327) [-2830.185] (-2831.943) (-2840.781) * (-2836.362) (-2841.762) [-2837.924] (-2840.149) -- 0:05:11 402000 -- (-2848.919) (-2834.609) [-2837.938] (-2830.766) * [-2836.185] (-2844.508) (-2829.624) (-2830.851) -- 0:05:10 402500 -- (-2838.429) (-2833.444) (-2829.124) [-2831.645] * (-2832.204) [-2831.272] (-2844.837) (-2840.460) -- 0:05:10 403000 -- (-2841.776) (-2838.892) [-2827.704] (-2832.084) * [-2830.907] (-2833.083) (-2832.160) (-2839.131) -- 0:05:09 403500 -- (-2837.707) (-2835.893) (-2831.119) [-2832.678] * (-2835.746) (-2839.229) (-2831.649) [-2827.834] -- 0:05:10 404000 -- (-2835.569) (-2832.215) [-2839.504] (-2830.583) * (-2845.369) (-2843.430) [-2827.856] (-2840.055) -- 0:05:09 404500 -- [-2834.591] (-2835.308) (-2834.918) (-2835.711) * (-2840.105) (-2839.016) [-2837.267] (-2851.849) -- 0:05:09 405000 -- (-2834.596) (-2837.120) (-2840.995) [-2835.229] * [-2836.424] (-2836.548) (-2839.102) (-2851.259) -- 0:05:08 Average standard deviation of split frequencies: 0.013135 405500 -- (-2834.462) (-2843.037) [-2835.255] (-2852.784) * (-2838.490) [-2836.896] (-2833.768) (-2841.310) -- 0:05:09 406000 -- (-2836.193) (-2829.009) (-2842.868) [-2829.800] * [-2831.039] (-2826.568) (-2835.153) (-2836.923) -- 0:05:08 406500 -- (-2835.224) (-2835.036) [-2834.197] (-2830.638) * (-2834.494) [-2830.156] (-2837.584) (-2837.901) -- 0:05:08 407000 -- (-2839.537) (-2836.675) (-2840.083) [-2829.270] * (-2828.746) (-2834.626) (-2846.100) [-2833.160] -- 0:05:07 407500 -- (-2835.443) (-2834.064) (-2841.575) [-2826.844] * [-2827.333] (-2834.277) (-2840.670) (-2833.922) -- 0:05:08 408000 -- [-2829.284] (-2837.461) (-2848.282) (-2837.659) * (-2834.159) [-2829.994] (-2844.025) (-2832.865) -- 0:05:07 408500 -- [-2824.999] (-2845.703) (-2830.980) (-2832.675) * [-2823.708] (-2837.362) (-2834.483) (-2831.473) -- 0:05:06 409000 -- (-2828.720) (-2838.524) (-2835.160) [-2832.388] * (-2832.901) (-2826.425) (-2831.160) [-2833.170] -- 0:05:06 409500 -- (-2838.622) [-2824.383] (-2850.496) (-2835.795) * (-2827.300) (-2845.841) (-2836.306) [-2834.022] -- 0:05:07 410000 -- (-2837.029) (-2837.717) [-2836.712] (-2836.666) * (-2832.082) (-2833.412) [-2832.934] (-2831.720) -- 0:05:06 Average standard deviation of split frequencies: 0.013560 410500 -- (-2840.832) (-2847.464) [-2840.442] (-2842.595) * (-2838.242) (-2837.181) [-2830.575] (-2827.030) -- 0:05:05 411000 -- (-2831.856) (-2834.334) (-2838.842) [-2832.606] * (-2838.624) (-2834.886) [-2830.064] (-2830.928) -- 0:05:05 411500 -- (-2824.763) (-2838.718) [-2835.445] (-2830.750) * (-2843.005) [-2832.584] (-2835.738) (-2836.467) -- 0:05:06 412000 -- (-2840.033) (-2838.236) (-2832.455) [-2837.003] * (-2840.513) (-2830.374) [-2831.069] (-2840.695) -- 0:05:05 412500 -- [-2839.417] (-2850.753) (-2828.918) (-2834.557) * [-2840.417] (-2839.752) (-2840.673) (-2838.583) -- 0:05:04 413000 -- (-2839.810) (-2835.332) (-2838.330) [-2829.936] * (-2841.261) [-2827.813] (-2825.256) (-2837.669) -- 0:05:04 413500 -- (-2835.465) [-2844.741] (-2837.001) (-2825.727) * (-2835.681) (-2830.263) [-2833.905] (-2829.097) -- 0:05:04 414000 -- (-2844.809) (-2833.379) [-2835.408] (-2853.327) * (-2830.509) (-2844.069) [-2837.822] (-2830.594) -- 0:05:04 414500 -- (-2836.390) (-2840.128) [-2829.137] (-2835.658) * (-2832.776) (-2840.037) (-2855.374) [-2835.027] -- 0:05:03 415000 -- (-2832.455) (-2843.599) [-2830.805] (-2839.144) * [-2832.987] (-2842.327) (-2851.814) (-2835.024) -- 0:05:03 Average standard deviation of split frequencies: 0.013315 415500 -- (-2830.942) (-2829.500) (-2834.959) [-2835.926] * (-2845.286) (-2837.582) (-2845.634) [-2829.488] -- 0:05:03 416000 -- (-2829.886) (-2840.514) [-2831.229] (-2833.816) * (-2843.767) (-2829.783) [-2831.620] (-2830.618) -- 0:05:03 416500 -- (-2823.138) (-2842.481) [-2827.372] (-2827.126) * (-2836.584) [-2829.718] (-2829.589) (-2830.579) -- 0:05:02 417000 -- [-2833.843] (-2831.718) (-2831.332) (-2831.023) * [-2825.515] (-2827.353) (-2831.003) (-2832.094) -- 0:05:01 417500 -- (-2851.328) (-2832.599) [-2831.772] (-2842.625) * [-2824.409] (-2828.697) (-2834.865) (-2839.472) -- 0:05:02 418000 -- (-2840.522) (-2830.754) [-2835.325] (-2842.692) * (-2829.326) (-2835.158) [-2835.642] (-2840.754) -- 0:05:02 418500 -- (-2828.923) (-2839.616) [-2843.352] (-2845.998) * (-2843.599) (-2837.913) [-2842.530] (-2836.116) -- 0:05:01 419000 -- (-2839.738) (-2840.030) [-2836.850] (-2842.963) * (-2829.441) [-2834.357] (-2839.371) (-2841.636) -- 0:05:00 419500 -- (-2841.083) [-2831.242] (-2832.781) (-2852.432) * [-2827.793] (-2835.236) (-2838.116) (-2843.254) -- 0:05:01 420000 -- (-2849.101) (-2831.222) [-2835.604] (-2839.027) * [-2836.330] (-2835.913) (-2847.531) (-2837.135) -- 0:05:01 Average standard deviation of split frequencies: 0.013587 420500 -- (-2835.807) (-2827.923) (-2836.303) [-2833.812] * (-2830.229) (-2836.209) (-2840.126) [-2841.340] -- 0:05:00 421000 -- (-2827.145) (-2833.196) [-2838.313] (-2845.137) * (-2832.939) (-2838.960) [-2833.136] (-2844.612) -- 0:04:59 421500 -- (-2827.298) (-2830.803) [-2828.784] (-2836.762) * (-2830.872) (-2836.420) (-2836.988) [-2832.885] -- 0:05:00 422000 -- (-2844.617) [-2833.742] (-2833.736) (-2836.987) * (-2842.180) (-2836.313) (-2833.002) [-2834.072] -- 0:04:59 422500 -- (-2837.354) [-2834.526] (-2830.623) (-2839.487) * (-2840.691) (-2841.066) [-2831.561] (-2840.923) -- 0:04:59 423000 -- [-2831.417] (-2831.974) (-2841.095) (-2838.166) * (-2841.796) (-2851.388) [-2838.249] (-2838.184) -- 0:05:00 423500 -- (-2832.369) (-2838.119) [-2837.025] (-2836.094) * (-2828.940) (-2835.499) [-2848.327] (-2840.460) -- 0:04:59 424000 -- (-2836.296) (-2836.833) [-2826.715] (-2846.947) * (-2830.959) (-2838.386) (-2839.090) [-2839.821] -- 0:04:58 424500 -- (-2834.895) (-2831.591) (-2834.864) [-2835.251] * [-2833.795] (-2837.294) (-2830.901) (-2832.558) -- 0:04:58 425000 -- (-2831.458) [-2837.083] (-2828.477) (-2849.207) * (-2832.305) [-2832.262] (-2838.338) (-2836.870) -- 0:04:59 Average standard deviation of split frequencies: 0.013072 425500 -- (-2832.408) (-2828.714) (-2837.629) [-2837.928] * [-2830.730] (-2842.986) (-2837.945) (-2840.373) -- 0:04:58 426000 -- (-2841.882) (-2833.618) [-2829.652] (-2829.892) * [-2835.068] (-2844.230) (-2838.445) (-2838.172) -- 0:04:57 426500 -- [-2832.726] (-2829.522) (-2844.022) (-2833.574) * (-2829.633) (-2842.425) [-2835.636] (-2834.127) -- 0:04:57 427000 -- [-2829.611] (-2831.577) (-2828.030) (-2828.670) * (-2828.675) (-2848.472) (-2834.753) [-2835.938] -- 0:04:57 427500 -- (-2830.446) (-2831.635) (-2839.815) [-2827.978] * (-2834.877) (-2849.870) (-2835.855) [-2832.976] -- 0:04:57 428000 -- (-2841.573) [-2836.463] (-2832.049) (-2842.346) * (-2835.157) (-2838.999) (-2843.418) [-2831.924] -- 0:04:56 428500 -- (-2837.367) [-2827.350] (-2840.347) (-2835.327) * (-2828.201) (-2842.902) (-2835.439) [-2833.329] -- 0:04:56 429000 -- (-2832.292) [-2833.157] (-2839.800) (-2834.268) * (-2845.767) [-2838.915] (-2829.262) (-2845.352) -- 0:04:56 429500 -- [-2826.905] (-2835.399) (-2847.817) (-2837.300) * (-2827.628) (-2842.275) (-2841.350) [-2844.778] -- 0:04:56 430000 -- (-2834.787) [-2830.463] (-2830.292) (-2833.552) * [-2839.977] (-2841.774) (-2841.059) (-2833.790) -- 0:04:55 Average standard deviation of split frequencies: 0.012109 430500 -- [-2824.964] (-2837.943) (-2825.843) (-2844.014) * (-2834.885) (-2839.345) (-2838.321) [-2829.092] -- 0:04:55 431000 -- (-2831.458) [-2834.186] (-2835.292) (-2841.347) * (-2828.010) (-2835.609) [-2827.526] (-2831.590) -- 0:04:55 431500 -- [-2831.131] (-2842.493) (-2833.884) (-2837.617) * (-2830.535) (-2833.899) (-2837.128) [-2834.118] -- 0:04:55 432000 -- [-2829.949] (-2839.425) (-2834.458) (-2829.544) * (-2832.169) (-2833.760) [-2829.377] (-2831.775) -- 0:04:54 432500 -- [-2834.212] (-2836.766) (-2835.454) (-2833.420) * (-2835.140) (-2839.939) (-2831.106) [-2827.195] -- 0:04:53 433000 -- (-2843.693) (-2833.971) [-2836.525] (-2835.054) * [-2828.921] (-2842.000) (-2830.869) (-2836.545) -- 0:04:54 433500 -- (-2840.034) (-2838.366) [-2830.162] (-2840.830) * [-2833.765] (-2843.148) (-2837.926) (-2844.859) -- 0:04:54 434000 -- (-2836.544) (-2837.292) [-2824.172] (-2827.912) * [-2839.353] (-2833.432) (-2836.145) (-2837.831) -- 0:04:53 434500 -- (-2837.626) (-2830.025) (-2827.779) [-2827.889] * (-2847.903) (-2841.055) [-2841.012] (-2840.651) -- 0:04:52 435000 -- [-2842.921] (-2835.316) (-2832.097) (-2830.932) * (-2849.043) (-2837.097) [-2829.391] (-2841.314) -- 0:04:53 Average standard deviation of split frequencies: 0.010812 435500 -- (-2843.478) (-2834.701) (-2836.870) [-2835.796] * (-2840.025) [-2833.652] (-2830.887) (-2840.895) -- 0:04:52 436000 -- (-2841.307) (-2828.712) [-2830.861] (-2837.304) * [-2830.843] (-2840.517) (-2829.443) (-2832.451) -- 0:04:52 436500 -- (-2832.191) (-2834.490) [-2830.096] (-2834.772) * (-2836.531) [-2832.676] (-2838.280) (-2828.707) -- 0:04:51 437000 -- (-2836.570) (-2836.465) [-2836.060] (-2835.431) * (-2836.918) [-2823.771] (-2835.577) (-2829.406) -- 0:04:52 437500 -- (-2834.214) [-2830.739] (-2835.980) (-2838.356) * (-2828.102) (-2837.568) (-2829.035) [-2831.102] -- 0:04:51 438000 -- (-2838.530) (-2835.541) [-2840.116] (-2832.960) * [-2831.283] (-2849.497) (-2828.769) (-2824.858) -- 0:04:51 438500 -- (-2835.586) (-2840.216) [-2839.555] (-2828.646) * [-2824.555] (-2829.645) (-2836.046) (-2832.262) -- 0:04:50 439000 -- (-2836.605) (-2828.725) (-2848.337) [-2836.112] * (-2837.900) (-2835.110) [-2831.647] (-2837.710) -- 0:04:51 439500 -- (-2834.976) (-2836.478) (-2839.852) [-2833.313] * (-2836.264) (-2830.673) (-2835.882) [-2832.871] -- 0:04:50 440000 -- (-2840.415) [-2831.383] (-2841.429) (-2836.291) * (-2834.491) (-2837.937) [-2824.651] (-2830.952) -- 0:04:50 Average standard deviation of split frequencies: 0.011968 440500 -- (-2835.295) [-2829.124] (-2846.876) (-2830.922) * (-2832.642) [-2832.560] (-2845.043) (-2854.493) -- 0:04:50 441000 -- (-2846.118) [-2833.221] (-2834.303) (-2845.465) * (-2841.547) (-2834.962) (-2840.985) [-2839.516] -- 0:04:50 441500 -- (-2840.300) [-2826.681] (-2834.793) (-2848.026) * (-2841.775) (-2833.589) [-2831.815] (-2853.290) -- 0:04:49 442000 -- [-2832.233] (-2837.994) (-2844.278) (-2826.829) * (-2832.940) (-2839.118) [-2827.647] (-2839.305) -- 0:04:49 442500 -- (-2828.628) (-2829.100) (-2843.963) [-2831.669] * (-2836.347) [-2834.834] (-2835.772) (-2836.144) -- 0:04:49 443000 -- (-2839.467) [-2832.161] (-2833.410) (-2832.963) * [-2832.644] (-2828.070) (-2844.681) (-2838.019) -- 0:04:49 443500 -- (-2838.160) [-2829.849] (-2845.650) (-2834.299) * [-2834.290] (-2836.603) (-2839.486) (-2834.382) -- 0:04:48 444000 -- [-2831.324] (-2832.174) (-2830.938) (-2835.438) * [-2837.771] (-2831.012) (-2838.334) (-2831.360) -- 0:04:48 444500 -- (-2830.779) [-2834.291] (-2831.093) (-2839.175) * (-2844.822) [-2827.480] (-2839.618) (-2839.725) -- 0:04:48 445000 -- [-2831.473] (-2843.286) (-2830.383) (-2833.178) * (-2846.938) (-2835.614) [-2833.109] (-2836.096) -- 0:04:48 Average standard deviation of split frequencies: 0.011494 445500 -- (-2829.624) (-2838.616) (-2829.554) [-2839.612] * (-2841.003) [-2835.050] (-2843.719) (-2838.707) -- 0:04:47 446000 -- [-2828.544] (-2833.846) (-2838.990) (-2837.021) * (-2837.905) [-2838.797] (-2838.273) (-2832.729) -- 0:04:46 446500 -- (-2825.303) (-2835.125) [-2828.663] (-2846.955) * (-2846.468) (-2837.841) (-2829.529) [-2832.585] -- 0:04:47 447000 -- [-2836.106] (-2824.854) (-2844.342) (-2846.937) * (-2836.644) (-2831.243) (-2839.735) [-2840.972] -- 0:04:47 447500 -- (-2839.247) (-2830.858) [-2842.439] (-2840.379) * (-2834.018) [-2833.454] (-2839.153) (-2836.385) -- 0:04:46 448000 -- [-2834.594] (-2845.021) (-2847.894) (-2829.152) * [-2840.316] (-2830.858) (-2839.007) (-2829.598) -- 0:04:45 448500 -- (-2833.365) [-2827.908] (-2848.271) (-2830.296) * [-2837.259] (-2828.040) (-2834.562) (-2836.483) -- 0:04:46 449000 -- (-2836.281) [-2832.707] (-2850.155) (-2839.673) * [-2828.039] (-2826.862) (-2826.841) (-2836.587) -- 0:04:45 449500 -- [-2833.268] (-2835.669) (-2826.958) (-2848.890) * [-2840.174] (-2832.385) (-2834.003) (-2843.335) -- 0:04:45 450000 -- (-2830.290) (-2832.169) [-2839.859] (-2839.731) * (-2834.870) [-2835.402] (-2838.832) (-2823.489) -- 0:04:44 Average standard deviation of split frequencies: 0.010199 450500 -- [-2832.309] (-2829.527) (-2842.406) (-2842.781) * [-2828.855] (-2834.465) (-2832.348) (-2833.773) -- 0:04:45 451000 -- (-2837.473) (-2838.695) [-2829.542] (-2841.797) * (-2831.283) (-2839.544) [-2831.309] (-2831.024) -- 0:04:44 451500 -- (-2835.585) [-2830.673] (-2834.786) (-2839.746) * (-2837.503) (-2844.469) (-2828.361) [-2828.855] -- 0:04:44 452000 -- (-2833.217) (-2836.201) (-2835.085) [-2836.719] * (-2834.928) [-2833.034] (-2839.355) (-2835.637) -- 0:04:43 452500 -- (-2827.202) [-2828.323] (-2832.320) (-2837.922) * (-2833.485) [-2825.423] (-2843.029) (-2838.559) -- 0:04:44 453000 -- [-2826.545] (-2830.418) (-2833.108) (-2848.975) * (-2841.782) (-2832.477) [-2832.989] (-2825.754) -- 0:04:43 453500 -- [-2826.308] (-2835.966) (-2842.520) (-2839.507) * (-2849.848) (-2829.259) (-2833.804) [-2834.091] -- 0:04:43 454000 -- (-2838.931) (-2834.026) (-2843.278) [-2826.272] * [-2845.274] (-2835.222) (-2832.629) (-2836.656) -- 0:04:42 454500 -- (-2834.248) (-2826.496) (-2828.563) [-2826.233] * (-2840.890) (-2834.618) [-2837.617] (-2834.572) -- 0:04:43 455000 -- (-2827.058) [-2833.120] (-2835.542) (-2838.458) * (-2841.073) [-2838.346] (-2844.135) (-2830.927) -- 0:04:42 Average standard deviation of split frequencies: 0.011307 455500 -- [-2826.733] (-2826.789) (-2829.646) (-2846.784) * [-2834.084] (-2837.670) (-2832.491) (-2838.640) -- 0:04:42 456000 -- (-2829.984) (-2835.397) [-2832.795] (-2836.296) * (-2842.309) (-2835.735) [-2838.844] (-2837.090) -- 0:04:41 456500 -- [-2837.286] (-2840.561) (-2841.049) (-2844.392) * [-2836.279] (-2840.704) (-2840.535) (-2831.636) -- 0:04:42 457000 -- (-2833.922) (-2837.841) (-2834.862) [-2840.010] * (-2834.133) (-2834.683) (-2836.925) [-2831.003] -- 0:04:41 457500 -- [-2829.523] (-2837.833) (-2844.557) (-2844.232) * (-2834.194) (-2837.606) [-2830.439] (-2831.072) -- 0:04:41 458000 -- (-2840.825) [-2827.109] (-2835.876) (-2839.464) * (-2833.885) (-2832.116) [-2837.431] (-2834.372) -- 0:04:40 458500 -- (-2840.740) (-2833.258) [-2831.732] (-2842.660) * (-2832.243) [-2831.749] (-2827.370) (-2836.683) -- 0:04:41 459000 -- (-2830.516) (-2825.658) [-2834.473] (-2841.544) * (-2839.458) [-2836.025] (-2833.662) (-2842.088) -- 0:04:40 459500 -- (-2836.460) [-2831.064] (-2832.022) (-2831.751) * (-2844.377) [-2830.888] (-2829.949) (-2840.467) -- 0:04:39 460000 -- (-2827.703) [-2828.925] (-2840.389) (-2840.369) * (-2839.347) [-2827.284] (-2839.140) (-2828.169) -- 0:04:39 Average standard deviation of split frequencies: 0.011128 460500 -- [-2833.700] (-2829.997) (-2844.601) (-2836.879) * [-2834.218] (-2839.524) (-2845.563) (-2834.413) -- 0:04:40 461000 -- (-2839.665) (-2832.462) (-2841.441) [-2841.527] * (-2830.000) (-2835.407) [-2834.328] (-2827.656) -- 0:04:39 461500 -- (-2831.052) (-2841.921) [-2843.977] (-2838.150) * (-2830.374) [-2830.201] (-2844.898) (-2829.690) -- 0:04:38 462000 -- [-2836.261] (-2834.095) (-2841.304) (-2841.093) * [-2829.355] (-2836.170) (-2843.089) (-2836.489) -- 0:04:39 462500 -- (-2834.053) (-2836.403) [-2829.001] (-2839.614) * [-2833.805] (-2831.801) (-2834.223) (-2839.524) -- 0:04:38 463000 -- [-2826.586] (-2835.503) (-2836.995) (-2841.307) * (-2843.938) [-2840.294] (-2834.684) (-2842.721) -- 0:04:38 463500 -- (-2829.149) [-2831.124] (-2842.059) (-2833.076) * (-2835.243) [-2832.389] (-2837.710) (-2841.023) -- 0:04:37 464000 -- (-2828.329) (-2857.592) (-2843.894) [-2834.096] * [-2837.373] (-2835.567) (-2856.483) (-2837.818) -- 0:04:38 464500 -- (-2853.885) (-2843.246) (-2844.767) [-2830.368] * (-2842.074) [-2830.083] (-2829.663) (-2829.847) -- 0:04:37 465000 -- (-2836.314) (-2841.432) (-2850.529) [-2824.737] * (-2839.232) (-2839.409) [-2833.775] (-2833.632) -- 0:04:37 Average standard deviation of split frequencies: 0.011949 465500 -- (-2839.955) [-2832.764] (-2849.601) (-2832.227) * (-2826.972) (-2831.185) [-2830.921] (-2835.827) -- 0:04:36 466000 -- [-2827.999] (-2840.850) (-2841.800) (-2839.116) * (-2826.504) (-2843.664) [-2833.230] (-2839.856) -- 0:04:37 466500 -- (-2840.756) [-2836.004] (-2853.793) (-2838.824) * (-2830.111) (-2846.509) [-2829.430] (-2834.228) -- 0:04:36 467000 -- [-2845.576] (-2836.568) (-2844.065) (-2841.605) * [-2832.311] (-2837.198) (-2840.194) (-2837.775) -- 0:04:36 467500 -- (-2827.435) [-2828.699] (-2844.105) (-2831.987) * (-2836.228) [-2833.421] (-2834.335) (-2833.795) -- 0:04:35 468000 -- (-2829.073) [-2835.209] (-2838.830) (-2835.371) * (-2844.942) (-2836.028) (-2826.518) [-2834.552] -- 0:04:36 468500 -- [-2828.330] (-2838.641) (-2838.989) (-2828.547) * (-2831.466) (-2840.393) [-2835.900] (-2841.857) -- 0:04:35 469000 -- [-2825.193] (-2840.400) (-2835.994) (-2833.929) * (-2835.898) [-2837.096] (-2827.529) (-2833.386) -- 0:04:35 469500 -- [-2831.448] (-2835.371) (-2839.760) (-2835.630) * (-2831.119) (-2837.436) [-2822.692] (-2837.550) -- 0:04:34 470000 -- (-2834.603) (-2832.284) [-2846.629] (-2841.152) * (-2831.537) (-2831.642) [-2830.390] (-2832.659) -- 0:04:35 Average standard deviation of split frequencies: 0.011330 470500 -- (-2827.966) (-2823.104) [-2834.226] (-2836.396) * [-2838.332] (-2848.437) (-2827.070) (-2834.453) -- 0:04:34 471000 -- (-2828.252) [-2832.959] (-2838.706) (-2834.604) * (-2827.231) (-2834.890) [-2838.678] (-2833.958) -- 0:04:34 471500 -- (-2834.902) (-2834.881) [-2831.425] (-2835.861) * (-2829.210) (-2838.338) (-2846.632) [-2833.742] -- 0:04:33 472000 -- (-2829.355) (-2842.059) (-2836.359) [-2833.367] * (-2832.147) (-2836.594) [-2832.104] (-2835.873) -- 0:04:34 472500 -- (-2839.325) (-2832.108) (-2835.807) [-2836.047] * (-2835.676) [-2827.028] (-2836.893) (-2843.169) -- 0:04:33 473000 -- (-2844.620) (-2853.214) (-2842.224) [-2835.056] * (-2846.521) [-2838.800] (-2832.113) (-2843.483) -- 0:04:32 473500 -- (-2845.922) (-2835.353) [-2825.849] (-2832.347) * (-2837.015) [-2838.613] (-2834.065) (-2838.818) -- 0:04:32 474000 -- (-2840.810) (-2846.935) (-2840.215) [-2836.978] * (-2844.622) (-2827.983) (-2831.560) [-2837.700] -- 0:04:32 474500 -- [-2829.586] (-2832.348) (-2831.517) (-2832.065) * (-2846.688) (-2845.251) [-2826.386] (-2838.575) -- 0:04:32 475000 -- [-2836.332] (-2835.767) (-2837.509) (-2834.612) * (-2843.597) (-2846.831) (-2828.951) [-2829.973] -- 0:04:31 Average standard deviation of split frequencies: 0.009375 475500 -- [-2835.443] (-2846.928) (-2833.435) (-2838.739) * [-2836.883] (-2841.409) (-2843.520) (-2839.734) -- 0:04:32 476000 -- (-2836.371) (-2835.034) [-2838.201] (-2832.330) * [-2828.879] (-2850.263) (-2835.515) (-2844.011) -- 0:04:31 476500 -- (-2830.973) [-2834.345] (-2849.495) (-2837.231) * (-2835.392) [-2835.750] (-2832.578) (-2835.945) -- 0:04:31 477000 -- (-2842.247) (-2842.017) [-2834.003] (-2846.095) * (-2841.047) (-2849.173) (-2836.557) [-2825.300] -- 0:04:30 477500 -- (-2838.699) (-2838.390) (-2833.626) [-2838.939] * (-2830.572) (-2845.915) [-2832.620] (-2828.586) -- 0:04:31 478000 -- [-2833.911] (-2836.366) (-2826.125) (-2835.618) * [-2831.260] (-2837.904) (-2832.915) (-2833.600) -- 0:04:30 478500 -- [-2834.758] (-2834.166) (-2832.189) (-2837.268) * (-2827.234) (-2839.290) [-2831.543] (-2842.483) -- 0:04:30 479000 -- (-2839.680) (-2836.223) [-2833.666] (-2839.983) * [-2830.920] (-2837.435) (-2835.864) (-2830.066) -- 0:04:29 479500 -- (-2831.347) (-2849.983) [-2839.150] (-2838.228) * [-2829.366] (-2846.559) (-2838.622) (-2826.552) -- 0:04:30 480000 -- (-2833.225) (-2836.505) [-2835.140] (-2834.127) * (-2835.010) [-2836.540] (-2836.651) (-2831.278) -- 0:04:29 Average standard deviation of split frequencies: 0.009284 480500 -- (-2828.942) (-2833.343) (-2834.301) [-2831.619] * (-2831.257) (-2830.664) [-2829.325] (-2836.068) -- 0:04:29 481000 -- (-2833.380) (-2834.680) [-2839.456] (-2837.153) * [-2828.678] (-2839.582) (-2829.141) (-2839.067) -- 0:04:29 481500 -- (-2826.202) [-2828.093] (-2833.280) (-2839.552) * (-2837.794) (-2840.988) (-2827.043) [-2830.643] -- 0:04:29 482000 -- (-2838.783) (-2831.762) [-2828.690] (-2839.574) * [-2833.669] (-2835.103) (-2834.815) (-2841.289) -- 0:04:28 482500 -- [-2834.480] (-2834.838) (-2838.407) (-2833.797) * (-2824.358) (-2829.823) [-2826.914] (-2830.738) -- 0:04:28 483000 -- (-2849.187) (-2836.121) (-2833.136) [-2826.632] * [-2830.839] (-2839.610) (-2838.436) (-2827.708) -- 0:04:28 483500 -- (-2848.479) [-2831.615] (-2832.119) (-2831.452) * (-2846.997) (-2838.543) [-2833.485] (-2834.496) -- 0:04:28 484000 -- (-2848.124) [-2832.448] (-2832.358) (-2842.658) * [-2835.964] (-2844.539) (-2830.983) (-2838.139) -- 0:04:27 484500 -- (-2848.047) [-2834.967] (-2846.039) (-2838.856) * (-2847.983) (-2836.604) (-2838.058) [-2829.810] -- 0:04:27 485000 -- [-2838.739] (-2834.983) (-2835.235) (-2836.706) * (-2834.770) (-2834.343) (-2826.839) [-2834.227] -- 0:04:27 Average standard deviation of split frequencies: 0.009376 485500 -- [-2836.103] (-2832.120) (-2833.844) (-2838.885) * (-2836.235) [-2832.939] (-2825.164) (-2840.984) -- 0:04:27 486000 -- (-2840.426) (-2843.005) (-2843.121) [-2834.176] * (-2836.596) [-2831.248] (-2834.754) (-2831.937) -- 0:04:26 486500 -- [-2828.970] (-2846.019) (-2836.094) (-2833.624) * (-2832.335) (-2837.695) (-2831.088) [-2837.252] -- 0:04:25 487000 -- (-2830.212) (-2843.699) (-2836.032) [-2830.816] * (-2834.550) [-2830.965] (-2839.261) (-2835.633) -- 0:04:26 487500 -- (-2830.946) [-2826.159] (-2829.137) (-2836.508) * (-2838.716) (-2837.293) (-2833.597) [-2834.037] -- 0:04:25 488000 -- [-2828.785] (-2831.344) (-2847.653) (-2833.872) * [-2837.618] (-2842.871) (-2829.671) (-2844.214) -- 0:04:25 488500 -- [-2826.210] (-2832.092) (-2832.898) (-2825.115) * (-2843.621) (-2830.781) (-2839.426) [-2838.973] -- 0:04:24 489000 -- (-2835.780) (-2839.840) [-2826.372] (-2836.757) * [-2829.032] (-2841.330) (-2835.752) (-2830.003) -- 0:04:25 489500 -- [-2839.627] (-2838.191) (-2836.842) (-2831.845) * (-2834.591) (-2840.926) [-2829.630] (-2835.896) -- 0:04:24 490000 -- [-2834.366] (-2842.866) (-2827.202) (-2843.498) * (-2840.923) [-2837.770] (-2835.756) (-2841.083) -- 0:04:24 Average standard deviation of split frequencies: 0.009992 490500 -- (-2836.350) (-2836.192) [-2831.841] (-2834.454) * [-2826.943] (-2837.960) (-2837.062) (-2833.261) -- 0:04:23 491000 -- (-2845.993) (-2835.277) [-2827.727] (-2850.592) * (-2845.369) [-2836.711] (-2835.729) (-2832.967) -- 0:04:24 491500 -- (-2837.830) (-2827.075) (-2841.347) [-2839.175] * (-2831.992) (-2841.989) (-2835.845) [-2828.183] -- 0:04:23 492000 -- (-2832.989) (-2831.856) [-2837.832] (-2835.795) * (-2839.213) (-2848.399) [-2833.185] (-2829.565) -- 0:04:23 492500 -- (-2845.601) [-2831.609] (-2841.191) (-2843.165) * [-2834.266] (-2830.504) (-2834.542) (-2833.975) -- 0:04:22 493000 -- (-2844.560) (-2835.301) [-2828.920] (-2835.189) * (-2832.079) (-2828.744) [-2826.915] (-2837.806) -- 0:04:23 493500 -- [-2832.686] (-2839.764) (-2836.416) (-2841.220) * (-2844.105) (-2836.976) [-2832.530] (-2839.937) -- 0:04:22 494000 -- (-2837.697) (-2838.764) (-2839.927) [-2834.150] * (-2838.413) (-2842.452) (-2828.371) [-2842.280] -- 0:04:22 494500 -- [-2838.085] (-2845.049) (-2837.848) (-2829.567) * (-2848.267) (-2841.976) [-2829.916] (-2832.868) -- 0:04:21 495000 -- [-2828.830] (-2849.657) (-2834.538) (-2841.838) * (-2832.087) [-2834.599] (-2837.507) (-2830.020) -- 0:04:22 Average standard deviation of split frequencies: 0.010455 495500 -- [-2832.303] (-2840.452) (-2839.471) (-2849.978) * [-2836.473] (-2850.004) (-2846.072) (-2837.638) -- 0:04:21 496000 -- [-2826.431] (-2840.155) (-2831.717) (-2832.021) * (-2832.296) (-2839.252) [-2832.928] (-2832.445) -- 0:04:21 496500 -- [-2824.596] (-2837.738) (-2830.672) (-2831.224) * (-2843.558) [-2828.110] (-2843.605) (-2829.812) -- 0:04:21 497000 -- (-2843.005) [-2822.936] (-2832.416) (-2833.458) * (-2836.564) (-2832.806) [-2832.493] (-2837.515) -- 0:04:21 497500 -- (-2832.017) (-2835.089) [-2827.097] (-2844.958) * (-2839.693) (-2836.298) [-2830.331] (-2834.171) -- 0:04:20 498000 -- (-2832.933) (-2841.004) [-2828.953] (-2844.176) * (-2859.205) (-2832.418) (-2830.671) [-2834.988] -- 0:04:20 498500 -- (-2828.014) [-2834.387] (-2836.341) (-2839.904) * [-2836.303] (-2831.144) (-2841.058) (-2836.491) -- 0:04:20 499000 -- [-2826.825] (-2838.748) (-2838.170) (-2840.479) * (-2840.750) (-2838.546) [-2841.223] (-2829.561) -- 0:04:20 499500 -- [-2826.702] (-2847.176) (-2844.141) (-2839.128) * [-2835.710] (-2835.050) (-2844.267) (-2830.831) -- 0:04:19 500000 -- [-2835.408] (-2835.339) (-2836.440) (-2838.014) * (-2830.856) (-2846.001) (-2836.386) [-2829.091] -- 0:04:19 Average standard deviation of split frequencies: 0.010671 500500 -- (-2830.338) (-2841.119) [-2838.833] (-2830.016) * (-2833.936) [-2831.191] (-2847.010) (-2824.010) -- 0:04:19 501000 -- (-2828.460) (-2845.419) (-2853.367) [-2829.220] * (-2838.500) (-2836.795) [-2842.010] (-2837.743) -- 0:04:18 501500 -- (-2844.741) (-2846.723) [-2833.192] (-2827.842) * [-2833.476] (-2837.405) (-2840.145) (-2827.964) -- 0:04:18 502000 -- [-2836.073] (-2839.779) (-2828.706) (-2830.979) * (-2832.447) (-2833.404) [-2839.223] (-2832.283) -- 0:04:17 502500 -- (-2833.444) (-2837.036) (-2838.198) [-2836.743] * (-2840.982) (-2837.115) [-2841.790] (-2839.297) -- 0:04:18 503000 -- (-2832.502) (-2842.911) (-2843.347) [-2830.924] * (-2832.439) (-2841.327) [-2834.256] (-2837.151) -- 0:04:17 503500 -- [-2834.862] (-2834.259) (-2826.037) (-2843.255) * (-2834.010) (-2826.710) (-2848.251) [-2825.157] -- 0:04:17 504000 -- (-2830.048) (-2834.536) [-2828.683] (-2834.281) * [-2832.645] (-2839.101) (-2838.143) (-2835.107) -- 0:04:17 504500 -- (-2831.484) (-2830.341) (-2832.685) [-2833.360] * (-2834.324) (-2838.234) [-2835.628] (-2837.815) -- 0:04:17 505000 -- (-2829.742) (-2841.095) (-2835.328) [-2829.006] * (-2834.836) (-2844.247) (-2838.987) [-2831.706] -- 0:04:16 Average standard deviation of split frequencies: 0.010248 505500 -- (-2838.154) [-2828.353] (-2835.945) (-2835.056) * (-2837.191) [-2831.135] (-2831.123) (-2838.262) -- 0:04:16 506000 -- (-2828.924) (-2829.118) [-2830.149] (-2843.041) * [-2839.184] (-2829.335) (-2833.944) (-2833.308) -- 0:04:16 506500 -- (-2835.345) (-2830.127) [-2832.369] (-2845.928) * (-2834.044) (-2833.937) [-2835.191] (-2838.150) -- 0:04:16 507000 -- [-2832.601] (-2832.001) (-2839.154) (-2836.617) * (-2844.919) (-2837.048) [-2832.666] (-2836.887) -- 0:04:15 507500 -- (-2835.970) (-2829.673) (-2832.815) [-2832.695] * (-2839.566) [-2833.482] (-2836.392) (-2831.321) -- 0:04:15 508000 -- (-2834.367) (-2828.315) [-2834.001] (-2840.593) * [-2837.577] (-2839.412) (-2833.414) (-2836.263) -- 0:04:15 508500 -- (-2837.741) (-2837.626) (-2827.379) [-2838.274] * (-2837.802) (-2832.724) [-2833.226] (-2829.027) -- 0:04:15 509000 -- [-2827.541] (-2845.672) (-2835.870) (-2832.976) * (-2832.483) [-2831.390] (-2838.318) (-2829.512) -- 0:04:14 509500 -- (-2832.339) (-2843.165) [-2838.519] (-2844.735) * (-2834.978) (-2824.376) [-2836.826] (-2832.786) -- 0:04:14 510000 -- (-2829.816) (-2840.230) [-2833.633] (-2840.701) * (-2840.865) (-2832.683) [-2832.892] (-2835.771) -- 0:04:14 Average standard deviation of split frequencies: 0.009416 510500 -- (-2837.483) (-2836.438) [-2835.861] (-2841.725) * (-2833.665) (-2838.585) (-2830.160) [-2832.458] -- 0:04:14 511000 -- (-2838.754) (-2845.147) (-2844.745) [-2832.488] * (-2832.868) (-2828.468) [-2829.060] (-2836.280) -- 0:04:13 511500 -- [-2836.565] (-2841.610) (-2835.277) (-2849.948) * (-2836.542) [-2828.880] (-2829.457) (-2835.467) -- 0:04:13 512000 -- (-2841.813) [-2836.956] (-2846.124) (-2835.487) * (-2851.904) (-2835.359) (-2836.050) [-2831.207] -- 0:04:13 512500 -- (-2833.433) (-2833.477) [-2840.118] (-2834.378) * [-2834.050] (-2843.953) (-2831.281) (-2831.434) -- 0:04:13 513000 -- (-2832.173) (-2840.744) (-2835.129) [-2844.101] * (-2834.953) (-2830.887) [-2831.156] (-2836.254) -- 0:04:12 513500 -- (-2836.445) [-2828.450] (-2834.297) (-2837.639) * [-2832.087] (-2835.765) (-2829.040) (-2833.746) -- 0:04:12 514000 -- (-2833.202) (-2839.741) [-2837.174] (-2837.507) * (-2833.625) (-2833.416) [-2835.488] (-2830.532) -- 0:04:12 514500 -- (-2842.752) (-2837.136) [-2835.303] (-2840.587) * (-2840.143) (-2836.163) [-2837.547] (-2833.632) -- 0:04:11 515000 -- [-2843.732] (-2837.980) (-2834.648) (-2839.039) * (-2846.693) (-2830.969) [-2832.078] (-2828.733) -- 0:04:11 Average standard deviation of split frequencies: 0.009623 515500 -- [-2822.815] (-2826.029) (-2827.981) (-2840.246) * (-2839.720) (-2832.140) (-2837.319) [-2829.647] -- 0:04:10 516000 -- (-2840.648) (-2837.006) [-2825.877] (-2834.269) * (-2837.583) [-2828.457] (-2842.702) (-2833.024) -- 0:04:11 516500 -- (-2835.983) [-2827.339] (-2836.097) (-2837.399) * (-2830.344) [-2828.382] (-2837.090) (-2827.783) -- 0:04:10 517000 -- (-2833.777) (-2845.489) [-2838.509] (-2839.308) * [-2829.251] (-2840.984) (-2837.285) (-2824.854) -- 0:04:10 517500 -- (-2833.036) (-2833.888) (-2833.310) [-2836.897] * (-2835.884) [-2831.197] (-2837.721) (-2846.237) -- 0:04:09 518000 -- (-2841.283) (-2837.212) [-2828.098] (-2835.764) * [-2826.428] (-2833.475) (-2834.775) (-2840.072) -- 0:04:10 518500 -- (-2829.733) [-2829.235] (-2824.774) (-2844.891) * (-2846.244) (-2850.280) (-2835.635) [-2831.273] -- 0:04:09 519000 -- (-2833.349) (-2835.305) [-2828.071] (-2842.585) * [-2826.034] (-2838.246) (-2842.956) (-2835.911) -- 0:04:09 519500 -- (-2832.040) [-2841.410] (-2830.925) (-2847.339) * [-2836.277] (-2833.648) (-2837.267) (-2833.888) -- 0:04:08 520000 -- (-2837.667) (-2849.378) (-2841.441) [-2833.502] * (-2833.366) (-2837.142) [-2832.187] (-2836.151) -- 0:04:09 Average standard deviation of split frequencies: 0.009537 520500 -- (-2830.673) [-2834.827] (-2849.020) (-2832.409) * (-2827.101) (-2837.284) (-2837.164) [-2840.667] -- 0:04:08 521000 -- [-2831.523] (-2839.660) (-2834.101) (-2827.719) * [-2828.509] (-2829.499) (-2837.331) (-2835.300) -- 0:04:08 521500 -- (-2841.845) (-2844.484) (-2841.917) [-2826.133] * [-2835.251] (-2835.313) (-2831.713) (-2837.519) -- 0:04:07 522000 -- (-2839.554) [-2834.107] (-2837.956) (-2834.505) * (-2836.533) (-2830.814) [-2831.016] (-2840.463) -- 0:04:08 522500 -- (-2839.026) (-2828.801) (-2831.430) [-2833.798] * (-2837.882) (-2834.656) (-2828.275) [-2822.724] -- 0:04:07 523000 -- (-2835.217) [-2833.420] (-2831.853) (-2841.503) * (-2834.033) (-2846.430) [-2829.878] (-2837.274) -- 0:04:07 523500 -- [-2832.036] (-2839.929) (-2832.322) (-2836.599) * (-2840.986) [-2832.004] (-2830.165) (-2834.053) -- 0:04:06 524000 -- [-2839.176] (-2829.867) (-2843.863) (-2834.334) * (-2826.943) (-2827.677) [-2832.062] (-2834.030) -- 0:04:07 524500 -- (-2833.430) [-2828.759] (-2831.697) (-2843.048) * (-2835.718) [-2835.319] (-2832.058) (-2833.164) -- 0:04:06 525000 -- (-2843.766) (-2830.935) (-2840.053) [-2830.051] * (-2838.956) (-2830.402) [-2835.325] (-2838.804) -- 0:04:06 Average standard deviation of split frequencies: 0.010097 525500 -- (-2833.604) [-2832.883] (-2860.595) (-2835.128) * (-2830.694) [-2835.419] (-2839.521) (-2844.771) -- 0:04:05 526000 -- (-2838.104) [-2828.982] (-2839.888) (-2830.723) * (-2833.638) (-2828.374) [-2837.104] (-2838.543) -- 0:04:06 526500 -- (-2832.859) [-2835.019] (-2824.631) (-2833.783) * (-2838.002) (-2844.631) (-2846.182) [-2835.577] -- 0:04:05 527000 -- (-2834.981) [-2830.828] (-2830.154) (-2846.683) * [-2827.824] (-2844.024) (-2837.892) (-2830.061) -- 0:04:05 527500 -- [-2850.678] (-2832.800) (-2838.380) (-2841.339) * (-2842.933) (-2831.174) (-2847.694) [-2829.276] -- 0:04:05 528000 -- (-2834.187) (-2851.469) (-2832.341) [-2835.021] * (-2834.197) [-2822.934] (-2845.322) (-2854.845) -- 0:04:04 528500 -- [-2830.447] (-2833.159) (-2837.956) (-2839.867) * (-2833.227) (-2836.024) (-2826.473) [-2831.114] -- 0:04:04 529000 -- (-2837.840) (-2830.066) (-2832.019) [-2827.662] * (-2843.393) (-2832.267) [-2831.169] (-2832.303) -- 0:04:03 529500 -- (-2833.411) (-2845.616) (-2831.136) [-2832.394] * (-2851.897) (-2830.940) [-2828.228] (-2837.326) -- 0:04:04 530000 -- (-2841.277) (-2835.735) [-2835.894] (-2837.431) * [-2832.571] (-2833.361) (-2846.823) (-2836.620) -- 0:04:03 Average standard deviation of split frequencies: 0.009653 530500 -- (-2825.025) (-2841.100) [-2838.999] (-2839.710) * (-2828.654) [-2828.545] (-2837.982) (-2832.191) -- 0:04:03 531000 -- (-2844.027) [-2834.908] (-2831.914) (-2836.767) * (-2831.123) (-2831.299) [-2835.906] (-2835.534) -- 0:04:02 531500 -- (-2839.314) (-2831.825) (-2839.638) [-2830.631] * (-2838.916) (-2835.862) [-2832.377] (-2832.701) -- 0:04:03 532000 -- (-2832.533) [-2826.877] (-2834.529) (-2834.143) * (-2836.421) (-2836.244) (-2842.236) [-2829.960] -- 0:04:02 532500 -- (-2833.796) (-2840.157) [-2830.191] (-2834.325) * [-2832.532] (-2831.559) (-2833.411) (-2832.544) -- 0:04:02 533000 -- (-2835.803) [-2838.231] (-2834.159) (-2836.899) * (-2844.080) (-2838.645) [-2831.559] (-2837.393) -- 0:04:02 533500 -- (-2837.498) (-2843.927) (-2833.194) [-2836.089] * (-2829.398) (-2842.859) (-2830.859) [-2834.591] -- 0:04:02 534000 -- [-2833.445] (-2848.761) (-2831.673) (-2833.610) * (-2826.239) (-2843.950) [-2831.314] (-2843.839) -- 0:04:01 534500 -- (-2835.294) (-2829.850) (-2832.447) [-2831.557] * (-2832.250) (-2839.552) [-2826.302] (-2841.054) -- 0:04:01 535000 -- [-2832.772] (-2828.185) (-2830.262) (-2845.708) * (-2837.020) [-2829.861] (-2838.290) (-2838.350) -- 0:04:01 Average standard deviation of split frequencies: 0.009557 535500 -- (-2835.340) [-2830.103] (-2838.061) (-2835.249) * [-2826.981] (-2833.264) (-2833.689) (-2839.702) -- 0:04:01 536000 -- (-2834.069) (-2828.019) [-2826.889] (-2835.696) * (-2837.876) (-2832.153) (-2830.285) [-2838.278] -- 0:04:00 536500 -- (-2832.759) [-2830.872] (-2833.411) (-2842.608) * [-2833.537] (-2834.405) (-2830.157) (-2840.872) -- 0:04:01 537000 -- (-2835.655) [-2826.451] (-2834.919) (-2844.815) * [-2831.257] (-2824.589) (-2830.710) (-2842.168) -- 0:04:00 537500 -- (-2848.358) (-2838.209) [-2833.893] (-2825.961) * (-2829.035) [-2833.148] (-2839.192) (-2843.363) -- 0:04:00 538000 -- (-2839.988) [-2828.807] (-2847.667) (-2829.691) * (-2844.395) (-2829.386) (-2840.140) [-2839.661] -- 0:03:59 538500 -- (-2846.384) [-2840.832] (-2839.034) (-2843.184) * (-2845.567) (-2839.070) (-2840.832) [-2839.142] -- 0:03:59 539000 -- (-2842.561) [-2831.305] (-2832.081) (-2837.413) * (-2839.900) (-2838.783) (-2844.818) [-2838.869] -- 0:03:59 539500 -- (-2845.780) (-2828.470) (-2838.321) [-2839.968] * (-2833.076) (-2837.591) (-2849.351) [-2829.113] -- 0:03:58 540000 -- (-2847.976) [-2832.141] (-2837.879) (-2831.179) * [-2829.877] (-2832.495) (-2840.001) (-2841.293) -- 0:03:58 Average standard deviation of split frequencies: 0.009068 540500 -- (-2834.183) [-2828.544] (-2846.816) (-2843.211) * [-2826.632] (-2835.831) (-2832.922) (-2829.908) -- 0:03:58 541000 -- (-2838.166) (-2845.155) [-2830.839] (-2841.942) * (-2835.936) (-2830.139) [-2830.248] (-2838.412) -- 0:03:58 541500 -- [-2828.665] (-2837.662) (-2836.409) (-2839.685) * (-2840.333) (-2827.539) [-2835.537] (-2826.941) -- 0:03:57 542000 -- [-2826.087] (-2833.996) (-2842.910) (-2831.874) * (-2837.915) (-2830.557) [-2826.048] (-2828.474) -- 0:03:58 542500 -- (-2844.274) [-2826.579] (-2831.420) (-2829.840) * (-2829.539) (-2833.983) [-2832.126] (-2830.146) -- 0:03:57 543000 -- (-2828.628) [-2827.899] (-2839.593) (-2836.760) * (-2843.019) [-2835.137] (-2832.177) (-2840.536) -- 0:03:57 543500 -- [-2836.423] (-2826.856) (-2837.669) (-2828.837) * [-2826.339] (-2842.261) (-2830.571) (-2836.242) -- 0:03:56 544000 -- (-2832.656) (-2831.319) (-2842.592) [-2839.772] * [-2834.529] (-2839.436) (-2835.225) (-2832.045) -- 0:03:57 544500 -- [-2831.661] (-2832.764) (-2837.287) (-2843.361) * [-2830.236] (-2836.281) (-2841.797) (-2841.935) -- 0:03:56 545000 -- [-2832.995] (-2851.284) (-2833.077) (-2847.034) * (-2823.924) (-2845.803) (-2843.638) [-2832.651] -- 0:03:56 Average standard deviation of split frequencies: 0.009094 545500 -- [-2832.587] (-2835.329) (-2835.195) (-2836.926) * [-2831.132] (-2837.680) (-2835.932) (-2842.038) -- 0:03:55 546000 -- [-2839.311] (-2843.292) (-2827.450) (-2832.286) * (-2832.972) (-2837.815) (-2828.685) [-2832.227] -- 0:03:56 546500 -- (-2838.410) [-2834.887] (-2830.586) (-2843.825) * (-2834.887) [-2838.593] (-2829.233) (-2842.350) -- 0:03:55 547000 -- (-2831.345) (-2829.327) [-2828.493] (-2838.714) * (-2841.056) (-2836.934) [-2828.212] (-2849.583) -- 0:03:55 547500 -- (-2832.562) [-2831.842] (-2850.533) (-2831.722) * (-2835.493) (-2848.851) [-2827.629] (-2842.068) -- 0:03:55 548000 -- (-2837.354) (-2838.484) (-2849.738) [-2833.244] * (-2834.329) (-2834.727) (-2844.515) [-2840.888] -- 0:03:55 548500 -- [-2831.457] (-2831.502) (-2843.214) (-2839.588) * (-2838.343) (-2829.825) [-2844.986] (-2839.336) -- 0:03:54 549000 -- [-2833.622] (-2836.864) (-2839.081) (-2830.154) * [-2830.680] (-2827.661) (-2839.125) (-2854.117) -- 0:03:54 549500 -- (-2831.214) (-2840.852) [-2840.770] (-2836.689) * [-2837.448] (-2832.379) (-2833.051) (-2846.992) -- 0:03:54 550000 -- [-2839.035] (-2835.680) (-2836.858) (-2836.786) * (-2833.018) (-2840.054) [-2835.334] (-2844.521) -- 0:03:53 Average standard deviation of split frequencies: 0.009017 550500 -- [-2827.789] (-2838.101) (-2837.869) (-2839.695) * (-2831.322) (-2836.995) (-2835.755) [-2840.858] -- 0:03:53 551000 -- (-2834.386) [-2831.177] (-2831.239) (-2830.464) * [-2841.598] (-2829.687) (-2846.241) (-2837.873) -- 0:03:53 551500 -- (-2833.348) [-2845.606] (-2838.457) (-2840.920) * (-2829.159) (-2831.099) (-2843.494) [-2832.762] -- 0:03:53 552000 -- [-2834.193] (-2838.422) (-2835.432) (-2838.787) * (-2838.359) (-2847.455) [-2838.606] (-2835.265) -- 0:03:52 552500 -- (-2829.801) (-2836.489) [-2834.171] (-2829.971) * [-2834.960] (-2834.470) (-2832.787) (-2839.073) -- 0:03:52 553000 -- (-2836.980) (-2833.441) (-2825.726) [-2832.297] * (-2835.315) (-2838.418) [-2832.791] (-2844.318) -- 0:03:51 553500 -- [-2831.065] (-2838.324) (-2835.149) (-2841.543) * (-2832.660) (-2852.095) (-2831.018) [-2838.345] -- 0:03:52 554000 -- (-2832.104) (-2837.360) [-2832.602] (-2836.399) * (-2833.535) (-2841.853) (-2843.686) [-2835.224] -- 0:03:51 554500 -- (-2838.732) [-2822.703] (-2837.144) (-2842.727) * [-2837.688] (-2832.825) (-2836.628) (-2829.909) -- 0:03:51 555000 -- (-2828.275) [-2833.464] (-2839.618) (-2837.819) * (-2830.065) [-2836.073] (-2837.612) (-2842.916) -- 0:03:50 Average standard deviation of split frequencies: 0.007970 555500 -- (-2825.305) [-2831.585] (-2828.159) (-2840.102) * (-2832.789) [-2832.929] (-2840.652) (-2843.832) -- 0:03:51 556000 -- (-2827.763) (-2836.767) [-2835.858] (-2847.623) * (-2838.605) (-2838.759) (-2833.022) [-2835.630] -- 0:03:50 556500 -- (-2844.267) (-2830.619) (-2832.077) [-2832.116] * [-2830.937] (-2832.904) (-2835.051) (-2834.503) -- 0:03:50 557000 -- (-2830.186) (-2836.636) (-2835.367) [-2834.859] * [-2841.248] (-2834.288) (-2830.799) (-2849.370) -- 0:03:49 557500 -- (-2833.763) (-2840.730) [-2838.255] (-2848.565) * [-2827.863] (-2836.028) (-2838.625) (-2850.235) -- 0:03:50 558000 -- (-2832.668) (-2847.797) (-2828.040) [-2829.126] * (-2830.404) [-2830.391] (-2834.004) (-2841.305) -- 0:03:49 558500 -- [-2837.571] (-2844.462) (-2836.750) (-2840.047) * (-2843.033) (-2839.426) [-2832.587] (-2838.048) -- 0:03:49 559000 -- (-2848.590) [-2831.746] (-2836.438) (-2833.875) * (-2830.067) (-2831.039) [-2828.726] (-2832.215) -- 0:03:49 559500 -- (-2851.959) (-2833.434) (-2838.050) [-2835.863] * (-2838.201) (-2830.920) [-2828.598] (-2830.410) -- 0:03:49 560000 -- [-2833.069] (-2837.450) (-2832.603) (-2834.100) * (-2846.290) (-2836.827) [-2838.825] (-2829.144) -- 0:03:48 Average standard deviation of split frequencies: 0.008800 560500 -- (-2830.998) [-2834.127] (-2830.991) (-2838.401) * (-2836.183) (-2828.631) [-2838.349] (-2829.800) -- 0:03:48 561000 -- (-2841.034) [-2839.982] (-2837.982) (-2832.327) * (-2840.870) (-2836.256) (-2836.823) [-2834.874] -- 0:03:48 561500 -- [-2827.927] (-2844.683) (-2841.931) (-2836.767) * (-2845.311) (-2843.838) (-2829.451) [-2831.905] -- 0:03:48 562000 -- (-2834.308) (-2832.068) [-2835.441] (-2838.726) * (-2846.452) (-2832.585) (-2835.693) [-2839.503] -- 0:03:47 562500 -- (-2837.314) [-2833.401] (-2827.988) (-2839.611) * (-2838.563) (-2836.226) (-2836.357) [-2844.473] -- 0:03:47 563000 -- (-2836.418) (-2834.087) (-2828.354) [-2827.953] * [-2828.190] (-2837.632) (-2834.982) (-2845.672) -- 0:03:47 563500 -- (-2837.211) (-2833.646) (-2834.055) [-2827.849] * [-2833.024] (-2831.155) (-2840.320) (-2843.701) -- 0:03:46 564000 -- (-2837.558) (-2834.043) [-2838.416] (-2827.069) * [-2829.549] (-2857.134) (-2835.739) (-2840.392) -- 0:03:46 564500 -- (-2841.411) (-2832.805) (-2831.722) [-2834.151] * (-2835.531) (-2841.455) [-2837.437] (-2839.670) -- 0:03:46 565000 -- (-2844.558) (-2841.941) [-2827.429] (-2826.779) * (-2838.143) (-2839.979) [-2825.441] (-2833.394) -- 0:03:46 Average standard deviation of split frequencies: 0.008495 565500 -- (-2836.867) (-2832.218) (-2836.879) [-2832.834] * (-2836.940) [-2828.849] (-2833.053) (-2839.836) -- 0:03:45 566000 -- (-2833.481) (-2836.620) (-2826.661) [-2829.144] * (-2840.840) (-2839.175) (-2831.810) [-2834.843] -- 0:03:46 566500 -- (-2835.721) (-2840.374) [-2833.383] (-2843.622) * (-2831.221) [-2831.060] (-2832.695) (-2841.989) -- 0:03:45 567000 -- (-2834.619) (-2844.472) (-2834.455) [-2833.110] * [-2824.265] (-2846.231) (-2837.497) (-2846.082) -- 0:03:45 567500 -- (-2836.049) [-2832.900] (-2836.709) (-2834.211) * (-2832.513) (-2846.480) [-2837.375] (-2838.571) -- 0:03:45 568000 -- (-2843.260) (-2836.715) (-2840.277) [-2833.945] * [-2828.008] (-2842.307) (-2840.359) (-2845.717) -- 0:03:45 568500 -- (-2834.060) (-2832.341) [-2828.923] (-2838.709) * (-2832.282) (-2833.818) (-2839.590) [-2836.818] -- 0:03:44 569000 -- (-2835.088) (-2840.066) [-2833.507] (-2849.598) * [-2830.490] (-2837.885) (-2833.172) (-2839.119) -- 0:03:44 569500 -- (-2840.693) [-2834.182] (-2837.398) (-2855.168) * (-2833.973) [-2835.514] (-2834.495) (-2837.409) -- 0:03:44 570000 -- (-2830.765) [-2833.481] (-2835.985) (-2830.342) * (-2825.775) (-2837.906) [-2826.875] (-2835.526) -- 0:03:44 Average standard deviation of split frequencies: 0.008811 570500 -- (-2829.961) (-2824.977) [-2825.084] (-2837.164) * (-2834.146) (-2834.175) [-2826.996] (-2832.834) -- 0:03:43 571000 -- [-2834.589] (-2834.077) (-2835.274) (-2844.389) * (-2832.558) (-2832.542) (-2827.923) [-2828.681] -- 0:03:43 571500 -- (-2830.165) [-2832.738] (-2845.109) (-2857.685) * [-2829.831] (-2828.387) (-2832.388) (-2842.311) -- 0:03:43 572000 -- [-2838.351] (-2839.753) (-2838.604) (-2834.754) * [-2829.956] (-2834.887) (-2842.161) (-2833.225) -- 0:03:42 572500 -- [-2835.763] (-2836.547) (-2851.514) (-2832.011) * (-2841.824) (-2847.026) [-2832.644] (-2841.493) -- 0:03:42 573000 -- (-2835.718) [-2831.136] (-2845.244) (-2836.730) * (-2833.171) (-2832.688) [-2831.014] (-2835.923) -- 0:03:42 573500 -- (-2841.586) [-2823.891] (-2844.715) (-2834.679) * (-2849.205) [-2823.762] (-2829.339) (-2834.672) -- 0:03:42 574000 -- [-2836.951] (-2832.988) (-2840.058) (-2845.061) * (-2847.197) [-2832.015] (-2839.200) (-2842.538) -- 0:03:41 574500 -- (-2832.710) [-2837.906] (-2832.856) (-2838.775) * (-2836.484) [-2827.833] (-2841.400) (-2834.632) -- 0:03:41 575000 -- (-2836.187) (-2845.532) [-2832.803] (-2831.257) * [-2833.564] (-2833.737) (-2837.947) (-2834.127) -- 0:03:41 Average standard deviation of split frequencies: 0.008893 575500 -- (-2837.445) (-2837.242) [-2833.540] (-2838.386) * (-2833.307) [-2837.137] (-2830.609) (-2829.389) -- 0:03:41 576000 -- [-2834.064] (-2842.189) (-2838.212) (-2843.187) * (-2842.326) (-2839.925) [-2840.037] (-2827.982) -- 0:03:40 576500 -- (-2839.718) (-2839.130) [-2835.228] (-2835.837) * (-2832.585) (-2843.152) (-2839.918) [-2835.430] -- 0:03:41 577000 -- (-2834.930) [-2835.490] (-2837.995) (-2840.652) * (-2831.979) (-2831.814) (-2838.804) [-2834.678] -- 0:03:40 577500 -- [-2830.511] (-2836.606) (-2838.853) (-2839.238) * [-2836.722] (-2834.405) (-2839.138) (-2832.097) -- 0:03:40 578000 -- [-2826.493] (-2836.413) (-2831.342) (-2835.551) * (-2837.589) (-2835.010) (-2838.921) [-2831.149] -- 0:03:39 578500 -- (-2841.152) (-2854.009) (-2832.328) [-2831.395] * (-2839.153) (-2831.098) [-2837.092] (-2834.601) -- 0:03:40 579000 -- [-2836.653] (-2841.014) (-2833.395) (-2840.263) * (-2839.252) [-2829.452] (-2841.067) (-2831.760) -- 0:03:39 579500 -- [-2833.356] (-2839.476) (-2838.129) (-2846.977) * (-2833.720) (-2829.069) [-2831.661] (-2827.847) -- 0:03:39 580000 -- (-2828.261) (-2845.212) [-2835.502] (-2833.381) * [-2829.278] (-2841.132) (-2832.135) (-2830.078) -- 0:03:39 Average standard deviation of split frequencies: 0.008064 580500 -- (-2832.747) (-2832.330) [-2835.765] (-2837.765) * [-2829.960] (-2844.423) (-2834.086) (-2824.909) -- 0:03:38 581000 -- (-2832.737) (-2826.451) (-2840.661) [-2827.657] * (-2836.495) (-2844.865) [-2837.383] (-2829.709) -- 0:03:38 581500 -- (-2831.653) [-2833.799] (-2851.520) (-2833.639) * [-2830.409] (-2836.986) (-2833.957) (-2834.858) -- 0:03:38 582000 -- (-2833.085) (-2840.028) [-2832.299] (-2840.319) * (-2834.798) [-2830.114] (-2839.316) (-2828.352) -- 0:03:38 582500 -- (-2835.356) (-2827.983) (-2827.707) [-2830.192] * (-2832.612) (-2833.962) (-2849.389) [-2825.472] -- 0:03:37 583000 -- (-2837.243) [-2824.450] (-2830.022) (-2838.032) * (-2837.408) (-2835.238) (-2833.120) [-2833.081] -- 0:03:37 583500 -- [-2837.278] (-2830.978) (-2837.234) (-2836.072) * (-2843.488) (-2837.953) [-2833.869] (-2840.009) -- 0:03:36 584000 -- (-2851.253) [-2844.645] (-2842.311) (-2845.788) * (-2834.088) [-2835.583] (-2835.800) (-2842.841) -- 0:03:37 584500 -- (-2832.582) (-2836.868) (-2830.160) [-2831.414] * [-2839.833] (-2838.300) (-2830.942) (-2835.113) -- 0:03:36 585000 -- [-2833.666] (-2829.869) (-2833.917) (-2826.784) * (-2839.758) [-2837.034] (-2833.454) (-2835.166) -- 0:03:36 Average standard deviation of split frequencies: 0.008259 585500 -- (-2833.778) [-2834.870] (-2833.637) (-2832.818) * (-2843.293) (-2834.921) (-2833.701) [-2841.076] -- 0:03:35 586000 -- (-2830.090) (-2842.450) (-2830.732) [-2828.779] * (-2840.521) [-2829.867] (-2837.931) (-2837.427) -- 0:03:36 586500 -- [-2834.318] (-2840.808) (-2835.178) (-2837.079) * (-2834.673) (-2834.320) [-2829.448] (-2852.187) -- 0:03:35 587000 -- (-2842.349) (-2833.223) [-2836.560] (-2843.704) * (-2828.941) (-2848.644) [-2830.411] (-2833.442) -- 0:03:35 587500 -- (-2836.287) (-2845.438) [-2834.325] (-2842.867) * (-2834.408) (-2835.204) [-2831.626] (-2831.326) -- 0:03:35 588000 -- [-2834.175] (-2828.265) (-2837.358) (-2848.485) * [-2830.172] (-2840.672) (-2831.278) (-2840.249) -- 0:03:35 588500 -- (-2830.683) (-2836.552) (-2829.820) [-2828.842] * [-2827.748] (-2831.163) (-2835.633) (-2837.528) -- 0:03:34 589000 -- [-2832.433] (-2833.409) (-2844.498) (-2839.997) * (-2832.202) (-2828.718) (-2839.987) [-2831.988] -- 0:03:34 589500 -- [-2833.335] (-2838.216) (-2838.729) (-2841.036) * (-2849.935) [-2830.822] (-2837.500) (-2833.458) -- 0:03:34 590000 -- (-2841.836) [-2830.143] (-2836.630) (-2845.976) * [-2830.266] (-2841.206) (-2833.166) (-2839.242) -- 0:03:34 Average standard deviation of split frequencies: 0.008194 590500 -- (-2836.528) [-2830.806] (-2836.779) (-2835.029) * [-2829.046] (-2838.883) (-2828.441) (-2838.287) -- 0:03:33 591000 -- (-2841.837) (-2830.911) [-2832.153] (-2837.975) * [-2833.228] (-2830.284) (-2847.928) (-2837.738) -- 0:03:33 591500 -- [-2833.279] (-2836.197) (-2829.426) (-2830.915) * (-2835.027) [-2842.051] (-2839.823) (-2825.299) -- 0:03:33 592000 -- (-2830.683) (-2840.911) (-2838.535) [-2832.088] * (-2833.501) (-2843.282) (-2839.255) [-2826.324] -- 0:03:32 592500 -- [-2831.352] (-2833.329) (-2840.196) (-2844.653) * [-2831.675] (-2847.140) (-2835.243) (-2829.508) -- 0:03:32 593000 -- (-2838.294) [-2835.020] (-2828.815) (-2840.629) * (-2844.280) [-2838.411] (-2844.894) (-2833.282) -- 0:03:32 593500 -- (-2841.797) (-2833.750) (-2837.247) [-2834.412] * (-2834.864) (-2846.296) [-2830.791] (-2834.611) -- 0:03:32 594000 -- (-2835.577) (-2835.454) (-2825.802) [-2826.953] * (-2842.201) (-2846.994) (-2838.782) [-2837.558] -- 0:03:31 594500 -- [-2827.150] (-2839.308) (-2833.073) (-2835.243) * [-2829.955] (-2845.793) (-2827.031) (-2840.592) -- 0:03:31 595000 -- (-2832.144) [-2837.356] (-2839.425) (-2834.033) * (-2842.442) (-2838.689) (-2838.242) [-2828.102] -- 0:03:31 Average standard deviation of split frequencies: 0.008700 595500 -- [-2827.513] (-2843.031) (-2835.566) (-2846.464) * (-2846.453) (-2841.181) [-2828.550] (-2836.581) -- 0:03:31 596000 -- (-2829.647) (-2831.129) [-2834.863] (-2829.546) * (-2833.687) (-2850.011) (-2828.292) [-2830.666] -- 0:03:30 596500 -- (-2833.145) (-2834.148) (-2837.824) [-2828.927] * (-2836.191) (-2847.105) [-2828.828] (-2837.945) -- 0:03:30 597000 -- (-2839.614) (-2841.674) (-2840.427) [-2831.424] * (-2834.292) (-2836.377) (-2830.069) [-2827.240] -- 0:03:29 597500 -- [-2834.173] (-2829.624) (-2842.420) (-2835.028) * (-2833.539) [-2831.692] (-2836.077) (-2828.015) -- 0:03:30 598000 -- (-2840.393) (-2837.269) [-2837.315] (-2843.307) * (-2833.742) (-2831.945) [-2827.083] (-2845.431) -- 0:03:29 598500 -- (-2837.438) [-2830.507] (-2848.356) (-2832.403) * (-2830.327) (-2845.839) [-2825.538] (-2840.973) -- 0:03:29 599000 -- [-2836.128] (-2833.759) (-2827.575) (-2837.722) * (-2841.350) (-2837.644) [-2828.063] (-2838.939) -- 0:03:28 599500 -- (-2835.774) [-2827.081] (-2835.150) (-2830.167) * (-2832.161) (-2834.542) (-2838.475) [-2841.423] -- 0:03:29 600000 -- (-2838.461) (-2830.367) [-2832.883] (-2841.998) * (-2838.839) (-2833.076) (-2827.884) [-2831.985] -- 0:03:28 Average standard deviation of split frequencies: 0.008737 600500 -- (-2837.616) [-2837.135] (-2836.739) (-2834.189) * (-2849.359) (-2841.403) [-2831.531] (-2831.973) -- 0:03:28 601000 -- [-2829.912] (-2840.128) (-2839.359) (-2831.620) * (-2845.171) (-2839.665) [-2833.975] (-2831.694) -- 0:03:27 601500 -- (-2830.013) (-2837.726) [-2823.353] (-2835.680) * (-2847.637) (-2831.507) (-2834.202) [-2835.723] -- 0:03:28 602000 -- (-2846.879) (-2847.162) [-2831.269] (-2835.252) * (-2844.215) [-2840.563] (-2826.847) (-2829.288) -- 0:03:27 602500 -- (-2842.449) (-2833.917) (-2846.834) [-2840.279] * (-2835.873) (-2835.945) (-2837.892) [-2833.456] -- 0:03:27 603000 -- (-2842.093) (-2841.855) (-2835.010) [-2834.006] * [-2831.761] (-2841.149) (-2837.727) (-2839.460) -- 0:03:26 603500 -- [-2854.193] (-2845.649) (-2836.997) (-2830.630) * (-2829.887) [-2828.128] (-2834.732) (-2838.420) -- 0:03:26 604000 -- (-2835.856) (-2839.171) [-2834.386] (-2832.080) * (-2834.610) (-2829.126) [-2842.148] (-2839.148) -- 0:03:26 604500 -- (-2839.750) (-2837.285) [-2831.673] (-2842.623) * (-2835.203) [-2825.542] (-2833.316) (-2835.084) -- 0:03:26 605000 -- (-2826.793) (-2843.215) [-2830.389] (-2834.688) * (-2841.340) [-2831.029] (-2837.244) (-2833.783) -- 0:03:26 Average standard deviation of split frequencies: 0.008764 605500 -- (-2829.848) (-2836.843) [-2832.119] (-2829.204) * (-2841.453) [-2829.151] (-2834.305) (-2835.345) -- 0:03:25 606000 -- (-2836.516) [-2832.058] (-2843.826) (-2832.778) * [-2832.689] (-2842.676) (-2840.644) (-2843.671) -- 0:03:25 606500 -- (-2843.375) (-2829.957) (-2829.928) [-2831.972] * (-2840.271) (-2829.671) (-2833.319) [-2831.431] -- 0:03:25 607000 -- [-2836.354] (-2839.864) (-2844.319) (-2837.488) * [-2840.532] (-2835.488) (-2833.516) (-2829.383) -- 0:03:25 607500 -- [-2835.161] (-2829.826) (-2849.812) (-2838.508) * [-2836.281] (-2835.934) (-2833.355) (-2849.181) -- 0:03:24 608000 -- (-2842.479) (-2835.185) (-2826.557) [-2838.897] * (-2838.987) (-2838.855) [-2837.741] (-2847.728) -- 0:03:24 608500 -- [-2829.218] (-2836.009) (-2835.752) (-2835.345) * (-2843.469) (-2833.192) (-2827.852) [-2839.236] -- 0:03:23 609000 -- [-2828.183] (-2845.791) (-2846.097) (-2840.830) * (-2833.533) (-2842.352) (-2827.362) [-2837.707] -- 0:03:24 609500 -- (-2844.049) (-2841.719) [-2834.858] (-2845.113) * (-2838.460) (-2838.543) (-2838.342) [-2829.165] -- 0:03:23 610000 -- (-2834.542) (-2843.849) (-2832.843) [-2841.505] * (-2844.457) [-2831.016] (-2833.530) (-2842.049) -- 0:03:23 Average standard deviation of split frequencies: 0.008131 610500 -- (-2831.317) (-2835.947) (-2836.898) [-2832.508] * (-2845.225) (-2836.747) [-2829.673] (-2832.157) -- 0:03:22 611000 -- (-2834.237) [-2837.057] (-2839.529) (-2840.493) * (-2855.248) (-2830.995) [-2833.117] (-2830.029) -- 0:03:23 611500 -- [-2835.386] (-2835.032) (-2837.360) (-2838.559) * (-2843.638) [-2827.146] (-2832.286) (-2832.042) -- 0:03:22 612000 -- (-2832.624) [-2827.470] (-2836.325) (-2835.403) * [-2841.010] (-2831.410) (-2840.905) (-2840.331) -- 0:03:22 612500 -- (-2843.525) [-2834.462] (-2834.035) (-2838.135) * (-2845.592) (-2837.844) [-2830.920] (-2843.968) -- 0:03:22 613000 -- (-2844.352) [-2828.581] (-2835.869) (-2837.866) * [-2831.119] (-2830.281) (-2830.303) (-2849.289) -- 0:03:22 613500 -- (-2842.660) [-2831.928] (-2831.136) (-2842.879) * (-2847.035) (-2842.005) (-2850.057) [-2840.624] -- 0:03:21 614000 -- (-2834.198) (-2835.091) (-2832.026) [-2836.773] * (-2845.469) (-2834.998) (-2835.445) [-2837.312] -- 0:03:21 614500 -- [-2831.208] (-2835.915) (-2833.869) (-2829.035) * (-2830.437) (-2836.125) [-2829.225] (-2833.238) -- 0:03:21 615000 -- [-2828.488] (-2835.009) (-2855.294) (-2831.436) * (-2832.832) [-2832.608] (-2842.452) (-2833.366) -- 0:03:20 Average standard deviation of split frequencies: 0.008418 615500 -- (-2828.937) (-2831.306) (-2846.200) [-2835.730] * (-2848.038) (-2824.577) (-2835.672) [-2826.207] -- 0:03:20 616000 -- [-2834.019] (-2835.025) (-2841.300) (-2844.723) * (-2842.722) (-2835.768) (-2837.288) [-2838.174] -- 0:03:20 616500 -- (-2829.266) (-2836.600) [-2836.394] (-2846.691) * (-2835.864) (-2833.297) (-2828.283) [-2833.832] -- 0:03:20 617000 -- (-2841.753) (-2843.364) [-2830.598] (-2839.478) * (-2831.669) (-2835.152) [-2839.821] (-2835.587) -- 0:03:19 617500 -- (-2832.105) (-2837.672) [-2834.563] (-2833.802) * (-2848.994) (-2835.891) [-2834.181] (-2835.979) -- 0:03:19 618000 -- (-2838.802) (-2841.098) (-2835.962) [-2829.351] * (-2837.172) (-2833.689) (-2836.280) [-2828.015] -- 0:03:19 618500 -- (-2839.583) (-2838.031) [-2833.093] (-2838.112) * [-2826.544] (-2831.271) (-2839.786) (-2831.299) -- 0:03:19 619000 -- (-2838.667) (-2831.881) [-2829.533] (-2834.455) * (-2831.246) [-2833.924] (-2830.527) (-2830.719) -- 0:03:18 619500 -- (-2845.409) [-2832.679] (-2833.693) (-2836.617) * (-2834.933) [-2832.951] (-2832.306) (-2836.719) -- 0:03:18 620000 -- (-2846.414) (-2836.316) [-2826.503] (-2835.800) * (-2832.148) (-2830.811) (-2828.683) [-2831.428] -- 0:03:17 Average standard deviation of split frequencies: 0.007704 620500 -- (-2835.022) (-2838.483) (-2835.047) [-2829.501] * (-2849.982) (-2828.024) [-2839.653] (-2841.228) -- 0:03:18 621000 -- (-2838.284) (-2837.275) [-2828.269] (-2838.610) * (-2837.087) [-2824.390] (-2848.595) (-2840.549) -- 0:03:17 621500 -- (-2833.528) (-2835.126) (-2827.533) [-2834.214] * (-2831.977) [-2831.050] (-2841.502) (-2836.368) -- 0:03:17 622000 -- [-2832.905] (-2838.522) (-2835.691) (-2833.294) * (-2837.532) (-2833.987) [-2838.704] (-2833.311) -- 0:03:16 622500 -- (-2838.259) (-2844.592) (-2828.590) [-2831.870] * (-2844.274) [-2833.170] (-2836.603) (-2840.563) -- 0:03:17 623000 -- (-2840.841) [-2832.428] (-2836.178) (-2824.929) * (-2840.311) [-2833.034] (-2835.493) (-2841.519) -- 0:03:16 623500 -- (-2849.120) (-2830.401) [-2837.280] (-2839.615) * (-2838.440) [-2837.167] (-2827.404) (-2843.854) -- 0:03:16 624000 -- (-2850.212) (-2831.354) (-2842.900) [-2833.813] * (-2826.869) [-2828.569] (-2840.194) (-2834.898) -- 0:03:15 624500 -- (-2832.419) [-2833.372] (-2840.126) (-2842.826) * (-2833.060) [-2824.112] (-2841.249) (-2842.650) -- 0:03:16 625000 -- (-2846.320) [-2835.599] (-2835.497) (-2833.105) * [-2832.382] (-2829.702) (-2829.086) (-2843.545) -- 0:03:15 Average standard deviation of split frequencies: 0.008484 625500 -- (-2828.445) (-2836.645) [-2828.268] (-2835.661) * (-2844.959) [-2838.641] (-2829.241) (-2847.671) -- 0:03:15 626000 -- (-2832.029) (-2835.610) [-2826.319] (-2843.360) * (-2833.100) (-2829.987) [-2837.068] (-2832.488) -- 0:03:14 626500 -- (-2835.476) (-2833.278) (-2834.684) [-2842.569] * (-2836.441) (-2827.557) [-2833.379] (-2833.794) -- 0:03:14 627000 -- (-2835.512) (-2829.633) (-2833.778) [-2828.931] * (-2836.297) [-2829.741] (-2837.953) (-2837.861) -- 0:03:14 627500 -- (-2833.331) (-2843.552) [-2833.583] (-2837.442) * (-2837.230) [-2835.399] (-2833.221) (-2837.287) -- 0:03:14 628000 -- (-2847.397) [-2829.519] (-2833.365) (-2849.836) * [-2830.759] (-2829.095) (-2830.029) (-2830.407) -- 0:03:13 628500 -- [-2843.635] (-2843.941) (-2837.562) (-2842.899) * (-2850.701) (-2827.338) [-2830.351] (-2832.461) -- 0:03:13 629000 -- (-2845.210) (-2840.785) (-2833.010) [-2832.148] * (-2828.719) (-2837.236) (-2839.664) [-2836.736] -- 0:03:13 629500 -- (-2849.348) (-2840.216) (-2830.329) [-2834.768] * (-2835.784) (-2834.146) (-2837.977) [-2834.525] -- 0:03:13 630000 -- (-2839.528) (-2831.980) [-2836.161] (-2830.445) * [-2831.323] (-2829.206) (-2834.489) (-2829.618) -- 0:03:13 Average standard deviation of split frequencies: 0.008671 630500 -- (-2832.435) [-2832.601] (-2834.193) (-2839.042) * (-2824.962) [-2829.239] (-2839.384) (-2833.241) -- 0:03:12 631000 -- (-2838.413) (-2833.056) [-2841.774] (-2835.408) * [-2830.403] (-2831.940) (-2835.583) (-2833.819) -- 0:03:12 631500 -- (-2830.557) (-2850.862) (-2831.448) [-2835.215] * (-2834.025) [-2825.351] (-2843.781) (-2842.747) -- 0:03:12 632000 -- (-2832.184) (-2840.431) (-2839.301) [-2835.035] * (-2838.711) [-2831.018] (-2832.959) (-2838.299) -- 0:03:12 632500 -- (-2835.905) (-2837.753) (-2834.190) [-2842.250] * (-2838.717) [-2831.682] (-2838.038) (-2846.422) -- 0:03:11 633000 -- (-2829.371) (-2833.677) (-2830.045) [-2838.011] * (-2842.912) [-2842.425] (-2835.937) (-2831.460) -- 0:03:11 633500 -- (-2832.938) (-2841.108) [-2830.417] (-2842.043) * (-2837.088) (-2834.979) (-2836.922) [-2828.764] -- 0:03:11 634000 -- [-2831.391] (-2825.109) (-2824.021) (-2838.270) * (-2838.153) (-2841.911) (-2839.965) [-2835.043] -- 0:03:11 634500 -- (-2833.062) [-2833.768] (-2833.265) (-2841.906) * (-2829.038) (-2835.940) (-2827.412) [-2827.242] -- 0:03:10 635000 -- [-2835.420] (-2830.941) (-2834.621) (-2838.660) * (-2841.231) (-2838.609) (-2832.868) [-2838.241] -- 0:03:10 Average standard deviation of split frequencies: 0.008418 635500 -- (-2832.784) (-2827.775) (-2840.783) [-2832.056] * (-2848.557) (-2842.792) (-2831.139) [-2831.146] -- 0:03:10 636000 -- (-2829.251) (-2831.758) (-2839.738) [-2833.225] * [-2831.849] (-2837.868) (-2838.581) (-2831.776) -- 0:03:10 636500 -- (-2831.427) [-2834.120] (-2831.219) (-2839.861) * (-2833.992) [-2833.735] (-2835.596) (-2840.412) -- 0:03:09 637000 -- (-2827.269) [-2828.498] (-2835.353) (-2850.760) * (-2830.956) (-2836.925) [-2837.693] (-2837.299) -- 0:03:09 637500 -- [-2837.202] (-2833.638) (-2829.282) (-2834.730) * (-2848.785) [-2827.264] (-2847.997) (-2828.470) -- 0:03:09 638000 -- [-2833.315] (-2833.303) (-2832.756) (-2830.237) * (-2836.105) [-2834.882] (-2834.470) (-2833.653) -- 0:03:08 638500 -- (-2840.007) [-2827.407] (-2834.588) (-2824.763) * (-2844.334) [-2834.344] (-2842.128) (-2835.403) -- 0:03:08 639000 -- (-2838.485) (-2838.075) (-2836.689) [-2835.765] * [-2838.337] (-2834.772) (-2837.649) (-2842.192) -- 0:03:08 639500 -- (-2828.814) [-2834.128] (-2832.914) (-2834.523) * [-2833.855] (-2833.769) (-2831.935) (-2829.901) -- 0:03:08 640000 -- (-2826.581) (-2842.231) [-2832.486] (-2839.494) * [-2829.248] (-2825.525) (-2841.164) (-2828.728) -- 0:03:07 Average standard deviation of split frequencies: 0.008567 640500 -- (-2834.471) [-2837.539] (-2845.987) (-2842.085) * [-2833.542] (-2831.740) (-2841.043) (-2829.698) -- 0:03:08 641000 -- (-2837.316) [-2839.364] (-2836.576) (-2839.407) * [-2835.950] (-2837.101) (-2837.641) (-2839.167) -- 0:03:07 641500 -- (-2841.189) (-2834.088) [-2833.493] (-2841.796) * (-2836.369) (-2835.332) [-2829.664] (-2839.587) -- 0:03:07 642000 -- (-2838.283) (-2833.945) [-2841.964] (-2838.382) * (-2832.089) (-2834.236) [-2830.123] (-2832.818) -- 0:03:06 642500 -- (-2827.294) [-2832.993] (-2837.982) (-2837.287) * (-2834.704) [-2833.094] (-2837.036) (-2828.275) -- 0:03:06 643000 -- (-2833.043) [-2834.128] (-2840.157) (-2834.052) * (-2838.095) (-2839.407) [-2828.646] (-2832.521) -- 0:03:06 643500 -- (-2834.801) [-2836.831] (-2835.316) (-2831.726) * [-2832.467] (-2844.180) (-2840.224) (-2829.858) -- 0:03:06 644000 -- [-2830.335] (-2849.612) (-2833.109) (-2829.022) * (-2844.350) (-2839.595) (-2829.487) [-2831.617] -- 0:03:06 644500 -- [-2832.191] (-2838.556) (-2838.259) (-2838.826) * (-2830.549) (-2834.423) [-2826.654] (-2849.599) -- 0:03:05 645000 -- (-2839.201) (-2835.212) [-2830.572] (-2843.450) * (-2833.765) (-2838.397) [-2832.277] (-2838.508) -- 0:03:05 Average standard deviation of split frequencies: 0.008236 645500 -- (-2843.052) (-2828.699) (-2838.595) [-2835.597] * [-2830.786] (-2830.857) (-2829.366) (-2838.338) -- 0:03:05 646000 -- (-2838.974) [-2827.837] (-2839.640) (-2832.082) * (-2832.498) (-2835.255) [-2828.473] (-2839.013) -- 0:03:05 646500 -- (-2834.943) (-2837.757) (-2833.798) [-2831.174] * [-2832.512] (-2836.481) (-2849.864) (-2848.117) -- 0:03:04 647000 -- (-2836.336) (-2835.073) [-2825.940] (-2841.343) * (-2844.594) (-2831.879) [-2836.093] (-2838.405) -- 0:03:04 647500 -- (-2840.897) [-2838.221] (-2839.714) (-2837.433) * (-2833.389) (-2826.100) (-2841.078) [-2826.791] -- 0:03:04 648000 -- (-2840.917) (-2834.158) [-2833.096] (-2833.040) * [-2832.318] (-2832.351) (-2833.162) (-2836.272) -- 0:03:04 648500 -- [-2832.864] (-2832.858) (-2829.518) (-2839.253) * (-2824.833) (-2841.098) [-2828.386] (-2833.086) -- 0:03:03 649000 -- (-2843.372) [-2832.723] (-2839.054) (-2843.878) * (-2832.072) (-2832.553) [-2835.960] (-2834.526) -- 0:03:03 649500 -- (-2840.579) (-2828.657) [-2831.657] (-2843.855) * (-2834.078) (-2833.476) (-2828.237) [-2838.065] -- 0:03:02 650000 -- (-2833.528) (-2845.332) (-2836.437) [-2832.795] * (-2838.061) (-2843.197) (-2832.622) [-2825.421] -- 0:03:03 Average standard deviation of split frequencies: 0.008176 650500 -- (-2844.608) [-2830.063] (-2828.620) (-2836.355) * [-2835.860] (-2829.682) (-2828.585) (-2829.987) -- 0:03:02 651000 -- (-2832.859) (-2830.500) [-2827.864] (-2827.573) * [-2831.077] (-2838.824) (-2834.547) (-2834.301) -- 0:03:02 651500 -- (-2831.885) (-2836.140) (-2829.380) [-2828.330] * [-2836.432] (-2845.879) (-2828.824) (-2838.220) -- 0:03:01 652000 -- (-2838.710) [-2833.457] (-2834.183) (-2846.601) * [-2838.697] (-2833.618) (-2830.632) (-2847.951) -- 0:03:02 652500 -- [-2835.545] (-2833.463) (-2829.552) (-2835.876) * (-2834.685) [-2828.872] (-2833.265) (-2843.953) -- 0:03:01 653000 -- (-2833.426) (-2833.149) (-2839.197) [-2839.711] * (-2833.591) (-2831.766) (-2831.872) [-2828.235] -- 0:03:01 653500 -- [-2834.268] (-2839.508) (-2830.581) (-2842.425) * [-2826.690] (-2837.060) (-2833.806) (-2838.295) -- 0:03:01 654000 -- [-2825.561] (-2833.242) (-2836.357) (-2838.087) * [-2825.860] (-2833.139) (-2843.009) (-2837.445) -- 0:03:00 654500 -- (-2833.492) (-2859.930) [-2833.771] (-2828.116) * [-2837.256] (-2838.815) (-2838.434) (-2843.577) -- 0:03:00 655000 -- (-2837.230) (-2838.718) (-2838.594) [-2838.731] * (-2841.373) (-2830.858) (-2840.714) [-2829.886] -- 0:03:00 Average standard deviation of split frequencies: 0.008213 655500 -- (-2836.289) (-2833.905) [-2834.779] (-2847.124) * (-2842.916) [-2827.547] (-2839.246) (-2833.168) -- 0:03:00 656000 -- (-2849.474) (-2832.238) [-2833.400] (-2844.421) * (-2845.149) (-2836.701) (-2847.627) [-2830.651] -- 0:02:59 656500 -- (-2843.591) [-2829.281] (-2839.521) (-2839.692) * (-2844.067) (-2833.703) [-2841.493] (-2837.585) -- 0:02:59 657000 -- [-2830.325] (-2825.792) (-2835.920) (-2837.086) * [-2827.550] (-2832.961) (-2843.670) (-2832.526) -- 0:02:59 657500 -- (-2849.246) (-2830.556) (-2834.231) [-2834.605] * (-2833.007) (-2842.843) (-2840.890) [-2833.692] -- 0:02:59 658000 -- [-2825.296] (-2834.276) (-2827.310) (-2842.919) * [-2833.279] (-2834.650) (-2824.785) (-2847.049) -- 0:02:58 658500 -- (-2831.528) (-2844.473) [-2824.995] (-2835.430) * (-2833.054) [-2834.858] (-2832.195) (-2837.253) -- 0:02:58 659000 -- [-2832.945] (-2841.228) (-2837.536) (-2840.443) * [-2830.397] (-2843.547) (-2834.744) (-2834.171) -- 0:02:58 659500 -- (-2837.299) [-2830.079] (-2835.543) (-2830.870) * (-2841.783) [-2830.284] (-2842.168) (-2835.115) -- 0:02:58 660000 -- [-2829.510] (-2833.766) (-2839.087) (-2826.358) * [-2835.735] (-2836.963) (-2841.774) (-2843.158) -- 0:02:57 Average standard deviation of split frequencies: 0.008308 660500 -- (-2841.565) [-2828.258] (-2829.800) (-2828.666) * (-2837.407) [-2837.653] (-2840.162) (-2836.915) -- 0:02:57 661000 -- (-2830.647) (-2836.388) [-2844.867] (-2838.946) * (-2840.768) (-2836.413) [-2840.310] (-2843.720) -- 0:02:57 661500 -- (-2836.689) (-2841.301) [-2828.409] (-2842.976) * [-2829.018] (-2827.932) (-2840.680) (-2845.078) -- 0:02:57 662000 -- (-2830.798) (-2831.213) (-2838.030) [-2834.924] * [-2832.428] (-2833.316) (-2842.143) (-2837.765) -- 0:02:56 662500 -- (-2825.519) [-2835.632] (-2838.451) (-2825.377) * (-2842.060) (-2841.259) (-2840.030) [-2835.963] -- 0:02:56 663000 -- [-2840.906] (-2850.290) (-2833.893) (-2844.581) * [-2830.165] (-2846.630) (-2837.288) (-2839.906) -- 0:02:56 663500 -- (-2838.409) (-2842.688) [-2834.491] (-2835.928) * (-2838.935) [-2838.629] (-2844.674) (-2834.845) -- 0:02:55 664000 -- [-2834.816] (-2834.563) (-2841.444) (-2831.780) * (-2830.373) (-2836.692) [-2825.276] (-2832.711) -- 0:02:55 664500 -- (-2843.389) (-2840.907) [-2834.019] (-2846.642) * (-2839.002) (-2840.295) [-2822.740] (-2831.090) -- 0:02:55 665000 -- (-2834.468) [-2835.387] (-2836.789) (-2844.646) * [-2830.341] (-2829.670) (-2831.535) (-2833.403) -- 0:02:55 Average standard deviation of split frequencies: 0.008140 665500 -- (-2834.508) (-2831.652) [-2827.317] (-2840.679) * [-2828.156] (-2844.757) (-2834.816) (-2835.957) -- 0:02:54 666000 -- (-2842.571) (-2842.881) [-2836.197] (-2829.611) * (-2833.931) (-2838.008) [-2835.340] (-2834.783) -- 0:02:54 666500 -- (-2857.378) (-2833.391) [-2840.606] (-2828.712) * (-2833.890) (-2834.907) [-2839.287] (-2843.550) -- 0:02:54 667000 -- (-2845.028) (-2832.287) [-2827.632] (-2825.829) * (-2831.842) (-2835.506) [-2832.055] (-2836.300) -- 0:02:54 667500 -- (-2840.921) [-2832.669] (-2844.510) (-2840.213) * (-2846.714) (-2841.140) [-2832.992] (-2833.246) -- 0:02:53 668000 -- (-2841.510) (-2833.658) [-2833.489] (-2857.241) * (-2832.543) (-2838.811) [-2835.008] (-2833.780) -- 0:02:53 668500 -- (-2838.466) (-2830.370) (-2838.346) [-2835.616] * [-2827.930] (-2841.687) (-2829.228) (-2836.383) -- 0:02:53 669000 -- (-2843.386) (-2829.983) [-2833.507] (-2834.166) * [-2830.059] (-2833.879) (-2852.674) (-2838.007) -- 0:02:53 669500 -- (-2833.753) (-2840.907) [-2823.152] (-2838.206) * [-2833.851] (-2843.871) (-2848.700) (-2829.510) -- 0:02:52 670000 -- (-2831.838) (-2833.950) [-2835.310] (-2841.756) * (-2834.627) (-2839.605) (-2837.584) [-2827.844] -- 0:02:52 Average standard deviation of split frequencies: 0.007129 670500 -- (-2845.050) (-2832.187) [-2831.781] (-2837.760) * [-2840.968] (-2828.320) (-2839.930) (-2830.613) -- 0:02:52 671000 -- [-2834.902] (-2828.353) (-2831.954) (-2840.841) * (-2846.372) [-2826.781] (-2837.811) (-2833.738) -- 0:02:52 671500 -- (-2848.207) (-2834.803) (-2833.435) [-2832.676] * [-2827.798] (-2834.481) (-2830.820) (-2831.318) -- 0:02:51 672000 -- (-2844.582) (-2832.218) (-2849.874) [-2836.488] * [-2827.791] (-2835.329) (-2829.666) (-2843.161) -- 0:02:51 672500 -- (-2843.614) (-2840.294) [-2832.218] (-2835.127) * (-2829.504) [-2835.711] (-2839.795) (-2831.518) -- 0:02:51 673000 -- (-2844.943) [-2831.937] (-2832.701) (-2827.155) * (-2834.256) (-2831.436) [-2837.971] (-2834.705) -- 0:02:51 673500 -- (-2848.645) (-2835.733) (-2838.470) [-2838.776] * [-2829.276] (-2825.269) (-2841.655) (-2836.366) -- 0:02:50 674000 -- (-2833.350) [-2832.317] (-2845.759) (-2839.342) * (-2840.615) [-2829.759] (-2838.922) (-2828.068) -- 0:02:50 674500 -- (-2827.572) [-2825.826] (-2832.470) (-2839.029) * (-2835.128) [-2833.091] (-2830.034) (-2833.956) -- 0:02:50 675000 -- (-2845.220) (-2834.169) (-2839.033) [-2836.119] * (-2834.547) (-2832.290) (-2843.457) [-2833.954] -- 0:02:49 Average standard deviation of split frequencies: 0.006924 675500 -- (-2829.302) (-2835.456) [-2834.935] (-2840.477) * [-2831.641] (-2834.057) (-2839.950) (-2835.711) -- 0:02:49 676000 -- (-2838.068) [-2832.950] (-2836.830) (-2838.699) * (-2840.367) [-2833.721] (-2845.275) (-2834.415) -- 0:02:49 676500 -- (-2845.824) [-2836.988] (-2832.377) (-2836.365) * (-2849.727) [-2835.830] (-2833.583) (-2833.942) -- 0:02:49 677000 -- (-2832.701) (-2834.269) [-2829.815] (-2839.029) * (-2840.496) [-2833.478] (-2843.925) (-2843.358) -- 0:02:48 677500 -- (-2837.084) (-2835.151) [-2832.896] (-2842.212) * (-2831.096) [-2831.185] (-2841.200) (-2842.283) -- 0:02:48 678000 -- (-2837.558) [-2830.156] (-2826.519) (-2835.244) * (-2845.533) (-2834.510) [-2830.458] (-2841.031) -- 0:02:48 678500 -- (-2836.379) (-2844.922) (-2833.020) [-2835.210] * (-2844.330) (-2837.501) [-2837.552] (-2836.335) -- 0:02:48 679000 -- (-2834.257) [-2833.009] (-2834.411) (-2843.822) * [-2829.980] (-2833.035) (-2835.979) (-2839.594) -- 0:02:47 679500 -- (-2832.725) [-2829.125] (-2837.770) (-2831.393) * [-2837.503] (-2830.289) (-2838.000) (-2836.960) -- 0:02:47 680000 -- [-2836.199] (-2839.275) (-2829.650) (-2831.974) * (-2833.950) (-2853.283) [-2826.654] (-2829.935) -- 0:02:47 Average standard deviation of split frequencies: 0.006678 680500 -- (-2836.732) (-2838.157) [-2833.008] (-2830.701) * [-2830.267] (-2841.225) (-2839.117) (-2846.278) -- 0:02:47 681000 -- (-2842.187) [-2831.723] (-2830.824) (-2831.166) * (-2841.086) (-2828.300) (-2836.866) [-2833.226] -- 0:02:46 681500 -- (-2833.175) [-2834.051] (-2831.444) (-2843.686) * (-2830.588) (-2837.791) (-2834.617) [-2830.337] -- 0:02:46 682000 -- (-2834.920) (-2835.401) [-2826.641] (-2835.871) * [-2836.572] (-2834.213) (-2843.338) (-2841.893) -- 0:02:46 682500 -- (-2835.043) (-2857.956) [-2835.935] (-2835.069) * [-2828.366] (-2832.621) (-2835.289) (-2843.767) -- 0:02:46 683000 -- (-2839.976) (-2833.978) [-2845.918] (-2841.077) * (-2838.511) [-2833.988] (-2834.612) (-2833.236) -- 0:02:45 683500 -- (-2834.123) (-2837.484) (-2832.199) [-2836.411] * [-2824.883] (-2851.358) (-2843.488) (-2845.878) -- 0:02:45 684000 -- (-2834.028) (-2839.067) (-2836.516) [-2831.981] * (-2834.927) (-2829.644) [-2830.277] (-2836.751) -- 0:02:45 684500 -- (-2841.400) (-2844.008) [-2832.413] (-2835.450) * (-2829.812) [-2831.188] (-2840.606) (-2835.072) -- 0:02:45 685000 -- (-2833.637) (-2837.254) [-2830.067] (-2843.496) * [-2834.616] (-2833.219) (-2842.850) (-2837.451) -- 0:02:44 Average standard deviation of split frequencies: 0.007696 685500 -- (-2842.918) [-2840.251] (-2824.872) (-2830.834) * (-2841.979) (-2833.630) (-2840.354) [-2832.458] -- 0:02:44 686000 -- [-2831.529] (-2834.779) (-2834.239) (-2842.525) * (-2834.026) (-2846.136) (-2839.223) [-2838.115] -- 0:02:44 686500 -- (-2841.089) [-2832.249] (-2837.163) (-2835.124) * (-2844.751) (-2841.688) [-2831.468] (-2837.439) -- 0:02:43 687000 -- (-2833.037) (-2840.371) (-2843.641) [-2828.769] * [-2836.252] (-2838.887) (-2835.794) (-2842.016) -- 0:02:43 687500 -- [-2852.199] (-2844.435) (-2844.930) (-2838.499) * (-2830.470) (-2832.834) [-2834.675] (-2846.307) -- 0:02:43 688000 -- (-2840.717) (-2841.318) (-2830.513) [-2827.702] * [-2838.601] (-2839.739) (-2832.608) (-2843.191) -- 0:02:43 688500 -- (-2839.245) [-2831.025] (-2833.952) (-2834.598) * (-2833.538) (-2840.229) [-2829.019] (-2841.725) -- 0:02:42 689000 -- (-2838.046) (-2834.920) [-2832.508] (-2847.849) * (-2831.732) (-2832.173) [-2836.199] (-2834.732) -- 0:02:42 689500 -- [-2842.401] (-2829.288) (-2834.777) (-2846.499) * (-2836.901) (-2839.850) [-2835.936] (-2832.720) -- 0:02:42 690000 -- (-2834.558) [-2832.743] (-2836.085) (-2848.638) * (-2834.498) [-2832.157] (-2843.265) (-2837.727) -- 0:02:42 Average standard deviation of split frequencies: 0.007644 690500 -- (-2840.179) (-2846.059) (-2834.848) [-2837.517] * (-2842.086) [-2831.064] (-2855.527) (-2838.971) -- 0:02:41 691000 -- (-2848.215) (-2831.593) [-2825.846] (-2833.457) * (-2839.901) (-2832.262) [-2827.999] (-2828.174) -- 0:02:41 691500 -- (-2832.448) [-2838.048] (-2827.593) (-2828.000) * [-2830.703] (-2833.262) (-2827.832) (-2830.052) -- 0:02:41 692000 -- (-2841.242) (-2833.315) (-2843.779) [-2831.826] * (-2831.366) (-2842.706) (-2837.152) [-2838.045] -- 0:02:41 692500 -- (-2837.901) (-2837.105) [-2828.953] (-2833.122) * (-2838.012) [-2833.843] (-2833.887) (-2835.464) -- 0:02:40 693000 -- (-2848.269) (-2844.498) (-2835.215) [-2826.658] * (-2830.064) (-2833.193) [-2839.642] (-2835.995) -- 0:02:40 693500 -- [-2835.617] (-2827.393) (-2835.815) (-2836.795) * (-2841.738) (-2836.511) (-2842.402) [-2840.092] -- 0:02:40 694000 -- (-2836.359) (-2838.994) (-2836.258) [-2831.960] * (-2834.483) (-2830.299) (-2841.918) [-2834.495] -- 0:02:40 694500 -- [-2838.207] (-2830.198) (-2826.772) (-2840.911) * (-2834.779) [-2832.782] (-2837.192) (-2829.239) -- 0:02:39 695000 -- (-2828.715) (-2840.475) (-2833.446) [-2837.482] * (-2835.930) (-2839.772) [-2832.429] (-2832.479) -- 0:02:39 Average standard deviation of split frequencies: 0.007586 695500 -- (-2836.224) (-2833.600) [-2833.534] (-2825.805) * [-2833.285] (-2840.595) (-2846.937) (-2831.906) -- 0:02:39 696000 -- [-2833.559] (-2841.853) (-2830.598) (-2845.037) * (-2835.956) [-2833.606] (-2845.171) (-2833.794) -- 0:02:38 696500 -- (-2836.167) (-2836.509) (-2839.722) [-2840.471] * (-2835.796) [-2841.447] (-2843.642) (-2834.034) -- 0:02:38 697000 -- [-2843.235] (-2828.223) (-2830.564) (-2827.051) * (-2830.967) (-2832.628) (-2835.893) [-2839.110] -- 0:02:38 697500 -- [-2829.363] (-2833.725) (-2831.943) (-2831.577) * (-2834.785) (-2837.443) (-2838.289) [-2840.710] -- 0:02:38 698000 -- [-2834.066] (-2859.621) (-2835.005) (-2837.987) * (-2837.599) (-2826.349) [-2837.803] (-2842.404) -- 0:02:37 698500 -- [-2833.585] (-2835.064) (-2828.633) (-2829.668) * [-2839.794] (-2833.618) (-2834.374) (-2832.643) -- 0:02:37 699000 -- (-2840.624) (-2835.488) [-2832.588] (-2839.868) * (-2832.609) [-2832.048] (-2830.741) (-2832.797) -- 0:02:37 699500 -- [-2834.992] (-2837.786) (-2841.295) (-2835.277) * (-2831.209) [-2822.346] (-2841.107) (-2837.903) -- 0:02:37 700000 -- [-2832.219] (-2834.377) (-2840.022) (-2843.807) * [-2828.093] (-2848.424) (-2844.632) (-2831.882) -- 0:02:36 Average standard deviation of split frequencies: 0.007580 700500 -- [-2831.119] (-2831.461) (-2834.129) (-2842.019) * [-2829.430] (-2840.112) (-2832.358) (-2829.488) -- 0:02:36 701000 -- [-2838.495] (-2845.882) (-2838.619) (-2838.262) * (-2831.357) (-2839.725) (-2837.688) [-2837.544] -- 0:02:36 701500 -- (-2836.063) (-2837.370) [-2833.908] (-2838.606) * [-2836.891] (-2830.029) (-2833.084) (-2848.200) -- 0:02:36 702000 -- (-2834.952) (-2827.725) [-2827.321] (-2838.743) * (-2835.579) (-2840.333) (-2835.036) [-2833.311] -- 0:02:35 702500 -- (-2828.929) (-2839.110) [-2824.651] (-2829.050) * (-2845.902) (-2834.948) (-2834.870) [-2837.700] -- 0:02:35 703000 -- [-2840.640] (-2842.408) (-2837.377) (-2841.952) * (-2841.425) [-2824.707] (-2839.165) (-2834.989) -- 0:02:35 703500 -- (-2837.194) (-2832.208) [-2838.139] (-2837.008) * (-2837.370) [-2831.043] (-2845.041) (-2842.968) -- 0:02:35 704000 -- (-2830.157) (-2840.179) [-2831.296] (-2838.320) * (-2834.028) (-2841.091) (-2842.487) [-2834.594] -- 0:02:34 704500 -- (-2839.679) (-2838.035) [-2829.309] (-2835.003) * (-2829.943) (-2838.217) [-2836.247] (-2840.002) -- 0:02:34 705000 -- (-2829.500) [-2835.316] (-2830.328) (-2830.307) * (-2830.281) [-2825.778] (-2830.285) (-2842.214) -- 0:02:34 Average standard deviation of split frequencies: 0.007078 705500 -- (-2835.348) (-2836.396) (-2839.085) [-2838.384] * [-2834.039] (-2841.405) (-2833.414) (-2834.973) -- 0:02:34 706000 -- [-2827.990] (-2840.743) (-2836.093) (-2837.167) * (-2836.349) (-2835.564) [-2828.204] (-2828.656) -- 0:02:33 706500 -- (-2835.816) (-2835.990) [-2830.337] (-2831.620) * (-2825.611) [-2837.150] (-2839.054) (-2833.933) -- 0:02:33 707000 -- (-2837.481) (-2836.927) [-2832.847] (-2832.864) * [-2829.944] (-2832.096) (-2836.262) (-2835.985) -- 0:02:33 707500 -- [-2835.874] (-2840.607) (-2839.618) (-2832.236) * (-2844.099) [-2832.888] (-2845.835) (-2832.494) -- 0:02:32 708000 -- (-2837.057) (-2836.443) (-2832.684) [-2827.253] * (-2835.152) (-2836.864) (-2833.286) [-2830.263] -- 0:02:32 708500 -- (-2835.007) (-2842.750) (-2841.394) [-2833.261] * (-2833.825) (-2839.078) [-2830.114] (-2835.494) -- 0:02:32 709000 -- (-2840.128) (-2835.113) (-2845.188) [-2834.333] * (-2830.793) (-2837.721) [-2836.555] (-2840.296) -- 0:02:32 709500 -- [-2833.996] (-2842.249) (-2838.251) (-2839.684) * (-2835.585) [-2843.182] (-2834.951) (-2845.288) -- 0:02:31 710000 -- (-2845.359) (-2830.477) [-2832.760] (-2828.941) * (-2839.438) (-2837.123) (-2834.716) [-2839.069] -- 0:02:31 Average standard deviation of split frequencies: 0.006501 710500 -- (-2832.744) [-2827.121] (-2839.010) (-2835.901) * [-2836.286] (-2835.635) (-2847.305) (-2845.527) -- 0:02:31 711000 -- (-2836.033) (-2844.961) [-2830.931] (-2837.670) * (-2838.602) [-2831.113] (-2837.545) (-2841.360) -- 0:02:31 711500 -- (-2831.351) (-2834.936) (-2838.963) [-2828.801] * [-2836.009] (-2834.991) (-2834.396) (-2834.806) -- 0:02:30 712000 -- (-2831.652) (-2835.463) (-2840.117) [-2833.060] * (-2847.719) [-2830.339] (-2832.064) (-2834.174) -- 0:02:30 712500 -- (-2830.718) (-2843.350) (-2825.231) [-2829.931] * [-2832.377] (-2839.757) (-2836.078) (-2834.205) -- 0:02:30 713000 -- (-2834.138) (-2833.002) [-2830.561] (-2842.764) * (-2833.389) (-2836.807) [-2832.628] (-2836.186) -- 0:02:30 713500 -- (-2834.181) (-2829.304) (-2846.513) [-2838.154] * (-2837.327) (-2845.758) [-2834.899] (-2843.421) -- 0:02:29 714000 -- (-2837.813) (-2830.469) (-2839.560) [-2835.017] * (-2834.326) (-2829.398) [-2833.511] (-2837.344) -- 0:02:29 714500 -- (-2834.410) [-2833.449] (-2837.274) (-2833.221) * [-2833.463] (-2831.345) (-2836.423) (-2839.867) -- 0:02:29 715000 -- (-2843.096) (-2834.987) (-2845.252) [-2830.867] * [-2826.378] (-2841.512) (-2838.104) (-2834.953) -- 0:02:29 Average standard deviation of split frequencies: 0.006803 715500 -- [-2830.817] (-2832.194) (-2841.040) (-2831.641) * [-2832.638] (-2836.652) (-2842.171) (-2833.768) -- 0:02:28 716000 -- (-2833.702) (-2830.876) (-2836.520) [-2831.790] * (-2834.240) (-2835.262) (-2830.387) [-2839.919] -- 0:02:28 716500 -- (-2828.050) (-2851.636) [-2834.717] (-2842.727) * (-2830.583) (-2844.194) [-2826.512] (-2841.166) -- 0:02:28 717000 -- (-2825.497) (-2831.959) [-2831.660] (-2834.257) * (-2836.968) [-2833.863] (-2834.782) (-2832.247) -- 0:02:28 717500 -- [-2835.016] (-2832.485) (-2835.587) (-2835.903) * (-2845.190) (-2833.582) [-2840.860] (-2825.507) -- 0:02:28 718000 -- [-2841.302] (-2832.477) (-2842.335) (-2844.764) * [-2824.946] (-2829.202) (-2849.796) (-2835.495) -- 0:02:27 718500 -- (-2840.000) (-2837.086) [-2840.804] (-2845.259) * (-2824.820) [-2832.294] (-2831.923) (-2838.392) -- 0:02:27 719000 -- (-2831.913) (-2844.120) [-2828.444] (-2835.727) * (-2844.966) [-2837.409] (-2843.976) (-2842.310) -- 0:02:26 719500 -- [-2832.665] (-2832.654) (-2834.473) (-2844.000) * (-2840.416) [-2827.223] (-2845.937) (-2836.598) -- 0:02:26 720000 -- (-2842.653) (-2830.731) (-2829.794) [-2834.546] * (-2839.637) [-2835.810] (-2842.130) (-2832.474) -- 0:02:26 Average standard deviation of split frequencies: 0.006498 720500 -- (-2837.854) (-2831.079) (-2836.166) [-2828.862] * (-2835.902) (-2835.092) [-2836.125] (-2833.706) -- 0:02:26 721000 -- (-2856.018) (-2839.569) (-2824.535) [-2823.464] * [-2835.520] (-2834.974) (-2833.801) (-2829.050) -- 0:02:25 721500 -- (-2845.832) (-2842.477) [-2832.221] (-2834.651) * (-2834.428) (-2840.340) (-2852.921) [-2828.865] -- 0:02:25 722000 -- (-2843.633) (-2836.954) [-2831.918] (-2843.351) * (-2831.642) [-2827.261] (-2837.925) (-2829.620) -- 0:02:25 722500 -- (-2830.985) (-2838.152) (-2827.608) [-2829.470] * (-2832.779) (-2835.183) [-2836.955] (-2839.368) -- 0:02:25 723000 -- (-2835.558) [-2826.626] (-2841.333) (-2831.059) * (-2845.250) (-2826.676) (-2846.197) [-2833.028] -- 0:02:24 723500 -- (-2833.401) (-2847.909) (-2836.081) [-2833.729] * (-2839.318) [-2826.673] (-2832.824) (-2831.053) -- 0:02:24 724000 -- (-2829.292) (-2834.223) (-2833.521) [-2827.944] * (-2835.775) (-2835.504) [-2834.986] (-2833.392) -- 0:02:24 724500 -- (-2842.137) (-2835.810) (-2834.080) [-2839.816] * [-2826.711] (-2850.666) (-2834.371) (-2837.231) -- 0:02:24 725000 -- (-2833.373) [-2835.464] (-2836.756) (-2843.151) * (-2831.807) (-2830.690) (-2838.772) [-2830.895] -- 0:02:23 Average standard deviation of split frequencies: 0.006666 725500 -- (-2837.925) [-2835.115] (-2836.105) (-2832.418) * (-2837.894) (-2836.675) (-2846.532) [-2839.008] -- 0:02:23 726000 -- (-2841.169) (-2832.581) [-2828.006] (-2838.577) * (-2836.502) (-2829.461) [-2833.375] (-2833.326) -- 0:02:23 726500 -- (-2838.358) [-2834.198] (-2833.231) (-2841.838) * (-2845.406) (-2836.220) [-2833.151] (-2832.508) -- 0:02:23 727000 -- (-2841.749) [-2830.767] (-2841.497) (-2840.616) * (-2834.250) (-2840.946) [-2837.747] (-2843.046) -- 0:02:22 727500 -- (-2835.565) (-2831.334) (-2844.186) [-2833.765] * (-2847.176) (-2835.527) (-2842.091) [-2832.284] -- 0:02:22 728000 -- [-2839.906] (-2837.081) (-2847.093) (-2841.448) * (-2833.854) (-2827.944) (-2843.851) [-2829.465] -- 0:02:22 728500 -- [-2836.630] (-2849.309) (-2839.408) (-2845.794) * (-2831.499) (-2838.566) [-2830.931] (-2840.270) -- 0:02:21 729000 -- (-2835.662) (-2835.133) [-2831.208] (-2836.349) * (-2841.508) (-2844.175) [-2831.478] (-2831.864) -- 0:02:22 729500 -- (-2839.628) (-2836.676) [-2829.149] (-2839.461) * (-2835.002) (-2841.243) [-2827.277] (-2838.931) -- 0:02:21 730000 -- (-2835.295) (-2826.262) (-2831.636) [-2832.351] * [-2835.483] (-2829.519) (-2835.555) (-2849.540) -- 0:02:21 Average standard deviation of split frequencies: 0.006323 730500 -- [-2829.172] (-2828.532) (-2845.633) (-2830.765) * (-2847.449) (-2833.653) [-2837.913] (-2836.905) -- 0:02:20 731000 -- [-2830.150] (-2845.900) (-2836.901) (-2830.705) * (-2839.624) (-2834.437) [-2835.282] (-2838.435) -- 0:02:20 731500 -- (-2834.301) [-2834.756] (-2831.374) (-2849.178) * [-2833.155] (-2838.702) (-2837.866) (-2851.044) -- 0:02:20 732000 -- (-2837.290) [-2831.893] (-2827.167) (-2838.660) * (-2839.501) [-2833.162] (-2827.168) (-2847.033) -- 0:02:20 732500 -- (-2833.947) (-2842.879) (-2839.300) [-2843.507] * (-2830.395) (-2847.268) (-2829.287) [-2837.459] -- 0:02:20 733000 -- (-2838.297) (-2831.828) (-2830.553) [-2840.918] * (-2841.002) (-2835.921) (-2834.096) [-2830.543] -- 0:02:19 733500 -- (-2832.579) (-2834.389) [-2838.136] (-2838.533) * (-2835.071) (-2833.251) (-2838.135) [-2837.648] -- 0:02:19 734000 -- (-2840.745) [-2829.366] (-2834.608) (-2833.249) * (-2835.112) [-2824.758] (-2839.754) (-2845.608) -- 0:02:19 734500 -- (-2839.710) (-2837.650) (-2834.035) [-2834.926] * (-2826.966) [-2829.660] (-2828.809) (-2844.067) -- 0:02:19 735000 -- (-2839.685) [-2829.738] (-2828.127) (-2831.277) * [-2827.143] (-2833.336) (-2835.065) (-2841.930) -- 0:02:18 Average standard deviation of split frequencies: 0.005850 735500 -- (-2831.602) [-2833.083] (-2844.186) (-2827.744) * (-2833.695) (-2839.606) [-2832.434] (-2842.901) -- 0:02:18 736000 -- (-2835.663) (-2835.949) (-2832.802) [-2837.944] * (-2845.085) (-2852.507) (-2846.265) [-2834.660] -- 0:02:18 736500 -- (-2830.774) (-2838.326) (-2832.804) [-2829.527] * [-2836.587] (-2831.793) (-2837.611) (-2841.135) -- 0:02:18 737000 -- (-2835.758) (-2830.999) [-2835.433] (-2837.237) * (-2832.943) (-2838.299) [-2831.635] (-2841.350) -- 0:02:17 737500 -- (-2840.926) [-2827.802] (-2829.461) (-2830.866) * [-2829.051] (-2839.102) (-2836.783) (-2841.474) -- 0:02:17 738000 -- (-2843.147) (-2833.854) (-2832.566) [-2835.645] * (-2837.617) [-2831.762] (-2846.764) (-2835.675) -- 0:02:17 738500 -- [-2828.916] (-2842.144) (-2829.853) (-2837.001) * [-2832.681] (-2836.425) (-2842.152) (-2835.645) -- 0:02:17 739000 -- (-2840.291) (-2840.862) (-2836.757) [-2821.847] * (-2828.460) (-2839.451) (-2837.980) [-2832.677] -- 0:02:16 739500 -- (-2831.356) (-2841.906) [-2824.623] (-2829.288) * (-2828.586) (-2830.803) (-2831.932) [-2830.432] -- 0:02:16 740000 -- (-2837.214) (-2837.554) (-2830.172) [-2835.114] * [-2823.953] (-2839.182) (-2842.156) (-2831.440) -- 0:02:15 Average standard deviation of split frequencies: 0.005431 740500 -- [-2843.510] (-2829.492) (-2827.163) (-2835.868) * (-2832.820) [-2830.153] (-2826.650) (-2830.219) -- 0:02:15 741000 -- (-2834.906) (-2839.632) [-2841.379] (-2839.666) * (-2834.201) (-2836.362) [-2825.262] (-2832.385) -- 0:02:15 741500 -- (-2829.173) (-2847.021) [-2837.428] (-2836.457) * (-2839.495) (-2839.840) [-2830.406] (-2845.113) -- 0:02:15 742000 -- [-2848.559] (-2842.961) (-2835.353) (-2836.086) * (-2847.035) (-2837.523) (-2842.916) [-2833.073] -- 0:02:15 742500 -- (-2832.070) (-2838.180) [-2835.051] (-2836.740) * (-2833.604) (-2844.957) [-2835.581] (-2828.447) -- 0:02:14 743000 -- (-2835.183) (-2847.652) (-2831.943) [-2833.030] * (-2838.053) (-2831.033) (-2828.134) [-2827.558] -- 0:02:14 743500 -- (-2831.889) (-2844.001) [-2834.276] (-2835.832) * (-2828.910) [-2829.764] (-2835.729) (-2836.289) -- 0:02:14 744000 -- (-2833.353) (-2850.282) (-2843.007) [-2837.536] * [-2831.187] (-2846.981) (-2837.622) (-2835.751) -- 0:02:14 744500 -- (-2833.443) (-2834.952) [-2831.541] (-2835.044) * (-2834.313) (-2851.018) (-2833.615) [-2830.634] -- 0:02:13 745000 -- (-2829.251) (-2838.564) [-2829.417] (-2838.650) * (-2829.762) (-2838.091) [-2843.449] (-2840.895) -- 0:02:13 Average standard deviation of split frequencies: 0.005140 745500 -- (-2833.305) (-2831.135) [-2830.175] (-2826.232) * [-2836.306] (-2840.058) (-2856.493) (-2828.040) -- 0:02:13 746000 -- (-2836.832) (-2829.507) (-2841.183) [-2826.710] * (-2845.560) (-2829.205) (-2832.262) [-2830.462] -- 0:02:13 746500 -- (-2829.701) [-2825.581] (-2844.072) (-2830.395) * (-2841.933) (-2841.713) [-2833.720] (-2829.496) -- 0:02:12 747000 -- [-2829.110] (-2831.101) (-2836.491) (-2834.970) * (-2850.074) (-2839.063) [-2835.399] (-2837.416) -- 0:02:12 747500 -- (-2832.855) (-2832.930) [-2830.808] (-2835.311) * (-2835.670) (-2838.404) (-2841.538) [-2831.531] -- 0:02:12 748000 -- (-2834.217) [-2833.718] (-2844.059) (-2844.049) * [-2835.648] (-2843.346) (-2835.248) (-2844.043) -- 0:02:12 748500 -- (-2830.744) (-2826.471) [-2843.276] (-2836.239) * (-2832.642) [-2836.481] (-2832.933) (-2834.256) -- 0:02:11 749000 -- (-2830.079) [-2834.477] (-2838.047) (-2837.186) * [-2835.414] (-2834.853) (-2829.858) (-2840.021) -- 0:02:11 749500 -- [-2839.768] (-2843.306) (-2839.771) (-2833.963) * (-2839.913) (-2837.230) [-2833.106] (-2835.100) -- 0:02:11 750000 -- (-2836.983) [-2834.659] (-2832.269) (-2830.321) * (-2838.000) [-2842.065] (-2833.548) (-2837.761) -- 0:02:11 Average standard deviation of split frequencies: 0.005694 750500 -- (-2839.185) [-2831.522] (-2837.175) (-2837.213) * (-2834.225) (-2845.483) [-2829.142] (-2842.313) -- 0:02:10 751000 -- (-2824.405) (-2834.455) [-2834.250] (-2831.793) * [-2828.825] (-2836.463) (-2838.287) (-2850.081) -- 0:02:10 751500 -- (-2836.082) (-2837.962) [-2828.011] (-2831.946) * [-2831.881] (-2835.937) (-2827.169) (-2838.505) -- 0:02:10 752000 -- (-2834.631) (-2832.233) (-2842.420) [-2832.482] * [-2827.243] (-2843.066) (-2839.023) (-2837.300) -- 0:02:09 752500 -- [-2832.054] (-2826.849) (-2829.829) (-2830.988) * [-2832.192] (-2845.265) (-2837.555) (-2833.983) -- 0:02:09 753000 -- (-2836.330) (-2842.161) (-2833.684) [-2834.693] * (-2835.615) (-2848.519) (-2838.619) [-2827.270] -- 0:02:09 753500 -- [-2825.735] (-2839.481) (-2836.445) (-2832.292) * [-2833.303] (-2839.261) (-2839.548) (-2829.859) -- 0:02:09 754000 -- (-2837.156) (-2831.209) (-2828.235) [-2837.387] * (-2838.288) (-2831.788) [-2836.762] (-2833.356) -- 0:02:09 754500 -- (-2827.977) (-2829.809) (-2843.705) [-2837.951] * (-2842.594) (-2840.521) [-2837.155] (-2839.025) -- 0:02:08 755000 -- (-2829.573) [-2836.464] (-2832.027) (-2835.634) * (-2832.581) [-2827.396] (-2838.561) (-2836.130) -- 0:02:08 Average standard deviation of split frequencies: 0.005155 755500 -- (-2834.148) [-2832.503] (-2835.026) (-2833.102) * (-2847.684) (-2836.092) (-2843.436) [-2833.552] -- 0:02:08 756000 -- (-2829.412) (-2832.842) [-2844.677] (-2840.222) * (-2839.809) [-2831.956] (-2837.558) (-2836.736) -- 0:02:08 756500 -- (-2832.624) (-2841.579) (-2845.314) [-2845.406] * [-2827.952] (-2843.302) (-2829.664) (-2839.464) -- 0:02:07 757000 -- (-2833.172) (-2840.329) (-2845.444) [-2837.926] * (-2832.339) [-2830.627] (-2830.255) (-2828.684) -- 0:02:07 757500 -- (-2840.088) (-2826.590) (-2836.494) [-2835.550] * (-2835.956) (-2827.796) [-2837.732] (-2834.642) -- 0:02:07 758000 -- [-2832.844] (-2823.961) (-2836.892) (-2843.213) * (-2832.103) (-2829.394) [-2844.404] (-2836.615) -- 0:02:07 758500 -- (-2832.351) [-2832.679] (-2833.352) (-2835.940) * [-2832.291] (-2831.588) (-2835.119) (-2831.237) -- 0:02:06 759000 -- (-2838.033) (-2843.395) [-2832.673] (-2838.825) * (-2832.392) [-2830.391] (-2832.542) (-2841.897) -- 0:02:06 759500 -- [-2829.788] (-2840.744) (-2835.932) (-2832.922) * [-2839.096] (-2831.281) (-2835.619) (-2836.197) -- 0:02:06 760000 -- (-2835.724) (-2839.904) (-2836.685) [-2832.881] * [-2839.660] (-2837.272) (-2824.043) (-2835.920) -- 0:02:05 Average standard deviation of split frequencies: 0.004090 760500 -- [-2831.405] (-2843.629) (-2841.725) (-2829.272) * [-2832.321] (-2833.905) (-2841.861) (-2833.113) -- 0:02:05 761000 -- (-2835.710) (-2835.826) [-2837.612] (-2839.016) * (-2836.050) (-2834.717) (-2831.456) [-2831.946] -- 0:02:05 761500 -- [-2825.227] (-2847.250) (-2839.474) (-2834.866) * (-2836.602) (-2830.895) (-2834.713) [-2830.121] -- 0:02:04 762000 -- [-2828.208] (-2839.063) (-2841.510) (-2828.387) * [-2827.108] (-2834.472) (-2830.548) (-2829.365) -- 0:02:04 762500 -- (-2833.347) (-2837.250) (-2834.161) [-2831.603] * (-2834.407) (-2840.072) [-2831.222] (-2835.191) -- 0:02:04 763000 -- [-2832.649] (-2841.107) (-2837.268) (-2837.580) * (-2832.431) (-2830.135) [-2831.588] (-2833.472) -- 0:02:04 763500 -- [-2832.988] (-2834.735) (-2838.114) (-2833.954) * (-2844.022) (-2829.766) [-2831.652] (-2827.494) -- 0:02:04 764000 -- (-2838.877) (-2837.223) (-2833.877) [-2830.084] * (-2844.033) (-2845.553) [-2838.866] (-2833.970) -- 0:02:03 764500 -- (-2834.566) (-2836.335) (-2838.259) [-2838.076] * (-2844.258) [-2826.974] (-2841.555) (-2834.994) -- 0:02:03 765000 -- (-2833.741) (-2843.598) (-2837.072) [-2836.564] * (-2837.352) (-2829.884) [-2833.419] (-2831.013) -- 0:02:03 Average standard deviation of split frequencies: 0.004718 765500 -- (-2829.912) (-2843.574) (-2841.939) [-2833.566] * (-2831.959) [-2831.345] (-2842.359) (-2834.212) -- 0:02:03 766000 -- (-2828.000) (-2829.819) [-2834.397] (-2835.182) * (-2829.887) (-2826.714) (-2844.661) [-2826.577] -- 0:02:02 766500 -- (-2835.476) (-2830.283) [-2832.128] (-2834.687) * (-2832.210) (-2832.525) (-2830.738) [-2824.195] -- 0:02:02 767000 -- (-2830.251) (-2834.664) [-2830.081] (-2832.077) * [-2836.170] (-2831.816) (-2832.602) (-2824.897) -- 0:02:02 767500 -- (-2835.093) [-2834.269] (-2838.527) (-2836.927) * [-2829.268] (-2837.025) (-2824.576) (-2831.303) -- 0:02:02 768000 -- (-2840.995) [-2839.394] (-2831.155) (-2839.375) * (-2847.438) [-2828.738] (-2830.041) (-2835.080) -- 0:02:01 768500 -- (-2836.681) (-2842.641) (-2831.088) [-2835.492] * (-2833.918) (-2832.575) [-2832.220] (-2831.475) -- 0:02:01 769000 -- (-2835.005) (-2844.241) [-2826.955] (-2831.607) * [-2831.389] (-2830.239) (-2832.884) (-2832.763) -- 0:02:01 769500 -- (-2831.016) (-2843.794) [-2832.361] (-2837.313) * (-2832.093) [-2826.268] (-2835.823) (-2834.314) -- 0:02:01 770000 -- (-2842.495) [-2828.857] (-2845.537) (-2832.048) * (-2828.541) [-2835.575] (-2834.357) (-2831.755) -- 0:02:00 Average standard deviation of split frequencies: 0.005179 770500 -- [-2830.026] (-2829.879) (-2840.675) (-2832.643) * (-2832.443) [-2837.070] (-2830.212) (-2833.596) -- 0:02:00 771000 -- (-2841.243) [-2838.874] (-2840.596) (-2832.772) * (-2829.704) (-2843.541) (-2838.891) [-2835.154] -- 0:02:00 771500 -- (-2839.922) (-2843.753) (-2831.312) [-2831.336] * (-2830.778) [-2830.215] (-2838.926) (-2834.169) -- 0:01:59 772000 -- [-2830.468] (-2836.690) (-2832.076) (-2845.541) * [-2829.128] (-2838.335) (-2845.946) (-2829.999) -- 0:01:59 772500 -- (-2832.896) (-2844.357) (-2841.786) [-2837.710] * [-2840.371] (-2847.476) (-2835.230) (-2827.649) -- 0:01:59 773000 -- [-2828.067] (-2851.252) (-2832.060) (-2839.430) * (-2835.571) (-2836.450) [-2834.785] (-2840.001) -- 0:01:59 773500 -- (-2836.016) [-2829.713] (-2828.782) (-2836.945) * (-2826.032) (-2832.746) (-2841.292) [-2829.949] -- 0:01:58 774000 -- (-2835.754) [-2842.917] (-2835.478) (-2844.884) * (-2833.148) (-2829.683) (-2843.280) [-2824.832] -- 0:01:58 774500 -- [-2833.227] (-2832.978) (-2843.375) (-2836.703) * [-2834.370] (-2835.302) (-2840.025) (-2844.745) -- 0:01:58 775000 -- [-2837.168] (-2837.065) (-2831.947) (-2845.681) * (-2844.247) (-2830.255) (-2841.759) [-2838.283] -- 0:01:58 Average standard deviation of split frequencies: 0.005467 775500 -- [-2835.980] (-2831.650) (-2840.737) (-2838.978) * (-2849.887) [-2830.064] (-2837.085) (-2845.551) -- 0:01:58 776000 -- (-2823.439) (-2844.810) [-2830.388] (-2840.824) * [-2835.220] (-2839.250) (-2831.967) (-2828.959) -- 0:01:57 776500 -- (-2835.555) (-2840.164) [-2835.444] (-2834.295) * [-2833.827] (-2839.661) (-2841.498) (-2829.892) -- 0:01:57 777000 -- (-2837.350) (-2836.741) [-2823.500] (-2838.546) * (-2846.383) [-2833.900] (-2844.005) (-2838.566) -- 0:01:57 777500 -- (-2837.129) [-2829.195] (-2837.354) (-2837.690) * (-2841.090) [-2837.751] (-2835.163) (-2837.029) -- 0:01:57 778000 -- (-2843.153) (-2850.576) [-2830.869] (-2833.590) * (-2843.560) (-2832.232) (-2848.456) [-2828.936] -- 0:01:56 778500 -- (-2831.301) (-2834.995) [-2829.604] (-2843.040) * (-2841.417) [-2829.314] (-2830.026) (-2834.448) -- 0:01:56 779000 -- (-2841.755) (-2838.822) (-2836.421) [-2831.048] * (-2831.139) (-2830.025) [-2826.047] (-2839.105) -- 0:01:56 779500 -- (-2837.417) (-2843.933) (-2835.916) [-2833.276] * (-2833.144) (-2841.732) (-2838.741) [-2835.078] -- 0:01:55 780000 -- (-2837.961) (-2829.107) (-2835.245) [-2830.873] * (-2832.874) (-2831.771) [-2831.524] (-2834.505) -- 0:01:55 Average standard deviation of split frequencies: 0.005555 780500 -- (-2834.884) (-2834.471) [-2834.780] (-2839.243) * (-2844.289) (-2842.950) (-2842.833) [-2829.242] -- 0:01:55 781000 -- (-2838.793) (-2831.643) [-2832.491] (-2842.487) * (-2831.959) [-2832.886] (-2837.423) (-2834.922) -- 0:01:54 781500 -- (-2833.891) (-2842.131) (-2834.755) [-2825.429] * [-2829.940] (-2842.563) (-2834.273) (-2835.696) -- 0:01:54 782000 -- [-2830.485] (-2833.645) (-2826.362) (-2829.028) * (-2839.380) (-2843.867) [-2837.630] (-2836.457) -- 0:01:54 782500 -- (-2830.502) [-2837.730] (-2826.966) (-2827.025) * [-2834.592] (-2836.798) (-2833.602) (-2836.756) -- 0:01:54 783000 -- [-2834.626] (-2832.730) (-2836.616) (-2830.437) * (-2837.012) (-2840.703) (-2833.689) [-2841.816] -- 0:01:54 783500 -- [-2826.022] (-2837.641) (-2831.173) (-2833.075) * (-2836.737) (-2829.337) (-2844.743) [-2839.782] -- 0:01:53 784000 -- (-2833.421) [-2831.295] (-2831.834) (-2840.821) * (-2840.192) (-2829.929) [-2832.692] (-2828.697) -- 0:01:53 784500 -- (-2831.430) (-2840.467) (-2829.426) [-2835.354] * (-2839.131) (-2842.689) (-2843.374) [-2832.634] -- 0:01:53 785000 -- (-2840.690) [-2836.025] (-2829.510) (-2830.386) * [-2832.318] (-2838.911) (-2851.061) (-2828.954) -- 0:01:53 Average standard deviation of split frequencies: 0.005678 785500 -- [-2828.223] (-2837.241) (-2840.727) (-2829.192) * [-2825.898] (-2841.857) (-2860.089) (-2832.400) -- 0:01:52 786000 -- (-2833.942) (-2834.239) [-2829.910] (-2840.015) * (-2833.269) (-2842.605) (-2836.120) [-2830.488] -- 0:01:52 786500 -- (-2834.083) (-2842.475) (-2832.677) [-2833.178] * [-2834.942] (-2839.903) (-2828.612) (-2846.301) -- 0:01:52 787000 -- (-2842.873) [-2841.867] (-2838.929) (-2840.786) * [-2830.013] (-2831.828) (-2828.067) (-2836.734) -- 0:01:52 787500 -- (-2836.043) (-2836.271) (-2840.840) [-2837.612] * (-2838.072) (-2846.350) (-2836.190) [-2839.658] -- 0:01:51 788000 -- (-2828.448) (-2833.837) [-2830.767] (-2838.322) * (-2835.016) (-2852.003) [-2838.127] (-2831.280) -- 0:01:51 788500 -- (-2829.270) [-2830.957] (-2830.721) (-2837.367) * (-2837.801) (-2834.378) [-2829.714] (-2836.862) -- 0:01:51 789000 -- (-2844.972) (-2839.013) [-2831.279] (-2827.293) * (-2830.138) (-2833.613) (-2827.933) [-2833.681] -- 0:01:50 789500 -- [-2835.743] (-2830.132) (-2839.306) (-2842.435) * (-2830.055) (-2828.753) [-2827.516] (-2834.570) -- 0:01:50 790000 -- (-2830.612) [-2840.450] (-2843.979) (-2833.514) * (-2832.546) [-2829.848] (-2828.619) (-2835.639) -- 0:01:50 Average standard deviation of split frequencies: 0.005406 790500 -- [-2828.349] (-2841.914) (-2839.827) (-2829.368) * [-2833.731] (-2838.931) (-2828.200) (-2835.753) -- 0:01:50 791000 -- (-2833.813) (-2832.088) (-2851.299) [-2830.975] * (-2838.356) [-2838.887] (-2839.389) (-2838.116) -- 0:01:49 791500 -- (-2842.658) (-2831.364) (-2841.846) [-2830.296] * [-2844.646] (-2836.718) (-2829.422) (-2831.508) -- 0:01:49 792000 -- (-2837.673) [-2835.218] (-2838.030) (-2831.908) * (-2851.823) (-2843.161) (-2830.500) [-2834.721] -- 0:01:49 792500 -- (-2836.327) (-2832.398) [-2835.298] (-2834.204) * (-2840.124) (-2842.174) [-2831.134] (-2837.538) -- 0:01:49 793000 -- [-2841.718] (-2825.330) (-2840.900) (-2846.615) * [-2833.572] (-2844.341) (-2829.541) (-2837.329) -- 0:01:48 793500 -- [-2830.953] (-2828.692) (-2845.099) (-2840.477) * (-2834.301) (-2839.052) (-2840.156) [-2828.988] -- 0:01:48 794000 -- (-2833.936) (-2827.518) (-2838.641) [-2831.389] * (-2833.733) (-2833.472) (-2840.086) [-2838.358] -- 0:01:48 794500 -- (-2832.882) [-2837.660] (-2829.426) (-2824.791) * (-2836.253) [-2834.441] (-2834.830) (-2836.006) -- 0:01:48 795000 -- (-2839.242) (-2834.221) [-2834.402] (-2837.266) * (-2836.862) [-2829.937] (-2841.486) (-2845.432) -- 0:01:47 Average standard deviation of split frequencies: 0.004619 795500 -- (-2836.092) (-2845.302) (-2835.684) [-2828.738] * (-2835.876) (-2831.386) [-2826.377] (-2829.703) -- 0:01:47 796000 -- (-2833.344) (-2841.884) [-2824.585] (-2829.775) * (-2837.056) [-2837.373] (-2835.285) (-2836.588) -- 0:01:47 796500 -- (-2831.236) (-2830.909) (-2832.791) [-2834.064] * [-2835.125] (-2832.837) (-2840.247) (-2832.499) -- 0:01:47 797000 -- (-2832.722) [-2831.229] (-2835.739) (-2835.784) * (-2846.443) (-2835.486) (-2836.303) [-2825.348] -- 0:01:46 797500 -- [-2832.462] (-2832.577) (-2829.887) (-2836.901) * (-2840.864) [-2825.016] (-2839.725) (-2830.004) -- 0:01:46 798000 -- (-2834.447) (-2832.603) (-2838.169) [-2830.851] * (-2834.097) (-2834.489) (-2835.252) [-2821.928] -- 0:01:46 798500 -- (-2835.946) (-2829.992) (-2833.649) [-2829.847] * [-2842.085] (-2836.856) (-2828.189) (-2827.369) -- 0:01:45 799000 -- [-2834.322] (-2832.776) (-2853.223) (-2831.310) * (-2833.285) [-2839.173] (-2837.647) (-2841.629) -- 0:01:45 799500 -- [-2835.386] (-2834.309) (-2843.288) (-2836.408) * (-2833.014) (-2837.457) [-2836.120] (-2831.312) -- 0:01:45 800000 -- (-2846.070) (-2834.266) [-2829.733] (-2837.415) * (-2830.821) [-2833.548] (-2839.719) (-2837.724) -- 0:01:45 Average standard deviation of split frequencies: 0.004278 800500 -- (-2829.809) (-2836.726) [-2827.742] (-2834.272) * (-2833.263) (-2837.568) (-2832.980) [-2832.484] -- 0:01:44 801000 -- (-2831.570) (-2827.697) [-2831.224] (-2834.476) * [-2831.642] (-2846.699) (-2838.125) (-2830.833) -- 0:01:44 801500 -- (-2836.669) (-2835.464) [-2829.356] (-2830.259) * (-2834.375) (-2832.598) (-2838.403) [-2833.765] -- 0:01:44 802000 -- [-2840.053] (-2830.725) (-2831.151) (-2841.638) * [-2827.708] (-2836.363) (-2838.013) (-2834.044) -- 0:01:44 802500 -- [-2832.844] (-2833.559) (-2838.181) (-2842.573) * (-2837.108) (-2833.932) (-2837.978) [-2826.232] -- 0:01:43 803000 -- (-2839.909) (-2829.239) [-2839.916] (-2831.604) * (-2836.050) [-2829.975] (-2831.352) (-2832.794) -- 0:01:43 803500 -- (-2831.436) (-2831.446) [-2830.537] (-2838.721) * [-2834.581] (-2833.857) (-2839.560) (-2837.552) -- 0:01:43 804000 -- (-2836.391) (-2828.946) [-2833.450] (-2835.493) * (-2839.476) [-2833.367] (-2837.629) (-2835.232) -- 0:01:43 804500 -- (-2834.698) [-2826.610] (-2834.707) (-2830.545) * (-2831.186) (-2836.944) (-2839.271) [-2824.699] -- 0:01:42 805000 -- (-2845.253) (-2834.582) (-2837.728) [-2830.303] * [-2831.553] (-2844.857) (-2832.882) (-2826.148) -- 0:01:42 Average standard deviation of split frequencies: 0.003899 805500 -- (-2830.782) [-2833.550] (-2834.804) (-2831.902) * [-2839.667] (-2828.503) (-2826.387) (-2835.887) -- 0:01:42 806000 -- [-2830.840] (-2832.018) (-2832.166) (-2834.885) * (-2838.169) (-2835.907) (-2828.508) [-2837.609] -- 0:01:42 806500 -- (-2836.300) (-2836.927) [-2827.828] (-2831.403) * [-2827.301] (-2843.351) (-2831.916) (-2829.377) -- 0:01:41 807000 -- (-2839.704) [-2832.870] (-2832.879) (-2835.204) * (-2842.082) (-2834.114) [-2829.646] (-2829.936) -- 0:01:41 807500 -- (-2835.046) (-2832.449) [-2831.868] (-2832.931) * (-2836.348) (-2834.636) [-2836.138] (-2833.907) -- 0:01:41 808000 -- [-2827.785] (-2840.073) (-2827.592) (-2836.385) * (-2828.853) [-2830.500] (-2839.097) (-2833.818) -- 0:01:40 808500 -- (-2839.326) (-2835.746) (-2842.072) [-2833.423] * (-2840.978) (-2826.940) [-2826.573] (-2834.463) -- 0:01:40 809000 -- (-2837.742) [-2826.570] (-2848.225) (-2836.723) * (-2837.000) (-2830.155) (-2833.678) [-2831.555] -- 0:01:40 809500 -- (-2837.136) [-2825.220] (-2838.005) (-2839.901) * (-2834.629) (-2838.053) [-2830.944] (-2841.038) -- 0:01:40 810000 -- [-2842.330] (-2834.835) (-2837.677) (-2836.404) * (-2840.728) (-2843.575) [-2837.414] (-2829.738) -- 0:01:39 Average standard deviation of split frequencies: 0.003738 810500 -- [-2828.157] (-2836.535) (-2844.730) (-2831.898) * (-2837.507) (-2836.464) [-2832.874] (-2841.237) -- 0:01:39 811000 -- (-2835.177) [-2832.082] (-2834.661) (-2837.369) * (-2835.731) (-2826.725) [-2829.756] (-2835.058) -- 0:01:39 811500 -- (-2829.876) (-2834.848) [-2837.908] (-2832.826) * (-2832.117) (-2828.027) (-2826.639) [-2828.666] -- 0:01:39 812000 -- (-2831.290) (-2844.166) (-2841.701) [-2824.718] * (-2839.654) (-2834.151) [-2827.893] (-2838.200) -- 0:01:38 812500 -- (-2833.926) [-2830.700] (-2833.937) (-2829.616) * (-2836.997) (-2839.220) [-2836.357] (-2835.860) -- 0:01:38 813000 -- (-2840.706) (-2836.694) (-2831.068) [-2829.559] * (-2841.735) (-2839.353) (-2838.766) [-2832.820] -- 0:01:38 813500 -- (-2841.482) (-2828.559) [-2829.203] (-2833.229) * (-2840.446) (-2837.572) [-2832.372] (-2837.500) -- 0:01:38 814000 -- [-2834.034] (-2833.332) (-2830.458) (-2832.370) * [-2827.000] (-2829.767) (-2831.545) (-2833.400) -- 0:01:37 814500 -- (-2830.325) (-2838.902) (-2834.986) [-2829.058] * (-2828.074) [-2835.934] (-2841.400) (-2837.187) -- 0:01:37 815000 -- (-2839.926) (-2839.516) [-2839.612] (-2828.425) * [-2832.495] (-2834.979) (-2839.646) (-2837.218) -- 0:01:37 Average standard deviation of split frequencies: 0.003507 815500 -- [-2824.470] (-2835.350) (-2833.897) (-2841.641) * (-2836.375) [-2832.737] (-2833.054) (-2844.320) -- 0:01:37 816000 -- (-2828.361) [-2829.919] (-2842.174) (-2846.134) * (-2828.818) [-2835.948] (-2831.779) (-2850.070) -- 0:01:36 816500 -- [-2836.276] (-2828.831) (-2839.273) (-2841.249) * [-2836.484] (-2847.746) (-2835.811) (-2836.294) -- 0:01:36 817000 -- (-2833.556) (-2837.241) (-2839.077) [-2829.571] * (-2830.142) [-2831.410] (-2828.818) (-2833.334) -- 0:01:36 817500 -- (-2840.553) (-2836.477) (-2835.625) [-2826.701] * (-2833.516) (-2839.266) (-2833.423) [-2834.488] -- 0:01:35 818000 -- (-2835.126) (-2840.943) [-2838.223] (-2837.426) * (-2835.536) (-2843.537) [-2826.964] (-2830.326) -- 0:01:35 818500 -- [-2837.896] (-2855.075) (-2834.112) (-2841.518) * (-2828.618) [-2829.112] (-2833.480) (-2840.850) -- 0:01:35 819000 -- (-2839.074) [-2836.254] (-2833.214) (-2842.153) * (-2832.793) (-2833.670) [-2839.980] (-2831.959) -- 0:01:35 819500 -- (-2829.410) [-2836.761] (-2827.946) (-2835.592) * (-2835.760) [-2838.018] (-2843.290) (-2833.775) -- 0:01:34 820000 -- [-2830.375] (-2831.334) (-2841.021) (-2836.936) * (-2833.275) [-2842.458] (-2838.725) (-2828.926) -- 0:01:34 Average standard deviation of split frequencies: 0.003652 820500 -- (-2828.684) [-2837.513] (-2840.874) (-2834.834) * (-2826.078) (-2833.585) [-2831.048] (-2841.960) -- 0:01:34 821000 -- (-2839.532) [-2832.415] (-2841.087) (-2836.684) * (-2834.097) [-2829.097] (-2841.294) (-2831.907) -- 0:01:34 821500 -- [-2831.568] (-2842.257) (-2844.599) (-2838.391) * (-2825.292) (-2837.247) (-2836.857) [-2830.990] -- 0:01:33 822000 -- [-2833.335] (-2842.417) (-2838.956) (-2834.142) * (-2827.964) (-2828.072) [-2835.820] (-2839.887) -- 0:01:33 822500 -- (-2839.123) [-2833.929] (-2834.622) (-2830.309) * (-2839.951) (-2845.732) (-2830.027) [-2831.791] -- 0:01:33 823000 -- [-2841.349] (-2839.638) (-2835.918) (-2840.359) * [-2837.003] (-2840.861) (-2832.371) (-2842.704) -- 0:01:33 823500 -- (-2837.714) (-2830.477) [-2840.849] (-2842.394) * (-2836.693) (-2843.767) (-2830.758) [-2827.996] -- 0:01:33 824000 -- (-2830.633) (-2837.411) [-2844.414] (-2846.909) * (-2830.599) [-2834.726] (-2842.813) (-2826.375) -- 0:01:32 824500 -- (-2839.157) [-2837.960] (-2835.870) (-2847.876) * (-2837.879) (-2839.515) (-2826.604) [-2831.031] -- 0:01:32 825000 -- (-2838.826) (-2827.583) (-2829.940) [-2839.588] * (-2839.515) [-2836.012] (-2832.035) (-2836.340) -- 0:01:32 Average standard deviation of split frequencies: 0.003873 825500 -- (-2833.108) (-2829.440) (-2832.244) [-2833.901] * [-2844.112] (-2831.589) (-2835.962) (-2834.222) -- 0:01:31 826000 -- [-2830.403] (-2847.218) (-2833.567) (-2839.877) * (-2838.035) (-2826.372) (-2843.967) [-2827.158] -- 0:01:31 826500 -- (-2828.022) (-2835.576) [-2833.540] (-2836.890) * (-2840.643) [-2836.974] (-2834.458) (-2838.164) -- 0:01:31 827000 -- [-2829.109] (-2834.553) (-2844.083) (-2842.770) * (-2837.794) [-2832.756] (-2832.979) (-2834.134) -- 0:01:31 827500 -- (-2837.102) (-2835.324) (-2838.799) [-2833.633] * [-2830.990] (-2841.866) (-2845.752) (-2838.815) -- 0:01:30 828000 -- (-2844.241) (-2839.164) (-2840.723) [-2841.984] * (-2831.137) [-2825.566] (-2835.349) (-2840.150) -- 0:01:30 828500 -- (-2834.083) (-2839.912) [-2833.092] (-2833.287) * [-2837.785] (-2850.159) (-2841.165) (-2844.239) -- 0:01:30 829000 -- [-2832.696] (-2834.260) (-2838.261) (-2838.510) * (-2828.977) (-2833.358) [-2827.908] (-2837.828) -- 0:01:30 829500 -- [-2841.233] (-2843.525) (-2836.819) (-2830.899) * (-2827.777) [-2832.205] (-2830.708) (-2844.085) -- 0:01:29 830000 -- (-2823.909) [-2832.559] (-2832.148) (-2839.670) * (-2837.412) [-2837.914] (-2835.095) (-2846.339) -- 0:01:29 Average standard deviation of split frequencies: 0.003973 830500 -- [-2834.611] (-2830.546) (-2838.942) (-2853.273) * (-2852.302) (-2831.856) [-2835.115] (-2846.562) -- 0:01:29 831000 -- (-2837.389) [-2838.817] (-2828.587) (-2842.977) * (-2837.228) (-2838.648) [-2839.314] (-2831.190) -- 0:01:29 831500 -- (-2836.711) [-2832.374] (-2827.523) (-2842.165) * (-2835.947) [-2833.413] (-2844.315) (-2833.744) -- 0:01:28 832000 -- (-2827.949) (-2833.520) [-2833.931] (-2835.155) * (-2842.320) (-2827.809) [-2839.885] (-2827.709) -- 0:01:28 832500 -- (-2831.413) (-2834.300) [-2833.816] (-2833.563) * (-2838.974) (-2835.418) (-2832.546) [-2836.842] -- 0:01:28 833000 -- [-2832.529] (-2828.115) (-2833.807) (-2837.716) * (-2837.951) (-2832.708) (-2834.462) [-2834.726] -- 0:01:28 833500 -- (-2840.212) (-2832.800) (-2841.771) [-2831.354] * (-2838.887) (-2850.160) (-2831.437) [-2832.417] -- 0:01:27 834000 -- [-2831.125] (-2842.794) (-2840.213) (-2838.881) * (-2837.385) (-2831.888) (-2835.114) [-2829.586] -- 0:01:27 834500 -- (-2826.536) (-2836.156) [-2831.713] (-2833.255) * [-2832.481] (-2836.719) (-2827.671) (-2838.239) -- 0:01:27 835000 -- (-2836.222) [-2831.198] (-2833.787) (-2831.398) * (-2828.308) (-2831.556) (-2840.927) [-2831.805] -- 0:01:26 Average standard deviation of split frequencies: 0.003987 835500 -- (-2836.460) (-2831.932) (-2845.794) [-2832.997] * (-2836.649) [-2829.607] (-2845.300) (-2832.586) -- 0:01:26 836000 -- (-2837.689) [-2837.038] (-2846.261) (-2830.072) * (-2829.990) [-2829.651] (-2835.832) (-2825.733) -- 0:01:26 836500 -- (-2840.858) [-2831.449] (-2832.617) (-2840.481) * (-2838.106) (-2838.283) (-2836.830) [-2829.243] -- 0:01:26 837000 -- (-2830.626) (-2836.922) [-2828.797] (-2831.653) * [-2838.563] (-2842.258) (-2844.098) (-2837.542) -- 0:01:25 837500 -- (-2836.748) (-2835.332) (-2831.968) [-2829.087] * (-2834.064) (-2833.873) (-2842.123) [-2840.158] -- 0:01:25 838000 -- (-2831.913) (-2839.969) [-2833.286] (-2834.492) * (-2837.478) (-2828.827) (-2848.987) [-2833.983] -- 0:01:25 838500 -- (-2835.806) [-2843.479] (-2843.976) (-2832.284) * (-2831.010) [-2827.628] (-2840.308) (-2837.170) -- 0:01:25 839000 -- [-2830.859] (-2829.430) (-2842.545) (-2833.167) * (-2831.740) (-2837.064) (-2832.959) [-2833.362] -- 0:01:24 839500 -- (-2825.885) (-2829.832) (-2834.474) [-2836.399] * (-2833.238) (-2833.353) (-2838.389) [-2828.571] -- 0:01:24 840000 -- (-2840.821) (-2842.059) [-2832.313] (-2837.424) * (-2837.413) [-2829.927] (-2835.662) (-2838.562) -- 0:01:24 Average standard deviation of split frequencies: 0.004206 840500 -- (-2843.832) (-2836.434) (-2845.804) [-2833.851] * [-2833.367] (-2827.917) (-2843.034) (-2835.842) -- 0:01:24 841000 -- [-2834.419] (-2849.631) (-2839.877) (-2836.571) * (-2841.162) (-2825.554) (-2839.115) [-2828.590] -- 0:01:23 841500 -- (-2833.317) [-2834.010] (-2857.788) (-2832.117) * (-2838.452) (-2836.634) [-2832.851] (-2837.612) -- 0:01:23 842000 -- [-2827.326] (-2830.726) (-2848.456) (-2834.676) * (-2834.013) (-2842.364) (-2833.761) [-2832.398] -- 0:01:23 842500 -- (-2832.448) (-2830.430) (-2846.744) [-2840.731] * (-2833.910) (-2831.567) [-2838.560] (-2832.451) -- 0:01:23 843000 -- (-2849.763) (-2829.624) [-2851.322] (-2824.676) * (-2829.615) [-2834.103] (-2839.784) (-2832.754) -- 0:01:22 843500 -- (-2829.875) (-2836.301) (-2838.587) [-2828.494] * (-2847.505) [-2830.262] (-2842.808) (-2839.953) -- 0:01:22 844000 -- (-2860.164) [-2831.716] (-2836.143) (-2829.167) * (-2834.658) (-2838.573) (-2827.876) [-2841.190] -- 0:01:22 844500 -- (-2835.453) (-2833.524) (-2844.159) [-2840.878] * (-2836.689) [-2831.366] (-2832.965) (-2837.516) -- 0:01:21 845000 -- (-2839.181) (-2830.756) [-2831.859] (-2841.401) * [-2836.137] (-2844.272) (-2827.938) (-2835.532) -- 0:01:21 Average standard deviation of split frequencies: 0.004338 845500 -- (-2842.675) (-2831.520) (-2834.056) [-2844.086] * (-2837.253) (-2835.757) [-2830.301] (-2828.735) -- 0:01:21 846000 -- [-2834.850] (-2826.782) (-2843.451) (-2845.012) * (-2837.693) (-2843.676) (-2840.995) [-2830.549] -- 0:01:21 846500 -- [-2829.486] (-2833.559) (-2848.784) (-2841.175) * [-2839.458] (-2845.439) (-2834.285) (-2841.572) -- 0:01:20 847000 -- [-2835.419] (-2842.724) (-2846.717) (-2832.635) * (-2841.091) (-2844.099) [-2829.087] (-2837.889) -- 0:01:20 847500 -- (-2832.886) (-2846.812) [-2834.517] (-2835.178) * (-2845.716) [-2835.715] (-2828.739) (-2846.572) -- 0:01:20 848000 -- (-2834.562) (-2831.349) [-2835.746] (-2838.295) * (-2834.301) (-2839.408) (-2832.195) [-2842.123] -- 0:01:20 848500 -- [-2831.043] (-2834.500) (-2826.251) (-2839.889) * [-2837.915] (-2841.580) (-2839.404) (-2833.346) -- 0:01:19 849000 -- (-2833.628) [-2830.440] (-2831.319) (-2826.263) * (-2832.294) (-2833.512) [-2832.030] (-2846.123) -- 0:01:19 849500 -- (-2843.497) (-2837.185) (-2829.058) [-2829.834] * (-2851.459) [-2834.851] (-2829.123) (-2840.801) -- 0:01:19 850000 -- (-2833.130) [-2836.430] (-2844.205) (-2843.042) * (-2832.564) [-2843.134] (-2845.259) (-2837.944) -- 0:01:19 Average standard deviation of split frequencies: 0.004315 850500 -- [-2834.687] (-2839.156) (-2847.327) (-2840.965) * [-2821.337] (-2835.221) (-2831.807) (-2837.564) -- 0:01:18 851000 -- (-2839.869) (-2839.273) [-2828.515] (-2836.814) * (-2828.317) (-2836.298) (-2834.922) [-2838.789] -- 0:01:18 851500 -- (-2837.074) (-2842.198) [-2840.871] (-2831.887) * (-2833.325) (-2834.031) (-2839.859) [-2836.566] -- 0:01:18 852000 -- (-2832.093) [-2838.953] (-2828.220) (-2838.142) * (-2833.615) (-2839.827) [-2841.301] (-2834.610) -- 0:01:17 852500 -- [-2832.339] (-2828.579) (-2834.257) (-2843.670) * (-2832.733) (-2830.664) [-2835.880] (-2827.162) -- 0:01:17 853000 -- [-2833.252] (-2834.459) (-2842.250) (-2843.073) * (-2840.391) (-2840.152) (-2835.910) [-2825.006] -- 0:01:17 853500 -- (-2838.842) (-2837.863) [-2830.008] (-2835.059) * (-2834.700) (-2834.440) [-2832.099] (-2829.387) -- 0:01:17 854000 -- [-2831.024] (-2835.398) (-2839.223) (-2838.241) * [-2828.440] (-2834.435) (-2831.986) (-2831.529) -- 0:01:16 854500 -- [-2836.355] (-2831.423) (-2842.701) (-2843.314) * [-2829.546] (-2838.254) (-2825.459) (-2829.955) -- 0:01:16 855000 -- [-2830.017] (-2836.853) (-2832.047) (-2841.079) * (-2834.280) (-2845.250) (-2828.626) [-2837.573] -- 0:01:16 Average standard deviation of split frequencies: 0.004130 855500 -- (-2833.193) (-2840.583) [-2832.543] (-2830.133) * (-2837.843) (-2833.984) [-2830.287] (-2845.580) -- 0:01:16 856000 -- (-2835.970) (-2838.480) [-2827.219] (-2837.279) * (-2836.558) (-2842.695) [-2843.572] (-2836.261) -- 0:01:15 856500 -- [-2828.767] (-2839.809) (-2835.535) (-2833.799) * [-2831.553] (-2835.920) (-2835.228) (-2833.755) -- 0:01:15 857000 -- (-2831.033) [-2831.426] (-2835.677) (-2829.864) * (-2848.232) (-2847.895) (-2845.057) [-2831.053] -- 0:01:15 857500 -- (-2826.481) (-2835.903) [-2843.822] (-2828.451) * (-2835.070) (-2838.415) [-2835.078] (-2831.619) -- 0:01:14 858000 -- (-2833.574) (-2827.489) (-2844.605) [-2832.178] * [-2832.661] (-2831.645) (-2835.260) (-2825.989) -- 0:01:14 858500 -- (-2838.368) [-2840.793] (-2848.968) (-2831.723) * (-2840.237) (-2828.106) (-2828.599) [-2832.682] -- 0:01:14 859000 -- (-2834.834) (-2843.526) (-2841.146) [-2829.018] * [-2836.965] (-2843.318) (-2836.775) (-2837.741) -- 0:01:14 859500 -- (-2840.741) (-2834.316) (-2832.315) [-2832.623] * (-2827.026) [-2838.821] (-2840.557) (-2830.877) -- 0:01:13 860000 -- [-2832.499] (-2829.207) (-2832.625) (-2834.171) * (-2833.500) (-2851.517) [-2831.592] (-2834.083) -- 0:01:13 Average standard deviation of split frequencies: 0.004108 860500 -- [-2838.766] (-2828.003) (-2844.935) (-2836.053) * [-2838.398] (-2845.780) (-2830.965) (-2842.568) -- 0:01:13 861000 -- (-2834.565) [-2831.924] (-2833.546) (-2825.977) * [-2831.768] (-2847.572) (-2832.241) (-2836.903) -- 0:01:13 861500 -- (-2833.325) (-2827.848) (-2834.378) [-2833.494] * (-2830.412) [-2839.178] (-2837.142) (-2832.006) -- 0:01:12 862000 -- (-2842.134) (-2835.979) (-2835.442) [-2832.085] * [-2832.725] (-2834.670) (-2841.764) (-2831.045) -- 0:01:12 862500 -- (-2841.497) (-2844.656) (-2831.908) [-2833.361] * (-2831.512) (-2843.983) (-2830.743) [-2838.443] -- 0:01:12 863000 -- (-2844.909) (-2844.925) (-2833.485) [-2824.259] * (-2838.588) [-2830.422] (-2834.355) (-2832.768) -- 0:01:12 863500 -- (-2845.974) (-2838.722) [-2833.996] (-2828.383) * (-2835.216) (-2832.201) (-2839.604) [-2829.630] -- 0:01:11 864000 -- (-2835.250) (-2831.660) [-2836.445] (-2836.936) * (-2837.618) (-2832.737) [-2837.896] (-2830.924) -- 0:01:11 864500 -- (-2840.162) [-2829.881] (-2833.783) (-2830.593) * [-2834.201] (-2830.767) (-2831.747) (-2831.154) -- 0:01:11 865000 -- (-2833.128) (-2838.332) [-2838.508] (-2835.938) * [-2829.397] (-2845.743) (-2836.571) (-2837.873) -- 0:01:11 Average standard deviation of split frequencies: 0.004588 865500 -- [-2829.345] (-2836.001) (-2837.596) (-2832.610) * (-2839.882) [-2829.071] (-2840.211) (-2841.648) -- 0:01:10 866000 -- (-2836.150) (-2842.535) [-2830.410] (-2837.885) * (-2831.747) (-2842.296) [-2835.498] (-2829.256) -- 0:01:10 866500 -- (-2835.771) (-2834.909) [-2835.934] (-2842.601) * (-2838.142) (-2831.301) [-2834.266] (-2835.825) -- 0:01:10 867000 -- (-2843.851) (-2837.822) (-2837.026) [-2835.239] * (-2832.856) (-2835.714) (-2832.375) [-2827.056] -- 0:01:09 867500 -- (-2851.082) (-2835.437) (-2833.887) [-2830.105] * (-2844.941) (-2834.526) (-2834.723) [-2836.234] -- 0:01:09 868000 -- (-2846.168) (-2844.444) (-2830.412) [-2835.646] * [-2829.247] (-2838.640) (-2838.982) (-2831.717) -- 0:01:09 868500 -- (-2851.026) [-2832.713] (-2829.853) (-2834.796) * (-2839.760) (-2831.449) (-2834.259) [-2835.808] -- 0:01:09 869000 -- [-2831.918] (-2831.387) (-2837.402) (-2832.687) * (-2839.699) (-2832.069) (-2846.753) [-2831.538] -- 0:01:08 869500 -- (-2849.403) (-2833.956) [-2836.809] (-2829.906) * (-2832.322) (-2839.384) (-2837.555) [-2826.208] -- 0:01:08 870000 -- (-2841.536) (-2829.125) (-2832.430) [-2840.338] * [-2834.362] (-2840.534) (-2835.253) (-2822.421) -- 0:01:08 Average standard deviation of split frequencies: 0.004837 870500 -- (-2835.191) (-2827.075) (-2834.631) [-2829.317] * (-2834.251) (-2833.837) [-2837.394] (-2828.073) -- 0:01:08 871000 -- (-2851.793) (-2845.108) [-2830.397] (-2832.162) * (-2840.352) (-2836.818) [-2835.224] (-2833.578) -- 0:01:07 871500 -- (-2845.889) (-2836.248) (-2837.396) [-2832.630] * (-2839.947) (-2847.639) [-2839.361] (-2826.094) -- 0:01:07 872000 -- (-2834.880) [-2838.309] (-2836.103) (-2833.877) * (-2835.821) (-2831.733) [-2831.467] (-2831.498) -- 0:01:07 872500 -- (-2833.827) (-2848.867) [-2836.901] (-2837.310) * (-2834.186) (-2839.221) (-2833.404) [-2828.570] -- 0:01:07 873000 -- [-2825.926] (-2832.446) (-2839.210) (-2841.422) * [-2832.090] (-2834.226) (-2844.266) (-2839.575) -- 0:01:06 873500 -- (-2828.754) (-2832.764) (-2847.264) [-2838.538] * (-2835.424) [-2832.305] (-2844.622) (-2839.372) -- 0:01:06 874000 -- (-2837.218) (-2835.989) [-2832.962] (-2830.839) * [-2829.633] (-2840.411) (-2842.990) (-2844.629) -- 0:01:06 874500 -- (-2843.046) (-2835.752) (-2838.283) [-2835.579] * [-2831.446] (-2829.822) (-2838.299) (-2836.525) -- 0:01:06 875000 -- (-2834.920) [-2830.151] (-2837.086) (-2842.569) * (-2833.501) [-2834.615] (-2836.949) (-2847.664) -- 0:01:05 Average standard deviation of split frequencies: 0.004951 875500 -- [-2829.377] (-2834.727) (-2832.276) (-2832.559) * (-2841.653) [-2838.283] (-2843.304) (-2828.878) -- 0:01:05 876000 -- (-2836.552) [-2831.469] (-2835.526) (-2834.665) * [-2833.180] (-2841.578) (-2830.111) (-2839.582) -- 0:01:05 876500 -- (-2832.464) [-2831.814] (-2832.489) (-2835.661) * [-2833.414] (-2839.950) (-2843.243) (-2832.040) -- 0:01:04 877000 -- [-2833.084] (-2840.696) (-2833.145) (-2842.199) * [-2831.779] (-2830.761) (-2836.933) (-2842.902) -- 0:01:04 877500 -- [-2832.608] (-2832.634) (-2830.980) (-2838.375) * [-2832.215] (-2836.237) (-2838.559) (-2832.710) -- 0:01:04 878000 -- (-2841.328) (-2831.223) (-2840.567) [-2834.953] * [-2836.163] (-2840.266) (-2843.809) (-2837.200) -- 0:01:04 878500 -- (-2831.077) [-2831.498] (-2834.602) (-2833.194) * (-2838.011) (-2848.200) (-2847.349) [-2831.177] -- 0:01:03 879000 -- (-2828.839) [-2834.747] (-2837.767) (-2831.040) * (-2834.693) (-2839.287) [-2831.332] (-2833.003) -- 0:01:03 879500 -- [-2827.672] (-2843.799) (-2836.805) (-2833.828) * (-2841.295) [-2839.197] (-2838.755) (-2836.479) -- 0:01:03 880000 -- (-2838.745) (-2828.547) (-2835.514) [-2834.614] * (-2838.214) [-2832.903] (-2840.357) (-2835.008) -- 0:01:03 Average standard deviation of split frequencies: 0.004853 880500 -- (-2840.446) [-2830.271] (-2835.446) (-2842.582) * [-2831.578] (-2835.982) (-2828.627) (-2837.992) -- 0:01:02 881000 -- [-2829.033] (-2833.714) (-2842.863) (-2836.463) * (-2846.569) [-2833.953] (-2832.519) (-2840.087) -- 0:01:02 881500 -- [-2832.028] (-2832.877) (-2836.343) (-2832.105) * [-2832.985] (-2829.139) (-2828.591) (-2837.308) -- 0:01:02 882000 -- (-2833.665) [-2830.986] (-2830.769) (-2836.625) * [-2838.169] (-2832.419) (-2832.293) (-2846.222) -- 0:01:02 882500 -- (-2835.978) [-2839.897] (-2834.643) (-2839.383) * (-2833.888) (-2827.122) (-2830.897) [-2837.022] -- 0:01:01 883000 -- (-2830.834) (-2845.306) (-2832.218) [-2838.700] * (-2836.734) (-2826.040) (-2851.892) [-2830.762] -- 0:01:01 883500 -- [-2823.968] (-2830.131) (-2833.789) (-2832.622) * (-2839.708) (-2830.577) (-2841.917) [-2833.361] -- 0:01:01 884000 -- [-2829.168] (-2835.941) (-2833.239) (-2830.968) * (-2833.151) (-2832.783) (-2844.479) [-2826.391] -- 0:01:01 884500 -- (-2827.310) (-2848.518) (-2832.115) [-2831.118] * (-2828.552) (-2828.596) (-2843.233) [-2833.658] -- 0:01:00 885000 -- (-2844.745) (-2834.830) (-2838.166) [-2842.790] * (-2828.265) [-2830.763] (-2846.859) (-2834.841) -- 0:01:00 Average standard deviation of split frequencies: 0.005427 885500 -- (-2843.318) (-2844.192) (-2827.516) [-2830.477] * (-2838.056) [-2829.793] (-2834.767) (-2832.864) -- 0:01:00 886000 -- (-2838.718) (-2834.199) [-2834.470] (-2845.062) * [-2837.006] (-2832.675) (-2837.254) (-2838.973) -- 0:00:59 886500 -- (-2834.027) [-2830.431] (-2831.462) (-2829.658) * [-2834.192] (-2843.463) (-2833.923) (-2849.723) -- 0:00:59 887000 -- (-2840.242) (-2838.547) [-2832.543] (-2839.698) * (-2842.810) (-2827.824) [-2834.605] (-2848.734) -- 0:00:59 887500 -- [-2829.238] (-2840.506) (-2836.318) (-2836.025) * (-2848.585) (-2841.890) [-2830.662] (-2839.073) -- 0:00:59 888000 -- (-2830.492) (-2837.274) [-2833.436] (-2830.811) * [-2830.062] (-2848.896) (-2833.055) (-2839.412) -- 0:00:58 888500 -- (-2841.537) (-2836.620) [-2828.218] (-2826.579) * (-2838.252) (-2837.522) [-2833.064] (-2828.919) -- 0:00:58 889000 -- [-2829.004] (-2840.259) (-2834.014) (-2837.835) * (-2854.481) (-2835.975) [-2827.183] (-2835.701) -- 0:00:58 889500 -- [-2845.544] (-2838.188) (-2836.640) (-2849.985) * [-2838.168] (-2834.570) (-2840.081) (-2834.740) -- 0:00:58 890000 -- (-2830.582) (-2841.869) [-2830.483] (-2845.826) * (-2836.590) (-2830.894) [-2837.194] (-2841.006) -- 0:00:57 Average standard deviation of split frequencies: 0.005081 890500 -- (-2838.433) [-2827.068] (-2832.127) (-2847.126) * (-2836.245) [-2841.528] (-2835.734) (-2842.250) -- 0:00:57 891000 -- (-2851.360) (-2830.481) [-2828.659] (-2842.993) * (-2836.908) (-2841.168) [-2828.719] (-2836.991) -- 0:00:57 891500 -- (-2842.449) (-2832.289) [-2833.448] (-2839.022) * (-2840.458) [-2833.052] (-2825.939) (-2840.954) -- 0:00:57 892000 -- [-2828.100] (-2836.352) (-2839.247) (-2841.391) * (-2833.180) (-2834.864) (-2849.615) [-2833.131] -- 0:00:56 892500 -- (-2844.759) (-2827.736) [-2831.018] (-2832.006) * (-2835.984) (-2833.031) [-2834.760] (-2833.011) -- 0:00:56 893000 -- (-2835.353) [-2829.226] (-2837.687) (-2830.326) * [-2831.546] (-2826.147) (-2831.527) (-2830.323) -- 0:00:56 893500 -- (-2832.560) (-2834.531) [-2834.111] (-2838.703) * (-2829.866) (-2842.429) (-2839.502) [-2829.961] -- 0:00:56 894000 -- (-2836.624) [-2833.098] (-2842.581) (-2840.526) * (-2833.439) (-2854.127) [-2833.370] (-2833.491) -- 0:00:55 894500 -- (-2834.131) (-2830.433) (-2834.738) [-2832.779] * (-2835.954) [-2831.179] (-2837.567) (-2832.780) -- 0:00:55 895000 -- (-2835.713) (-2828.999) [-2830.858] (-2835.918) * (-2831.101) (-2830.651) [-2839.868] (-2835.886) -- 0:00:55 Average standard deviation of split frequencies: 0.004946 895500 -- (-2832.768) [-2827.745] (-2837.088) (-2830.472) * (-2830.831) (-2846.153) (-2837.162) [-2831.699] -- 0:00:54 896000 -- (-2827.771) [-2826.399] (-2833.072) (-2834.675) * (-2838.200) (-2839.023) (-2828.655) [-2834.722] -- 0:00:54 896500 -- (-2832.664) (-2840.318) (-2846.835) [-2832.408] * (-2833.641) (-2835.208) (-2839.804) [-2827.410] -- 0:00:54 897000 -- (-2840.432) [-2833.488] (-2844.094) (-2834.359) * (-2835.897) (-2837.414) [-2829.380] (-2821.683) -- 0:00:54 897500 -- (-2834.041) (-2837.472) [-2835.671] (-2832.302) * (-2843.956) [-2835.909] (-2832.259) (-2840.482) -- 0:00:53 898000 -- (-2830.877) [-2834.121] (-2838.860) (-2843.622) * (-2827.290) (-2834.467) [-2831.223] (-2839.167) -- 0:00:53 898500 -- (-2833.435) [-2829.161] (-2833.778) (-2832.354) * (-2827.764) (-2838.862) [-2830.801] (-2839.859) -- 0:00:53 899000 -- (-2838.900) (-2836.457) (-2834.887) [-2833.685] * (-2828.021) (-2837.832) [-2832.311] (-2830.668) -- 0:00:53 899500 -- (-2831.324) [-2832.776] (-2831.953) (-2838.460) * (-2828.942) (-2835.290) [-2832.494] (-2842.497) -- 0:00:52 900000 -- (-2838.248) (-2830.665) [-2828.296] (-2825.966) * (-2832.041) [-2826.162] (-2833.578) (-2828.676) -- 0:00:52 Average standard deviation of split frequencies: 0.004955 900500 -- (-2837.759) (-2837.626) [-2835.071] (-2837.783) * (-2829.663) [-2833.045] (-2834.874) (-2840.191) -- 0:00:52 901000 -- [-2834.589] (-2832.387) (-2846.503) (-2839.654) * (-2835.865) (-2835.572) [-2832.726] (-2838.821) -- 0:00:51 901500 -- [-2834.068] (-2833.327) (-2842.072) (-2839.715) * (-2833.580) (-2841.870) (-2835.759) [-2837.493] -- 0:00:51 902000 -- [-2837.366] (-2830.105) (-2842.710) (-2833.254) * (-2847.173) [-2829.367] (-2837.458) (-2830.465) -- 0:00:51 902500 -- (-2824.854) [-2838.955] (-2838.295) (-2844.490) * (-2835.046) [-2837.890] (-2824.036) (-2841.634) -- 0:00:51 903000 -- (-2834.419) (-2835.319) (-2833.199) [-2836.228] * [-2828.035] (-2835.967) (-2827.626) (-2835.093) -- 0:00:50 903500 -- (-2836.965) (-2837.778) (-2839.759) [-2838.663] * (-2831.978) (-2832.236) (-2836.923) [-2835.354] -- 0:00:50 904000 -- [-2828.355] (-2831.510) (-2850.795) (-2837.694) * [-2834.876] (-2836.813) (-2837.848) (-2837.244) -- 0:00:50 904500 -- (-2826.068) (-2833.663) [-2839.483] (-2839.004) * (-2831.818) (-2839.272) (-2839.381) [-2837.906] -- 0:00:50 905000 -- (-2830.368) (-2857.283) [-2838.435] (-2830.137) * [-2829.290] (-2849.861) (-2841.216) (-2830.087) -- 0:00:49 Average standard deviation of split frequencies: 0.004718 905500 -- (-2840.968) (-2835.522) [-2829.900] (-2843.065) * (-2831.899) (-2844.535) [-2841.832] (-2837.981) -- 0:00:49 906000 -- [-2830.572] (-2836.053) (-2829.231) (-2838.545) * (-2826.615) [-2831.304] (-2836.132) (-2837.304) -- 0:00:49 906500 -- [-2829.327] (-2829.866) (-2832.932) (-2841.686) * [-2832.922] (-2837.708) (-2851.230) (-2842.339) -- 0:00:49 907000 -- [-2826.204] (-2829.224) (-2832.249) (-2830.989) * (-2839.414) (-2828.760) (-2847.018) [-2835.290] -- 0:00:48 907500 -- (-2840.985) (-2830.063) [-2829.644] (-2833.149) * (-2847.090) (-2830.437) (-2842.134) [-2825.509] -- 0:00:48 908000 -- (-2831.570) [-2832.602] (-2839.853) (-2826.410) * (-2845.047) (-2831.247) [-2825.890] (-2837.412) -- 0:00:48 908500 -- (-2834.232) [-2833.661] (-2851.753) (-2837.203) * (-2835.354) (-2839.649) [-2826.281] (-2837.108) -- 0:00:48 909000 -- (-2842.804) (-2845.485) (-2852.629) [-2839.308] * (-2827.239) [-2828.350] (-2840.651) (-2835.539) -- 0:00:47 909500 -- (-2839.228) (-2829.252) [-2844.815] (-2838.401) * (-2832.615) [-2829.950] (-2833.849) (-2836.853) -- 0:00:47 910000 -- (-2833.948) [-2829.954] (-2840.235) (-2850.508) * (-2842.483) [-2834.724] (-2835.266) (-2831.464) -- 0:00:47 Average standard deviation of split frequencies: 0.004590 910500 -- (-2838.219) [-2827.294] (-2837.360) (-2836.348) * [-2833.246] (-2828.196) (-2840.323) (-2848.126) -- 0:00:46 911000 -- (-2842.867) (-2831.122) [-2831.754] (-2833.647) * (-2839.310) [-2829.539] (-2841.312) (-2834.595) -- 0:00:46 911500 -- [-2836.759] (-2829.880) (-2837.313) (-2843.806) * (-2829.596) [-2827.960] (-2836.478) (-2838.475) -- 0:00:46 912000 -- (-2833.041) (-2830.551) [-2827.113] (-2839.040) * (-2834.256) (-2829.132) [-2825.781] (-2838.831) -- 0:00:46 912500 -- (-2840.434) [-2830.233] (-2823.848) (-2836.893) * (-2831.508) (-2830.510) (-2844.415) [-2825.996] -- 0:00:45 913000 -- (-2838.989) (-2828.312) (-2828.063) [-2837.044] * [-2834.694] (-2829.789) (-2832.940) (-2835.656) -- 0:00:45 913500 -- (-2828.747) [-2836.506] (-2833.926) (-2832.159) * (-2835.748) (-2827.444) (-2837.943) [-2832.993] -- 0:00:45 914000 -- [-2833.706] (-2834.648) (-2837.961) (-2833.020) * (-2835.967) [-2830.766] (-2841.121) (-2839.670) -- 0:00:45 914500 -- (-2827.842) (-2842.153) (-2841.487) [-2832.507] * (-2829.483) (-2830.645) [-2834.265] (-2832.218) -- 0:00:44 915000 -- (-2832.812) [-2832.293] (-2837.809) (-2827.946) * (-2831.572) (-2836.856) [-2831.086] (-2833.321) -- 0:00:44 Average standard deviation of split frequencies: 0.004597 915500 -- (-2837.714) (-2846.358) (-2834.730) [-2835.646] * [-2831.233] (-2831.898) (-2829.421) (-2834.000) -- 0:00:44 916000 -- [-2834.046] (-2846.093) (-2835.431) (-2841.889) * (-2839.644) (-2841.145) [-2830.749] (-2835.257) -- 0:00:44 916500 -- (-2835.975) [-2827.496] (-2823.020) (-2834.115) * (-2847.692) (-2836.096) (-2840.562) [-2837.592] -- 0:00:43 917000 -- (-2837.824) (-2831.103) (-2845.868) [-2830.262] * (-2830.529) [-2829.173] (-2827.497) (-2831.006) -- 0:00:43 917500 -- (-2832.069) [-2832.443] (-2843.685) (-2838.418) * (-2838.926) (-2830.790) [-2829.537] (-2827.934) -- 0:00:43 918000 -- (-2835.633) (-2837.564) (-2834.853) [-2839.189] * (-2834.386) [-2830.392] (-2840.710) (-2831.907) -- 0:00:43 918500 -- [-2829.508] (-2828.951) (-2836.741) (-2839.353) * (-2838.543) [-2827.040] (-2837.982) (-2833.120) -- 0:00:42 919000 -- (-2840.214) (-2832.830) [-2838.110] (-2837.866) * (-2840.415) (-2832.210) (-2847.171) [-2837.083] -- 0:00:42 919500 -- [-2829.085] (-2832.973) (-2835.531) (-2824.885) * (-2838.930) [-2831.163] (-2838.434) (-2834.844) -- 0:00:42 920000 -- (-2828.746) (-2831.016) (-2832.678) [-2825.195] * (-2838.797) (-2834.604) [-2832.009] (-2832.649) -- 0:00:42 Average standard deviation of split frequencies: 0.004574 920500 -- (-2833.532) (-2830.241) [-2830.733] (-2825.637) * (-2830.854) (-2837.029) (-2838.714) [-2837.245] -- 0:00:41 921000 -- (-2834.522) (-2829.933) [-2833.728] (-2839.312) * [-2827.278] (-2834.795) (-2832.837) (-2839.913) -- 0:00:41 921500 -- (-2829.305) (-2841.190) (-2844.457) [-2833.141] * (-2841.667) (-2828.710) [-2828.570] (-2846.188) -- 0:00:41 922000 -- [-2828.578] (-2833.649) (-2832.068) (-2831.441) * [-2830.854] (-2829.414) (-2827.641) (-2842.165) -- 0:00:40 922500 -- (-2836.349) [-2830.564] (-2832.052) (-2830.070) * [-2832.170] (-2832.005) (-2835.932) (-2852.790) -- 0:00:40 923000 -- (-2840.787) (-2831.416) (-2836.333) [-2831.309] * (-2831.193) (-2839.825) (-2834.510) [-2845.761] -- 0:00:40 923500 -- (-2830.042) (-2829.914) [-2828.602] (-2837.536) * (-2836.340) [-2830.408] (-2831.676) (-2842.610) -- 0:00:40 924000 -- (-2836.203) (-2831.095) [-2831.154] (-2843.525) * (-2829.460) (-2833.677) (-2832.122) [-2837.279] -- 0:00:39 924500 -- [-2832.263] (-2840.101) (-2838.594) (-2841.797) * (-2836.146) [-2827.643] (-2832.510) (-2835.299) -- 0:00:39 925000 -- (-2833.919) (-2838.661) [-2837.872] (-2839.242) * (-2842.646) (-2830.781) [-2832.786] (-2831.941) -- 0:00:39 Average standard deviation of split frequencies: 0.004717 925500 -- (-2843.776) (-2834.022) (-2846.537) [-2840.918] * (-2837.010) (-2843.099) (-2842.019) [-2829.143] -- 0:00:39 926000 -- (-2840.861) [-2824.948] (-2845.180) (-2831.244) * (-2842.524) (-2835.808) [-2835.687] (-2831.728) -- 0:00:38 926500 -- (-2840.660) (-2828.898) (-2836.962) [-2827.957] * [-2832.360] (-2837.628) (-2832.739) (-2828.083) -- 0:00:38 927000 -- (-2838.088) (-2843.403) (-2835.956) [-2832.858] * (-2834.691) (-2841.763) [-2841.717] (-2830.480) -- 0:00:38 927500 -- [-2835.843] (-2834.931) (-2830.744) (-2838.016) * (-2837.369) (-2834.417) (-2829.936) [-2827.280] -- 0:00:38 928000 -- [-2832.145] (-2828.724) (-2845.926) (-2840.540) * (-2832.656) (-2834.076) (-2843.557) [-2834.563] -- 0:00:37 928500 -- (-2854.701) [-2835.038] (-2826.950) (-2832.773) * (-2833.046) [-2831.462] (-2836.575) (-2834.420) -- 0:00:37 929000 -- [-2833.422] (-2827.708) (-2839.473) (-2837.392) * (-2835.060) (-2844.164) [-2827.562] (-2836.909) -- 0:00:37 929500 -- (-2838.676) (-2837.457) (-2828.518) [-2830.898] * (-2834.267) (-2836.102) (-2836.788) [-2832.080] -- 0:00:37 930000 -- [-2827.682] (-2843.195) (-2833.970) (-2838.855) * (-2840.186) (-2837.872) (-2843.621) [-2827.568] -- 0:00:36 Average standard deviation of split frequencies: 0.004626 930500 -- (-2826.881) (-2846.532) (-2830.133) [-2827.576] * (-2837.398) [-2830.418] (-2834.287) (-2829.744) -- 0:00:36 931000 -- (-2829.317) (-2851.349) [-2829.060] (-2836.334) * (-2836.449) (-2828.626) (-2842.814) [-2833.744] -- 0:00:36 931500 -- [-2832.295] (-2834.281) (-2836.380) (-2834.856) * (-2842.015) (-2836.806) (-2838.759) [-2827.436] -- 0:00:35 932000 -- (-2839.535) [-2833.066] (-2836.670) (-2848.751) * (-2841.148) (-2836.937) (-2835.495) [-2834.529] -- 0:00:35 932500 -- (-2844.042) (-2839.525) [-2839.462] (-2835.769) * (-2836.375) (-2839.732) [-2827.535] (-2854.630) -- 0:00:35 933000 -- (-2849.985) [-2830.074] (-2842.707) (-2850.915) * (-2839.217) [-2833.573] (-2835.813) (-2836.554) -- 0:00:35 933500 -- (-2839.099) [-2830.391] (-2837.297) (-2844.435) * (-2843.241) (-2835.222) (-2838.005) [-2832.870] -- 0:00:34 934000 -- (-2834.247) (-2828.329) [-2826.134] (-2847.434) * (-2843.581) (-2826.596) [-2829.512] (-2831.931) -- 0:00:34 934500 -- (-2845.752) (-2839.926) (-2848.516) [-2832.207] * (-2846.813) (-2829.015) (-2838.869) [-2830.217] -- 0:00:34 935000 -- (-2836.352) (-2834.187) (-2845.866) [-2837.108] * [-2833.551] (-2836.142) (-2832.742) (-2830.697) -- 0:00:34 Average standard deviation of split frequencies: 0.004533 935500 -- (-2841.851) (-2838.174) (-2836.729) [-2834.158] * (-2839.142) (-2830.254) [-2838.609] (-2843.923) -- 0:00:33 936000 -- (-2835.513) (-2825.320) [-2828.818] (-2845.019) * (-2837.435) (-2840.989) [-2829.872] (-2833.645) -- 0:00:33 936500 -- (-2844.634) [-2830.968] (-2830.227) (-2837.516) * (-2832.882) [-2839.038] (-2834.657) (-2835.912) -- 0:00:33 937000 -- (-2834.594) (-2837.305) [-2840.558] (-2841.401) * [-2837.133] (-2837.774) (-2833.897) (-2832.652) -- 0:00:33 937500 -- [-2832.451] (-2840.174) (-2827.856) (-2837.253) * (-2831.938) (-2842.293) [-2827.104] (-2829.783) -- 0:00:32 938000 -- (-2834.654) [-2844.737] (-2840.020) (-2845.211) * (-2838.055) [-2836.282] (-2830.860) (-2832.735) -- 0:00:32 938500 -- (-2850.215) (-2844.199) [-2831.256] (-2843.548) * [-2835.824] (-2845.385) (-2828.522) (-2832.006) -- 0:00:32 939000 -- (-2853.303) [-2839.128] (-2830.246) (-2838.370) * [-2829.430] (-2826.965) (-2829.261) (-2831.323) -- 0:00:32 939500 -- (-2834.448) (-2848.297) [-2832.064] (-2846.544) * (-2842.978) (-2838.431) (-2842.967) [-2838.394] -- 0:00:31 940000 -- [-2826.871] (-2834.594) (-2825.164) (-2837.919) * (-2832.767) [-2825.774] (-2830.535) (-2835.114) -- 0:00:31 Average standard deviation of split frequencies: 0.004343 940500 -- (-2830.557) (-2835.712) [-2833.278] (-2848.537) * (-2834.560) (-2837.235) [-2836.348] (-2833.763) -- 0:00:31 941000 -- (-2830.871) (-2852.113) (-2838.904) [-2827.939] * [-2831.244] (-2835.939) (-2839.055) (-2829.589) -- 0:00:30 941500 -- [-2827.835] (-2844.992) (-2829.955) (-2837.383) * [-2831.910] (-2834.767) (-2836.549) (-2839.863) -- 0:00:30 942000 -- (-2832.663) (-2828.898) [-2830.569] (-2835.809) * (-2830.719) [-2833.615] (-2838.179) (-2834.880) -- 0:00:30 942500 -- (-2823.997) (-2845.926) [-2835.941] (-2834.486) * (-2830.093) [-2833.248] (-2836.086) (-2837.983) -- 0:00:30 943000 -- (-2828.445) (-2848.688) [-2840.964] (-2835.253) * (-2828.598) (-2836.736) [-2827.673] (-2852.479) -- 0:00:29 943500 -- (-2830.407) [-2835.853] (-2833.491) (-2839.268) * (-2828.850) [-2836.616] (-2828.303) (-2849.657) -- 0:00:29 944000 -- (-2834.852) (-2838.530) [-2835.707] (-2833.850) * (-2829.661) [-2833.388] (-2852.508) (-2829.869) -- 0:00:29 944500 -- (-2831.704) (-2832.165) [-2834.741] (-2831.031) * (-2835.506) [-2827.121] (-2833.796) (-2842.751) -- 0:00:29 945000 -- (-2837.231) (-2832.352) (-2838.579) [-2832.576] * [-2844.150] (-2835.466) (-2839.436) (-2839.038) -- 0:00:28 Average standard deviation of split frequencies: 0.004717 945500 -- (-2835.184) [-2835.162] (-2839.788) (-2831.127) * (-2838.329) [-2832.576] (-2841.203) (-2832.928) -- 0:00:28 946000 -- (-2832.936) [-2845.754] (-2836.655) (-2833.147) * (-2839.823) (-2829.207) (-2832.248) [-2827.021] -- 0:00:28 946500 -- (-2842.353) (-2847.605) [-2836.924] (-2834.767) * (-2834.205) (-2838.231) (-2841.499) [-2833.755] -- 0:00:28 947000 -- (-2834.884) [-2841.928] (-2838.731) (-2831.985) * (-2830.938) [-2833.205] (-2832.329) (-2839.120) -- 0:00:27 947500 -- [-2834.075] (-2843.401) (-2835.871) (-2834.246) * [-2830.924] (-2845.583) (-2842.819) (-2833.663) -- 0:00:27 948000 -- (-2839.190) (-2845.593) (-2835.176) [-2827.805] * (-2838.268) (-2842.741) (-2838.533) [-2836.127] -- 0:00:27 948500 -- (-2833.943) (-2838.807) (-2832.379) [-2835.153] * [-2832.397] (-2837.561) (-2836.043) (-2834.871) -- 0:00:26 949000 -- (-2835.517) (-2839.451) [-2834.233] (-2830.682) * (-2835.945) [-2833.446] (-2838.200) (-2837.501) -- 0:00:26 949500 -- (-2826.351) (-2840.902) (-2847.732) [-2832.736] * [-2834.685] (-2832.484) (-2836.477) (-2834.509) -- 0:00:26 950000 -- (-2839.577) (-2835.011) [-2828.507] (-2829.291) * (-2840.173) [-2830.667] (-2834.767) (-2846.339) -- 0:00:26 Average standard deviation of split frequencies: 0.004826 950500 -- (-2831.316) [-2830.761] (-2826.164) (-2830.187) * (-2832.400) (-2828.063) [-2825.296] (-2847.650) -- 0:00:25 951000 -- (-2835.279) (-2828.304) [-2830.904] (-2843.306) * (-2831.497) (-2830.572) [-2832.281] (-2832.231) -- 0:00:25 951500 -- (-2842.637) [-2836.531] (-2846.842) (-2842.383) * (-2852.344) [-2833.110] (-2834.100) (-2836.049) -- 0:00:25 952000 -- (-2839.953) (-2835.003) [-2842.071] (-2840.468) * (-2837.402) [-2825.072] (-2837.777) (-2838.467) -- 0:00:25 952500 -- [-2828.221] (-2844.431) (-2835.000) (-2831.149) * (-2843.235) (-2828.211) (-2838.138) [-2842.415] -- 0:00:24 953000 -- (-2839.851) (-2830.652) (-2824.701) [-2829.687] * [-2832.875] (-2837.743) (-2831.642) (-2841.165) -- 0:00:24 953500 -- (-2832.802) (-2828.174) [-2821.422] (-2843.078) * (-2843.825) [-2833.041] (-2830.579) (-2840.921) -- 0:00:24 954000 -- (-2838.160) [-2833.970] (-2829.270) (-2841.172) * (-2831.368) [-2835.335] (-2831.864) (-2834.095) -- 0:00:24 954500 -- (-2839.408) (-2831.999) (-2837.939) [-2828.663] * [-2833.828] (-2837.060) (-2833.012) (-2842.832) -- 0:00:23 955000 -- (-2836.313) (-2847.259) (-2827.839) [-2830.990] * (-2836.330) [-2835.377] (-2837.038) (-2844.376) -- 0:00:23 Average standard deviation of split frequencies: 0.004306 955500 -- (-2841.892) (-2837.844) [-2830.651] (-2829.323) * (-2845.660) [-2839.606] (-2833.175) (-2834.822) -- 0:00:23 956000 -- (-2830.461) (-2833.898) (-2826.366) [-2832.176] * (-2840.571) (-2830.418) [-2832.673] (-2837.719) -- 0:00:23 956500 -- (-2840.339) [-2841.307] (-2834.699) (-2831.775) * (-2839.250) [-2827.287] (-2830.308) (-2840.851) -- 0:00:22 957000 -- (-2834.445) (-2842.118) (-2826.709) [-2837.409] * (-2835.978) (-2829.118) [-2838.862] (-2825.067) -- 0:00:22 957500 -- (-2835.756) (-2834.824) [-2831.287] (-2825.473) * (-2837.918) (-2831.881) [-2829.140] (-2840.455) -- 0:00:22 958000 -- (-2834.400) [-2828.388] (-2826.518) (-2835.206) * (-2836.749) (-2834.492) [-2829.416] (-2839.189) -- 0:00:22 958500 -- [-2828.485] (-2832.975) (-2829.531) (-2836.341) * (-2837.084) [-2831.986] (-2847.003) (-2840.839) -- 0:00:21 959000 -- [-2831.274] (-2841.587) (-2832.443) (-2837.726) * (-2837.148) (-2831.500) [-2840.927] (-2835.250) -- 0:00:21 959500 -- (-2834.409) (-2842.114) (-2831.546) [-2836.455] * [-2830.686] (-2841.875) (-2841.274) (-2838.739) -- 0:00:21 960000 -- (-2835.774) (-2845.721) (-2833.658) [-2834.466] * (-2828.461) [-2837.144] (-2842.378) (-2842.487) -- 0:00:20 Average standard deviation of split frequencies: 0.004416 960500 -- (-2841.028) [-2830.831] (-2832.975) (-2832.549) * [-2825.281] (-2832.454) (-2831.739) (-2833.852) -- 0:00:20 961000 -- [-2836.568] (-2840.112) (-2830.784) (-2831.479) * [-2831.507] (-2832.242) (-2844.298) (-2833.293) -- 0:00:20 961500 -- (-2834.097) (-2836.155) [-2825.675] (-2835.308) * (-2839.830) [-2826.329] (-2841.452) (-2833.296) -- 0:00:20 962000 -- (-2843.488) (-2827.140) (-2839.556) [-2835.699] * (-2826.634) (-2826.699) [-2835.043] (-2846.644) -- 0:00:19 962500 -- (-2847.480) [-2830.081] (-2849.347) (-2838.506) * [-2832.671] (-2835.876) (-2832.801) (-2839.190) -- 0:00:19 963000 -- (-2838.514) [-2838.244] (-2837.887) (-2845.035) * (-2836.292) (-2831.538) [-2828.924] (-2851.218) -- 0:00:19 963500 -- (-2839.332) [-2830.386] (-2831.010) (-2831.368) * [-2826.348] (-2835.901) (-2838.199) (-2845.326) -- 0:00:19 964000 -- (-2840.455) (-2836.867) (-2837.127) [-2829.513] * (-2853.954) (-2840.686) [-2834.686] (-2839.553) -- 0:00:18 964500 -- [-2828.849] (-2837.406) (-2833.505) (-2840.575) * [-2833.596] (-2847.438) (-2841.562) (-2832.595) -- 0:00:18 965000 -- (-2838.343) (-2838.222) (-2834.572) [-2835.817] * (-2833.030) (-2841.463) (-2835.212) [-2839.043] -- 0:00:18 Average standard deviation of split frequencies: 0.004099 965500 -- (-2839.423) (-2837.854) [-2827.937] (-2830.267) * [-2828.545] (-2830.670) (-2835.711) (-2838.554) -- 0:00:18 966000 -- [-2833.400] (-2836.638) (-2831.373) (-2829.736) * (-2833.195) (-2837.821) (-2838.878) [-2826.914] -- 0:00:17 966500 -- [-2836.901] (-2838.498) (-2835.427) (-2829.504) * (-2845.777) [-2836.613] (-2833.809) (-2835.884) -- 0:00:17 967000 -- (-2832.816) (-2837.546) [-2839.498] (-2829.813) * (-2830.305) (-2832.651) (-2838.821) [-2833.273] -- 0:00:17 967500 -- [-2839.642] (-2831.029) (-2828.095) (-2843.145) * (-2836.958) [-2833.768] (-2840.822) (-2842.570) -- 0:00:17 968000 -- [-2834.533] (-2833.940) (-2839.188) (-2833.158) * (-2830.922) [-2832.931] (-2830.181) (-2841.447) -- 0:00:16 968500 -- [-2832.469] (-2832.187) (-2836.194) (-2836.503) * [-2841.179] (-2834.423) (-2838.524) (-2833.337) -- 0:00:16 969000 -- [-2845.016] (-2829.995) (-2833.551) (-2830.238) * (-2827.700) (-2838.306) (-2831.961) [-2829.037] -- 0:00:16 969500 -- (-2851.617) (-2827.651) [-2835.094] (-2840.062) * (-2836.831) (-2834.286) (-2843.258) [-2835.188] -- 0:00:15 970000 -- (-2835.415) (-2835.530) [-2841.049] (-2826.996) * (-2835.213) (-2835.236) [-2831.561] (-2832.996) -- 0:00:15 Average standard deviation of split frequencies: 0.004533 970500 -- [-2829.993] (-2828.919) (-2834.811) (-2835.226) * [-2831.796] (-2826.808) (-2845.410) (-2839.951) -- 0:00:15 971000 -- (-2834.916) (-2839.976) (-2842.117) [-2834.865] * (-2837.882) [-2827.889] (-2843.018) (-2830.287) -- 0:00:15 971500 -- (-2839.678) (-2835.824) (-2836.863) [-2832.080] * (-2845.640) (-2828.323) [-2834.625] (-2831.542) -- 0:00:14 972000 -- (-2833.538) (-2833.154) (-2839.712) [-2833.687] * (-2835.150) [-2836.552] (-2836.312) (-2835.320) -- 0:00:14 972500 -- (-2832.816) (-2832.852) (-2847.316) [-2834.537] * (-2834.620) (-2838.199) [-2835.179] (-2831.287) -- 0:00:14 973000 -- (-2849.259) [-2840.181] (-2829.493) (-2841.494) * (-2829.005) (-2837.140) [-2830.240] (-2830.573) -- 0:00:14 973500 -- [-2829.546] (-2831.490) (-2831.887) (-2835.300) * (-2833.037) (-2836.783) [-2827.703] (-2826.109) -- 0:00:13 974000 -- [-2826.487] (-2833.427) (-2838.951) (-2833.482) * [-2843.984] (-2839.944) (-2831.258) (-2835.795) -- 0:00:13 974500 -- (-2833.916) (-2845.357) [-2835.002] (-2833.119) * (-2823.335) [-2837.474] (-2836.089) (-2833.996) -- 0:00:13 975000 -- (-2836.107) (-2842.517) [-2832.029] (-2837.493) * (-2835.471) (-2831.732) (-2833.892) [-2837.401] -- 0:00:13 Average standard deviation of split frequencies: 0.004637 975500 -- [-2831.080] (-2830.181) (-2841.668) (-2837.089) * (-2837.910) [-2825.496] (-2836.369) (-2843.550) -- 0:00:12 976000 -- [-2833.284] (-2837.783) (-2831.357) (-2847.305) * (-2841.776) (-2842.200) (-2827.674) [-2834.392] -- 0:00:12 976500 -- (-2838.854) (-2836.257) (-2841.187) [-2828.811] * (-2845.835) [-2828.508] (-2830.748) (-2835.400) -- 0:00:12 977000 -- [-2835.418] (-2836.791) (-2834.947) (-2828.394) * (-2839.346) (-2832.884) [-2834.274] (-2836.281) -- 0:00:12 977500 -- (-2832.997) (-2842.380) [-2830.068] (-2834.496) * (-2840.036) (-2829.015) [-2834.704] (-2836.085) -- 0:00:11 978000 -- (-2825.524) (-2840.965) [-2828.520] (-2838.569) * (-2838.371) (-2839.629) (-2837.966) [-2831.129] -- 0:00:11 978500 -- (-2836.925) [-2839.517] (-2837.524) (-2840.586) * (-2842.787) (-2838.289) (-2841.187) [-2831.594] -- 0:00:11 979000 -- (-2832.574) (-2835.836) [-2831.067] (-2847.698) * (-2842.461) (-2843.268) [-2837.841] (-2832.577) -- 0:00:11 979500 -- (-2831.731) [-2827.508] (-2826.296) (-2836.074) * (-2840.923) (-2829.953) [-2831.628] (-2835.174) -- 0:00:10 980000 -- [-2829.333] (-2836.408) (-2839.838) (-2838.831) * (-2844.803) [-2823.330] (-2836.358) (-2834.601) -- 0:00:10 Average standard deviation of split frequencies: 0.005031 980500 -- (-2845.349) [-2847.874] (-2832.409) (-2836.287) * [-2823.440] (-2834.653) (-2834.818) (-2845.635) -- 0:00:10 981000 -- (-2838.426) (-2838.215) [-2826.723] (-2826.269) * [-2831.352] (-2827.429) (-2836.385) (-2840.152) -- 0:00:09 981500 -- [-2837.630] (-2832.809) (-2828.770) (-2827.256) * [-2832.738] (-2832.675) (-2827.587) (-2838.012) -- 0:00:09 982000 -- (-2836.269) (-2841.632) (-2841.918) [-2825.941] * (-2829.526) [-2829.557] (-2832.317) (-2835.962) -- 0:00:09 982500 -- (-2846.833) (-2847.343) [-2840.533] (-2838.237) * (-2840.222) (-2823.000) (-2843.056) [-2826.658] -- 0:00:09 983000 -- (-2838.277) (-2838.885) (-2836.683) [-2833.632] * (-2839.724) (-2827.307) (-2842.052) [-2836.884] -- 0:00:08 983500 -- [-2839.726] (-2834.223) (-2840.150) (-2833.923) * (-2838.184) (-2841.775) (-2838.338) [-2835.224] -- 0:00:08 984000 -- (-2831.856) (-2834.104) (-2840.562) [-2833.791] * [-2832.519] (-2844.823) (-2829.523) (-2843.995) -- 0:00:08 984500 -- (-2829.457) (-2833.768) (-2839.603) [-2828.326] * (-2832.242) (-2842.366) (-2855.974) [-2827.423] -- 0:00:08 985000 -- (-2837.934) (-2828.725) [-2834.109] (-2844.068) * (-2845.871) (-2837.159) (-2833.272) [-2832.963] -- 0:00:07 Average standard deviation of split frequencies: 0.004940 985500 -- (-2830.552) (-2831.182) (-2828.712) [-2831.422] * (-2831.380) (-2844.551) (-2839.825) [-2833.201] -- 0:00:07 986000 -- (-2835.713) [-2838.900] (-2848.708) (-2841.197) * (-2836.120) [-2837.642] (-2832.616) (-2838.947) -- 0:00:07 986500 -- [-2842.484] (-2835.780) (-2832.662) (-2836.873) * (-2839.983) (-2841.427) [-2832.409] (-2836.602) -- 0:00:07 987000 -- [-2837.033] (-2845.798) (-2835.377) (-2844.762) * (-2836.145) (-2831.005) (-2835.502) [-2833.171] -- 0:00:06 987500 -- (-2827.073) (-2837.703) (-2833.135) [-2835.977] * (-2836.469) [-2832.303] (-2848.687) (-2828.327) -- 0:00:06 988000 -- (-2829.776) (-2845.751) (-2831.573) [-2833.826] * [-2833.228] (-2835.934) (-2841.586) (-2831.420) -- 0:00:06 988500 -- (-2835.457) (-2838.243) (-2834.240) [-2832.867] * (-2833.332) (-2839.542) (-2845.420) [-2841.277] -- 0:00:06 989000 -- (-2837.474) [-2830.933] (-2848.401) (-2833.042) * [-2829.411] (-2831.951) (-2829.604) (-2837.959) -- 0:00:05 989500 -- (-2829.674) [-2833.436] (-2840.945) (-2829.027) * (-2834.796) (-2839.445) [-2832.951] (-2827.820) -- 0:00:05 990000 -- (-2840.059) (-2836.317) (-2830.541) [-2827.267] * (-2840.594) (-2826.849) (-2829.469) [-2831.780] -- 0:00:05 Average standard deviation of split frequencies: 0.004695 990500 -- (-2833.799) [-2828.781] (-2828.681) (-2846.256) * (-2833.026) [-2836.673] (-2846.953) (-2850.206) -- 0:00:04 991000 -- [-2843.246] (-2835.580) (-2838.049) (-2834.484) * (-2837.358) (-2831.976) [-2831.618] (-2829.332) -- 0:00:04 991500 -- [-2839.072] (-2834.373) (-2840.431) (-2838.865) * (-2843.685) (-2835.993) [-2831.536] (-2835.908) -- 0:00:04 992000 -- (-2837.901) (-2837.834) [-2841.402] (-2836.598) * [-2843.902] (-2830.641) (-2839.299) (-2831.919) -- 0:00:04 992500 -- (-2831.048) [-2828.248] (-2854.921) (-2838.293) * (-2837.402) (-2831.404) (-2834.478) [-2830.653] -- 0:00:03 993000 -- (-2838.449) (-2834.375) [-2844.119] (-2833.423) * (-2830.270) (-2830.900) [-2837.622] (-2824.002) -- 0:00:03 993500 -- (-2830.429) (-2840.320) (-2847.851) [-2830.100] * [-2833.115] (-2838.037) (-2833.207) (-2828.844) -- 0:00:03 994000 -- [-2831.387] (-2839.483) (-2829.221) (-2839.079) * (-2844.425) [-2831.144] (-2830.987) (-2830.196) -- 0:00:03 994500 -- (-2840.012) [-2835.156] (-2833.124) (-2831.778) * (-2842.921) (-2833.025) (-2837.559) [-2831.310] -- 0:00:02 995000 -- (-2830.823) (-2834.444) (-2846.545) [-2827.025] * (-2831.214) [-2831.992] (-2832.342) (-2834.866) -- 0:00:02 Average standard deviation of split frequencies: 0.004260 995500 -- [-2835.611] (-2855.532) (-2825.146) (-2834.171) * (-2837.258) (-2841.076) (-2833.760) [-2825.428] -- 0:00:02 996000 -- (-2834.604) (-2835.367) [-2829.586] (-2834.212) * (-2829.376) (-2845.895) (-2837.823) [-2832.282] -- 0:00:02 996500 -- (-2837.794) [-2838.961] (-2832.200) (-2830.894) * (-2838.569) (-2836.383) (-2829.734) [-2826.395] -- 0:00:01 997000 -- (-2835.370) (-2855.098) (-2832.940) [-2825.454] * [-2831.798] (-2838.189) (-2834.506) (-2831.397) -- 0:00:01 997500 -- (-2830.809) (-2833.106) [-2840.353] (-2826.532) * (-2838.760) (-2836.852) (-2844.597) [-2822.356] -- 0:00:01 998000 -- (-2835.298) (-2837.400) (-2834.561) [-2831.028] * (-2841.957) (-2842.048) [-2832.702] (-2838.209) -- 0:00:01 998500 -- [-2830.668] (-2838.635) (-2836.035) (-2842.962) * (-2829.876) [-2832.964] (-2831.925) (-2843.133) -- 0:00:00 999000 -- (-2834.786) (-2837.070) (-2829.887) [-2830.696] * (-2827.191) (-2844.733) (-2832.038) [-2836.858] -- 0:00:00 999500 -- (-2847.338) (-2827.829) (-2847.378) [-2829.108] * (-2836.754) (-2840.750) (-2847.780) [-2837.044] -- 0:00:00 1000000 -- (-2842.299) (-2837.626) (-2845.190) [-2828.321] * (-2843.236) (-2838.573) [-2831.040] (-2829.472) -- 0:00:00 Average standard deviation of split frequencies: 0.003675 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2842.298529 -- 17.984514 Chain 1 -- -2842.298533 -- 17.984514 Chain 2 -- -2837.625978 -- 18.734377 Chain 2 -- -2837.625983 -- 18.734377 Chain 3 -- -2845.189751 -- 20.060791 Chain 3 -- -2845.189791 -- 20.060791 Chain 4 -- -2828.321232 -- 20.285819 Chain 4 -- -2828.321225 -- 20.285819 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2843.236495 -- 21.189786 Chain 1 -- -2843.236479 -- 21.189786 Chain 2 -- -2838.573381 -- 18.312947 Chain 2 -- -2838.573381 -- 18.312947 Chain 3 -- -2831.039573 -- 22.215444 Chain 3 -- -2831.039570 -- 22.215444 Chain 4 -- -2829.472199 -- 14.047585 Chain 4 -- -2829.472196 -- 14.047585 Analysis completed in 8 mins 43 seconds Analysis used 523.22 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2819.24 Likelihood of best state for "cold" chain of run 2 was -2819.24 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 37.6 % ( 29 %) Dirichlet(Revmat{all}) 57.0 % ( 37 %) Slider(Revmat{all}) 25.0 % ( 23 %) Dirichlet(Pi{all}) 27.3 % ( 38 %) Slider(Pi{all}) 28.2 % ( 30 %) Multiplier(Alpha{1,2}) 40.4 % ( 19 %) Multiplier(Alpha{3}) 43.3 % ( 24 %) Slider(Pinvar{all}) 17.8 % ( 21 %) ExtSPR(Tau{all},V{all}) 5.5 % ( 6 %) ExtTBR(Tau{all},V{all}) 24.0 % ( 19 %) NNI(Tau{all},V{all}) 23.5 % ( 24 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 27 %) Multiplier(V{all}) 33.8 % ( 40 %) Nodeslider(V{all}) 25.3 % ( 30 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 37.9 % ( 27 %) Dirichlet(Revmat{all}) 54.9 % ( 47 %) Slider(Revmat{all}) 25.1 % ( 24 %) Dirichlet(Pi{all}) 27.0 % ( 25 %) Slider(Pi{all}) 28.1 % ( 33 %) Multiplier(Alpha{1,2}) 40.3 % ( 26 %) Multiplier(Alpha{3}) 43.3 % ( 25 %) Slider(Pinvar{all}) 17.5 % ( 14 %) ExtSPR(Tau{all},V{all}) 5.6 % ( 4 %) ExtTBR(Tau{all},V{all}) 23.6 % ( 27 %) NNI(Tau{all},V{all}) 23.5 % ( 20 %) ParsSPR(Tau{all},V{all}) 26.2 % ( 25 %) Multiplier(V{all}) 34.0 % ( 29 %) Nodeslider(V{all}) 25.3 % ( 23 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.76 0.55 0.39 2 | 166978 0.77 0.58 3 | 166613 167280 0.79 4 | 166469 166098 166562 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.76 0.55 0.39 2 | 167194 0.78 0.59 3 | 167216 166389 0.79 4 | 166953 166089 166159 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2830.50 |2 1 | | 2 | | 2 | | 1 1 22 2 * 12 | | 2 1 2 2 2 | | 1 1 1 21 2 1 1 * 1 | | 1 2 122 11 1 2 2 1* * 2 | |1 2 1 11 11 2 2 2 2 2 2 2| | 2 222 1 1 2 2 21 2 1| | *1 2 222 11 2 11 1 2 2 12 1 | | 1 21 2 22 1 2 2 1 111 *21 1 | | 1 1 1 1 | | 2 1 2 1 | | * 1 1 | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2835.06 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2826.99 -2847.09 2 -2826.03 -2842.39 -------------------------------------- TOTAL -2826.40 -2846.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.006019 0.009274 0.811624 1.189277 1.004319 1476.02 1488.51 1.000 r(A<->C){all} 0.092153 0.000337 0.058252 0.128712 0.091092 747.90 922.65 1.000 r(A<->G){all} 0.171612 0.000763 0.117693 0.224880 0.170491 950.21 980.21 1.000 r(A<->T){all} 0.081748 0.000654 0.036707 0.131569 0.079744 703.63 764.41 1.000 r(C<->G){all} 0.071254 0.000184 0.047356 0.099208 0.070426 1128.76 1201.33 1.000 r(C<->T){all} 0.488384 0.001558 0.416168 0.567437 0.487702 911.30 941.30 1.001 r(G<->T){all} 0.094849 0.000416 0.055688 0.134208 0.093584 937.17 1033.83 1.000 pi(A){all} 0.240563 0.000217 0.210593 0.268612 0.239931 1046.64 1090.30 1.001 pi(C){all} 0.290600 0.000209 0.263007 0.318780 0.290298 1040.86 1182.79 1.000 pi(G){all} 0.306362 0.000230 0.277052 0.336315 0.306136 1366.16 1408.92 1.001 pi(T){all} 0.162474 0.000132 0.139735 0.183871 0.162357 976.29 1075.19 1.000 alpha{1,2} 0.140327 0.000315 0.108565 0.175374 0.138831 1060.91 1237.79 1.000 alpha{3} 2.913458 0.694472 1.573391 4.715483 2.786817 1140.77 1213.26 1.000 pinvar{all} 0.422813 0.001944 0.330373 0.505072 0.423858 1324.85 1382.94 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 11 -- C11 12 -- C12 Key to taxon bipartitions (saved to file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------------ 1 -- .*********** 2 -- .*.......... 3 -- ..*......... 4 -- ...*........ 5 -- ....*....... 6 -- .....*...... 7 -- ......*..... 8 -- .......*.... 9 -- ........*... 10 -- .........*.. 11 -- ..........*. 12 -- ...........* 13 -- .....******* 14 -- ...********* 15 -- ..........** 16 -- .**......... 17 -- ......**.... 18 -- .....***.... 19 -- .....****... 20 -- .........*** 21 -- ....******** 22 -- .....****.** 23 -- ...*.******* 24 -- ...**....... 25 -- .....*..*... 26 -- .....*.**... 27 -- ........**.. ------------------ Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 13 3002 1.000000 0.000000 1.000000 1.000000 2 14 3002 1.000000 0.000000 1.000000 1.000000 2 15 2816 0.938041 0.003769 0.935376 0.940706 2 16 2744 0.914057 0.003769 0.911392 0.916722 2 17 2663 0.887075 0.003298 0.884744 0.889407 2 18 1797 0.598601 0.000471 0.598268 0.598934 2 19 1704 0.567622 0.005653 0.563624 0.571619 2 20 1574 0.524317 0.004711 0.520986 0.527648 2 21 1170 0.389740 0.007537 0.384410 0.395070 2 22 1026 0.341772 0.000942 0.341106 0.342438 2 23 1004 0.334444 0.001884 0.333111 0.335776 2 24 828 0.275816 0.009422 0.269154 0.282478 2 25 451 0.150233 0.002355 0.148568 0.151899 2 26 329 0.109594 0.005182 0.105929 0.113258 2 27 307 0.102265 0.006124 0.097935 0.106596 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.049385 0.000160 0.028056 0.076045 0.047847 1.000 2 length{all}[2] 0.032266 0.000096 0.015232 0.052718 0.031058 1.001 2 length{all}[3] 0.012889 0.000037 0.002698 0.024576 0.012016 1.000 2 length{all}[4] 0.042903 0.000157 0.020689 0.067720 0.041693 1.000 2 length{all}[5] 0.048181 0.000168 0.024762 0.073529 0.047055 1.000 2 length{all}[6] 0.079076 0.000318 0.047757 0.116394 0.077310 1.001 2 length{all}[7] 0.062727 0.000258 0.032818 0.095366 0.061428 1.000 2 length{all}[8] 0.050835 0.000223 0.023685 0.079863 0.049165 1.001 2 length{all}[9] 0.123491 0.000587 0.074825 0.168441 0.122076 1.000 2 length{all}[10] 0.170365 0.001086 0.107729 0.232901 0.167693 1.000 2 length{all}[11] 0.038357 0.000156 0.017000 0.064126 0.037103 1.000 2 length{all}[12] 0.078558 0.000329 0.045198 0.115337 0.076986 1.000 2 length{all}[13] 0.084756 0.000445 0.045682 0.127225 0.083619 1.000 2 length{all}[14] 0.028821 0.000108 0.011391 0.049892 0.027637 1.000 2 length{all}[15] 0.022665 0.000144 0.000046 0.044808 0.021194 1.000 2 length{all}[16] 0.010151 0.000033 0.000242 0.021229 0.009299 1.000 2 length{all}[17] 0.023440 0.000092 0.006919 0.042808 0.022106 1.000 2 length{all}[18] 0.012192 0.000060 0.000303 0.026472 0.010957 1.000 2 length{all}[19] 0.014968 0.000106 0.000116 0.034474 0.012827 0.999 2 length{all}[20] 0.018390 0.000110 0.000863 0.038897 0.016755 0.999 2 length{all}[21] 0.007287 0.000033 0.000012 0.018799 0.005916 1.000 2 length{all}[22] 0.020453 0.000137 0.000035 0.043169 0.019264 1.000 2 length{all}[23] 0.007711 0.000038 0.000015 0.019378 0.006131 0.999 2 length{all}[24] 0.006742 0.000036 0.000025 0.018130 0.005213 1.003 2 length{all}[25] 0.010216 0.000083 0.000040 0.027897 0.007712 1.000 2 length{all}[26] 0.021115 0.000100 0.003582 0.039236 0.019023 0.997 2 length{all}[27] 0.023784 0.000144 0.000444 0.044461 0.022418 0.997 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.003675 Maximum standard deviation of split frequencies = 0.009422 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.003 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | | /---------------------------------------------------------- C4 (4) | | | |---------------------------------------------------------- C5 (5) | | | | /----------------------- C6 (6) | | | |----100----+ /-----60----+ /------------ C7 (7) | | | \----89----+ | | /-----57----+ \------------ C8 (8) + | | | | | | \----------------------------------- C9 (9) | \----100---+ | | /----------------------- C10 (10) | | | | \-----------52----------+ /------------ C11 (11) | \----94----+ | \------------ C12 (12) | | /------------ C2 (2) \----------------------------91---------------------------+ \------------ C3 (3) Phylogram (based on average branch lengths): /----------- C1 (1) | | /--------- C4 (4) | | | |----------- C5 (5) | | | | /------------------ C6 (6) | | | |------+ /--+ /--------------- C7 (7) | | | \----+ | | /--+ \------------ C8 (8) + | | | | | | \----------------------------- C9 (9) | \------------------+ | | /---------------------------------------- C10 (10) | | | | \---+ /--------- C11 (11) | \----+ | \------------------- C12 (12) | | /-------- C2 (2) \-+ \--- C3 (3) |----------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (430 trees sampled): 50 % credible set contains 20 trees 90 % credible set contains 180 trees 95 % credible set contains 280 trees 99 % credible set contains 400 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 12 ls = 816 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Reading seq #11: C11 Reading seq #12: C12 Sites with gaps or missing data are removed. 6 ambiguity characters in seq. 1 6 ambiguity characters in seq. 2 6 ambiguity characters in seq. 3 6 ambiguity characters in seq. 4 6 ambiguity characters in seq. 5 3 ambiguity characters in seq. 6 3 ambiguity characters in seq. 7 3 ambiguity characters in seq. 8 6 ambiguity characters in seq. 9 6 ambiguity characters in seq. 10 6 ambiguity characters in seq. 11 6 ambiguity characters in seq. 12 2 sites are removed. 223 272 Sequences read.. Counting site patterns.. 0:00 191 patterns at 270 / 270 sites (100.0%), 0:00 Counting codons.. NG distances for seqs.: 1 2 3 4 5 6 7 8 9 10 11 12 528 bytes for distance 186416 bytes for conP 25976 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 838872 bytes for conP, adjusted 0.052348 0.037780 0.068079 0.053510 0.101316 0.047301 0.020172 0.092292 0.050399 0.060000 0.083403 0.144365 0.000000 0.163092 0.037256 0.076079 0.088941 0.015061 0.055135 0.029777 0.300000 1.300000 ntime & nrate & np: 20 2 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 22 lnL0 = -3325.178347 Iterating by ming2 Initial: fx= 3325.178347 x= 0.05235 0.03778 0.06808 0.05351 0.10132 0.04730 0.02017 0.09229 0.05040 0.06000 0.08340 0.14436 0.00000 0.16309 0.03726 0.07608 0.08894 0.01506 0.05513 0.02978 0.30000 1.30000 1 h-m-p 0.0000 0.0003 1820.9832 +CYCCC 3318.576681 4 0.0000 35 | 0/22 2 h-m-p 0.0001 0.0003 606.1197 +CYCYYCCC 3258.698966 7 0.0003 72 | 0/22 3 h-m-p 0.0000 0.0000 8695.4236 +CYYCC 3215.448357 4 0.0000 105 | 0/22 4 h-m-p 0.0000 0.0001 2978.8579 +YYCCC 3170.559539 4 0.0001 137 | 0/22 5 h-m-p 0.0001 0.0008 2843.9276 +CYCYYYCYCC 2935.297808 10 0.0008 179 | 0/22 6 h-m-p 0.0000 0.0000 711.8349 YYYYC 2934.257277 4 0.0000 208 | 0/22 7 h-m-p 0.0000 0.0010 386.5871 +++YYCYCCC 2881.794605 6 0.0009 246 | 0/22 8 h-m-p 0.0000 0.0002 1456.8520 YCYCCC 2863.812706 5 0.0001 279 | 0/22 9 h-m-p 0.0002 0.0010 262.5858 +CCC 2848.375493 2 0.0008 309 | 0/22 10 h-m-p 0.0000 0.0002 365.3650 ++ 2841.578409 m 0.0002 334 | 1/22 11 h-m-p 0.0001 0.0004 247.7435 +YCYCCC 2838.642183 5 0.0002 368 | 1/22 12 h-m-p 0.0002 0.0010 172.8074 CCCC 2837.280783 3 0.0002 399 | 1/22 13 h-m-p 0.0003 0.0022 107.0874 CCCC 2835.792663 3 0.0004 430 | 1/22 14 h-m-p 0.0007 0.0036 70.8571 YYC 2834.801963 2 0.0006 457 | 1/22 15 h-m-p 0.0005 0.0023 59.5308 CCCC 2834.236669 3 0.0005 488 | 1/22 16 h-m-p 0.0011 0.0088 26.3639 YCC 2833.912116 2 0.0009 516 | 1/22 17 h-m-p 0.0010 0.0111 23.7574 CCC 2833.536879 2 0.0012 545 | 1/22 18 h-m-p 0.0025 0.0191 11.5550 YC 2833.372526 1 0.0012 571 | 1/22 19 h-m-p 0.0005 0.0040 30.7251 YYC 2833.236995 2 0.0004 598 | 1/22 20 h-m-p 0.0023 0.0236 5.1540 YCCC 2832.799300 3 0.0041 628 | 1/22 21 h-m-p 0.0008 0.0089 26.2787 +CCC 2829.680683 2 0.0034 658 | 0/22 22 h-m-p 0.0010 0.0071 91.4412 +YCYCCC 2802.018316 5 0.0056 692 | 0/22 23 h-m-p 0.0001 0.0006 233.1329 +CYCCC 2792.582413 4 0.0005 725 | 0/22 24 h-m-p 0.0012 0.0061 11.7341 CCC 2792.409866 2 0.0013 754 | 0/22 25 h-m-p 0.0118 0.1935 1.3065 ++YYYCYCCC 2763.005143 7 0.1768 791 | 0/22 26 h-m-p 0.1818 0.9092 0.6426 +CCYC 2724.916718 3 0.8222 823 | 0/22 27 h-m-p 0.0437 0.2185 2.6028 YCCCCC 2711.002405 5 0.1079 879 | 0/22 28 h-m-p 0.2006 1.0031 0.7089 YCYCCC 2695.577199 5 0.5431 912 | 0/22 29 h-m-p 0.0621 0.3105 1.1062 +YCYCCC 2687.094364 5 0.1713 968 | 0/22 30 h-m-p 0.1070 0.5351 0.2326 ++ 2680.788071 m 0.5351 993 | 0/22 31 h-m-p 0.1639 0.8194 0.3229 YCC 2677.027482 2 0.2921 1043 | 0/22 32 h-m-p 0.3412 1.7058 0.0972 CYCCC 2673.411596 4 0.5907 1097 | 0/22 33 h-m-p 0.2895 1.4474 0.0659 YCCCC 2671.049194 4 0.6495 1151 | 0/22 34 h-m-p 0.3907 1.9533 0.0720 YC 2668.967661 1 0.6745 1199 | 0/22 35 h-m-p 0.7830 3.9148 0.0425 CCC 2668.198803 2 0.9138 1250 | 0/22 36 h-m-p 1.3635 8.0000 0.0285 CCC 2667.730624 2 1.7722 1301 | 0/22 37 h-m-p 1.6000 8.0000 0.0271 CCC 2667.362819 2 1.8134 1352 | 0/22 38 h-m-p 1.6000 8.0000 0.0213 YCCC 2666.883278 3 3.6136 1404 | 0/22 39 h-m-p 1.3440 6.7198 0.0197 YYC 2666.713120 2 1.1073 1453 | 0/22 40 h-m-p 1.1414 8.0000 0.0191 YC 2666.661334 1 0.8252 1501 | 0/22 41 h-m-p 1.6000 8.0000 0.0019 CC 2666.641077 1 1.9135 1550 | 0/22 42 h-m-p 0.5793 8.0000 0.0063 YC 2666.635256 1 1.4311 1598 | 0/22 43 h-m-p 1.6000 8.0000 0.0022 +YC 2666.631586 1 4.0861 1647 | 0/22 44 h-m-p 1.6000 8.0000 0.0037 C 2666.629740 0 1.7111 1694 | 0/22 45 h-m-p 1.6000 8.0000 0.0004 Y 2666.629466 0 1.2278 1741 | 0/22 46 h-m-p 1.3154 8.0000 0.0004 C 2666.629392 0 1.4321 1788 | 0/22 47 h-m-p 1.6000 8.0000 0.0001 C 2666.629383 0 1.6058 1835 | 0/22 48 h-m-p 1.6000 8.0000 0.0000 C 2666.629382 0 1.6151 1882 | 0/22 49 h-m-p 1.6000 8.0000 0.0000 C 2666.629381 0 1.9709 1929 | 0/22 50 h-m-p 1.6000 8.0000 0.0000 C 2666.629381 0 1.4824 1976 | 0/22 51 h-m-p 1.6000 8.0000 0.0000 Y 2666.629381 0 1.6000 2023 | 0/22 52 h-m-p 1.6000 8.0000 0.0000 ---------Y 2666.629381 0 0.0000 2079 Out.. lnL = -2666.629381 2080 lfun, 2080 eigenQcodon, 41600 P(t) Time used: 0:18 Model 1: NearlyNeutral TREE # 1 (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 0.080609 0.048014 0.051156 0.060664 0.086347 0.033365 0.014309 0.100693 0.039232 0.067113 0.078324 0.171846 0.000000 0.200494 0.046101 0.064704 0.085085 0.017826 0.053826 0.034672 1.762833 0.500545 0.139499 ntime & nrate & np: 20 2 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 6.790794 np = 23 lnL0 = -2892.803991 Iterating by ming2 Initial: fx= 2892.803991 x= 0.08061 0.04801 0.05116 0.06066 0.08635 0.03337 0.01431 0.10069 0.03923 0.06711 0.07832 0.17185 0.00000 0.20049 0.04610 0.06470 0.08508 0.01783 0.05383 0.03467 1.76283 0.50054 0.13950 1 h-m-p 0.0000 0.0004 783.5288 +++ 2750.946658 m 0.0004 29 | 1/23 2 h-m-p 0.0001 0.0007 583.2809 CYCCCC 2719.281154 5 0.0003 64 | 0/23 3 h-m-p 0.0000 0.0000 127943.4396 YCCC 2706.586726 3 0.0000 95 | 0/23 4 h-m-p 0.0002 0.0008 166.4575 +YYCCC 2698.682952 4 0.0005 128 | 0/23 5 h-m-p 0.0001 0.0003 288.2237 CCC 2697.364926 2 0.0001 158 | 0/23 6 h-m-p 0.0003 0.0015 70.3192 CCC 2696.636669 2 0.0004 188 | 0/23 7 h-m-p 0.0004 0.0020 45.7697 CCC 2696.284033 2 0.0005 218 | 0/23 8 h-m-p 0.0007 0.0079 33.3797 CCC 2695.992741 2 0.0009 248 | 0/23 9 h-m-p 0.0007 0.0037 24.6642 CCC 2695.805739 2 0.0010 278 | 0/23 10 h-m-p 0.0015 0.0134 17.5524 YC 2695.726094 1 0.0009 305 | 0/23 11 h-m-p 0.0012 0.0191 12.1508 YC 2695.582496 1 0.0027 332 | 0/23 12 h-m-p 0.0007 0.0093 45.8223 YCCC 2695.281231 3 0.0015 363 | 0/23 13 h-m-p 0.0012 0.0103 57.7722 CCC 2694.923692 2 0.0015 393 | 0/23 14 h-m-p 0.0010 0.0153 82.8479 YC 2694.013193 1 0.0026 420 | 0/23 15 h-m-p 0.0011 0.0054 69.6684 YYC 2693.774671 2 0.0008 448 | 0/23 16 h-m-p 0.0012 0.0112 48.5569 YCC 2693.633216 2 0.0007 477 | 0/23 17 h-m-p 0.0034 0.0312 10.3628 CC 2693.590231 1 0.0010 505 | 0/23 18 h-m-p 0.0024 0.0217 4.5303 YC 2693.551533 1 0.0015 532 | 0/23 19 h-m-p 0.0010 0.0389 6.9571 +YC 2693.328322 1 0.0032 560 | 0/23 20 h-m-p 0.0016 0.0148 13.8560 CCC 2692.850489 2 0.0021 590 | 0/23 21 h-m-p 0.0016 0.0142 18.6397 +CYCCC 2688.086414 4 0.0085 624 | 0/23 22 h-m-p 0.0003 0.0013 64.8178 CCCC 2687.607496 3 0.0004 656 | 0/23 23 h-m-p 0.0017 0.0229 13.6133 CC 2687.449171 1 0.0014 684 | 0/23 24 h-m-p 0.0073 0.1607 2.6338 +YCC 2686.522931 2 0.0201 714 | 0/23 25 h-m-p 0.0035 0.0315 15.2376 +YYYCC 2678.396542 4 0.0123 746 | 0/23 26 h-m-p 0.0948 0.4738 0.3293 +CYCCC 2669.794228 4 0.4102 780 | 0/23 27 h-m-p 0.1261 0.6303 0.1973 +CYC 2667.142744 2 0.4983 833 | 0/23 28 h-m-p 0.2666 1.3328 0.1006 CC 2665.985013 1 0.2666 884 | 0/23 29 h-m-p 0.1954 1.3187 0.1372 YCCC 2665.088395 3 0.4883 938 | 0/23 30 h-m-p 1.4289 7.1446 0.0266 CYCC 2664.122957 3 1.8940 992 | 0/23 31 h-m-p 1.6000 8.0000 0.0170 CCC 2662.548562 2 1.8319 1045 | 0/23 32 h-m-p 0.9268 4.6341 0.0309 CCCC 2661.690411 3 1.0137 1100 | 0/23 33 h-m-p 1.6000 8.0000 0.0182 YCCC 2661.448843 3 0.8611 1154 | 0/23 34 h-m-p 1.0645 8.0000 0.0147 CC 2661.277645 1 1.3951 1205 | 0/23 35 h-m-p 0.9274 8.0000 0.0221 YC 2661.095316 1 1.6563 1255 | 0/23 36 h-m-p 1.5420 7.7098 0.0180 YCCC 2661.017617 3 0.8390 1309 | 0/23 37 h-m-p 0.7896 8.0000 0.0192 CC 2660.995284 1 0.6763 1360 | 0/23 38 h-m-p 1.6000 8.0000 0.0040 YC 2660.988963 1 0.7231 1410 | 0/23 39 h-m-p 1.1222 8.0000 0.0026 YC 2660.988321 1 0.7357 1460 | 0/23 40 h-m-p 1.6000 8.0000 0.0003 Y 2660.988261 0 0.6676 1509 | 0/23 41 h-m-p 1.6000 8.0000 0.0001 Y 2660.988257 0 0.7778 1558 | 0/23 42 h-m-p 1.6000 8.0000 0.0000 Y 2660.988257 0 0.6757 1607 | 0/23 43 h-m-p 1.2013 8.0000 0.0000 Y 2660.988257 0 0.8037 1656 | 0/23 44 h-m-p 1.6000 8.0000 0.0000 Y 2660.988257 0 0.4000 1705 | 0/23 45 h-m-p 0.2248 8.0000 0.0000 +C 2660.988257 0 0.8993 1755 | 0/23 46 h-m-p 1.4049 8.0000 0.0000 -------Y 2660.988257 0 0.0000 1811 Out.. lnL = -2660.988257 1812 lfun, 5436 eigenQcodon, 72480 P(t) Time used: 0:48 Model 2: PositiveSelection TREE # 1 (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 initial w for M2:NSpselection reset. 0.070518 0.044569 0.058534 0.063717 0.100390 0.024747 0.013805 0.108117 0.026587 0.081647 0.090327 0.186778 0.000000 0.209623 0.040325 0.066397 0.080558 0.004629 0.040702 0.026714 1.801657 1.302842 0.509198 0.419451 2.107983 ntime & nrate & np: 20 3 25 Bounds (np=25): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 5.028915 np = 25 lnL0 = -2983.871525 Iterating by ming2 Initial: fx= 2983.871525 x= 0.07052 0.04457 0.05853 0.06372 0.10039 0.02475 0.01380 0.10812 0.02659 0.08165 0.09033 0.18678 0.00000 0.20962 0.04032 0.06640 0.08056 0.00463 0.04070 0.02671 1.80166 1.30284 0.50920 0.41945 2.10798 1 h-m-p 0.0000 0.0010 848.9626 ++YYCCCCC 2969.115322 6 0.0001 42 | 0/25 2 h-m-p 0.0002 0.0010 440.6964 ++ 2768.742291 m 0.0010 70 | 1/25 3 h-m-p 0.0002 0.0010 947.6556 CYCCC 2748.359991 4 0.0003 105 | 0/25 4 h-m-p 0.0000 0.0000 47599.7530 CCCC 2741.362631 3 0.0000 139 | 0/25 5 h-m-p 0.0004 0.0018 131.0241 +YYYCCC 2731.642629 5 0.0014 175 | 0/25 6 h-m-p 0.0002 0.0012 133.4129 +YCCC 2728.445366 3 0.0007 209 | 0/25 7 h-m-p 0.0005 0.0025 135.8765 CCCC 2725.578440 3 0.0008 243 | 0/25 8 h-m-p 0.0004 0.0021 103.6534 +YCYCCC 2722.420492 5 0.0012 280 | 0/25 9 h-m-p 0.0011 0.0055 72.7580 YCCC 2719.693040 3 0.0022 313 | 0/25 10 h-m-p 0.0017 0.0085 82.9407 YCYC 2718.307214 3 0.0012 345 | 0/25 11 h-m-p 0.0021 0.0129 46.9492 CCC 2716.330426 2 0.0033 377 | 0/25 12 h-m-p 0.0025 0.0124 62.2060 CCCC 2713.935725 3 0.0029 411 | 0/25 13 h-m-p 0.0019 0.0093 77.4632 CYC 2711.913299 2 0.0022 442 | 0/25 14 h-m-p 0.0008 0.0038 106.3927 +YCCC 2706.195631 3 0.0034 476 | 0/25 15 h-m-p 0.0001 0.0005 128.5007 ++ 2704.894539 m 0.0005 504 | 0/25 16 h-m-p 0.0032 0.0162 20.1035 YCC 2704.582978 2 0.0025 535 | 0/25 17 h-m-p 0.0026 0.0645 19.0603 +CCC 2703.573749 2 0.0109 568 | 0/25 18 h-m-p 0.0050 0.0318 41.3620 CCC 2702.171542 2 0.0076 600 | 0/25 19 h-m-p 0.0040 0.0218 79.2366 CCC 2700.716508 2 0.0044 632 | 0/25 20 h-m-p 0.0039 0.0196 58.2245 CCC 2699.745029 2 0.0041 664 | 0/25 21 h-m-p 0.0075 0.0374 26.7792 YCC 2699.323541 2 0.0042 695 | 0/25 22 h-m-p 0.0089 0.1223 12.7569 CCC 2698.764502 2 0.0140 727 | 0/25 23 h-m-p 0.0036 0.0868 49.5693 +CYCCCC 2694.800704 5 0.0235 765 | 0/25 24 h-m-p 0.0100 0.0498 65.1526 YCC 2693.753426 2 0.0054 796 | 0/25 25 h-m-p 0.0495 1.3400 7.0677 YCCC 2691.650091 3 0.0925 829 | 0/25 26 h-m-p 0.0404 0.2019 4.0053 YYC 2691.140241 2 0.0315 859 | 0/25 27 h-m-p 0.0136 0.3945 9.2660 ++YCC 2683.444928 2 0.1622 892 | 0/25 28 h-m-p 1.1868 6.0985 1.2662 CCCC 2679.304613 3 1.4088 926 | 0/25 29 h-m-p 0.6181 3.0904 0.3073 YCYCCC 2674.770083 5 1.6771 962 | 0/25 30 h-m-p 0.3156 1.5781 0.5823 YCCCC 2672.580206 4 0.7209 1022 | 0/25 31 h-m-p 1.0627 6.1211 0.3950 CCCCC 2669.925259 4 1.2653 1083 | 0/25 32 h-m-p 0.5320 2.6601 0.7116 YCCCCCC 2668.214509 6 0.6365 1147 | 0/25 33 h-m-p 0.2908 1.4539 0.8925 +YCCC 2666.134440 3 0.8388 1206 | 0/25 34 h-m-p 0.4181 2.0904 0.9923 CCCCC 2665.006351 4 0.6029 1267 | 0/25 35 h-m-p 0.3489 1.7446 1.1810 CCCC 2664.147510 3 0.4923 1326 | 0/25 36 h-m-p 0.4496 3.0743 1.2930 CCCC 2663.387021 3 0.4996 1360 | 0/25 37 h-m-p 0.3917 1.9583 1.2120 CCCC 2662.977046 3 0.4137 1394 | 0/25 38 h-m-p 0.4796 2.6787 1.0452 CCCC 2662.689251 3 0.5890 1428 | 0/25 39 h-m-p 0.5620 8.0000 1.0955 CCC 2662.506755 2 0.4721 1460 | 0/25 40 h-m-p 0.2858 2.9015 1.8098 CCCC 2662.318176 3 0.3453 1494 | 0/25 41 h-m-p 0.5588 8.0000 1.1183 YC 2662.158269 1 0.4230 1523 | 0/25 42 h-m-p 0.5134 6.9908 0.9213 YCC 2662.062291 2 0.4008 1554 | 0/25 43 h-m-p 0.3305 3.7531 1.1172 CC 2661.924770 1 0.4866 1609 | 0/25 44 h-m-p 0.6130 7.9267 0.8869 CC 2661.807018 1 0.5865 1639 | 0/25 45 h-m-p 0.4792 6.0547 1.0854 CCC 2661.639007 2 0.7714 1696 | 0/25 46 h-m-p 0.5698 7.9342 1.4692 CC 2661.523473 1 0.4672 1726 | 0/25 47 h-m-p 0.6583 8.0000 1.0427 CCC 2661.415999 2 0.7856 1758 | 0/25 48 h-m-p 0.5241 8.0000 1.5628 CCC 2661.301124 2 0.4616 1790 | 0/25 49 h-m-p 0.6581 5.4668 1.0962 YCC 2661.215746 2 0.5500 1821 | 0/25 50 h-m-p 0.5249 8.0000 1.1488 CCC 2661.154509 2 0.5420 1853 | 0/25 51 h-m-p 1.2566 8.0000 0.4954 CC 2661.137983 1 0.4903 1883 | 0/25 52 h-m-p 0.5182 8.0000 0.4688 CC 2661.122135 1 0.6295 1938 | 0/25 53 h-m-p 0.3631 8.0000 0.8129 CC 2661.110570 1 0.3860 1993 | 0/25 54 h-m-p 0.3915 8.0000 0.8015 YC 2661.090996 1 0.9694 2047 | 0/25 55 h-m-p 0.6867 8.0000 1.1316 CYC 2661.069192 2 0.8050 2103 | 0/25 56 h-m-p 0.4881 8.0000 1.8661 CCC 2661.044533 2 0.7811 2135 | 0/25 57 h-m-p 0.8463 8.0000 1.7224 CCC 2661.025334 2 0.6545 2167 | 0/25 58 h-m-p 0.5419 8.0000 2.0802 C 2661.015085 0 0.5419 2195 | 0/25 59 h-m-p 0.6612 8.0000 1.7051 C 2661.007091 0 0.6612 2223 | 0/25 60 h-m-p 0.7491 8.0000 1.5049 CC 2661.000872 1 0.9740 2253 | 0/25 61 h-m-p 0.8559 8.0000 1.7126 CC 2660.995768 1 1.0285 2283 | 0/25 62 h-m-p 0.9767 8.0000 1.8035 YC 2660.993386 1 0.6918 2312 | 0/25 63 h-m-p 0.8591 8.0000 1.4523 YC 2660.990789 1 1.6598 2341 | 0/25 64 h-m-p 1.5192 8.0000 1.5867 YC 2660.990028 1 0.7703 2370 | 0/25 65 h-m-p 0.6455 8.0000 1.8934 YC 2660.989195 1 1.0959 2399 | 0/25 66 h-m-p 1.3858 8.0000 1.4974 C 2660.988843 0 1.1707 2427 | 0/25 67 h-m-p 1.0737 8.0000 1.6326 C 2660.988565 0 1.2730 2455 | 0/25 68 h-m-p 1.6000 8.0000 1.2145 C 2660.988436 0 1.4154 2483 | 0/25 69 h-m-p 1.3306 8.0000 1.2919 C 2660.988349 0 1.9493 2511 | 0/25 70 h-m-p 1.6000 8.0000 0.6411 C 2660.988315 0 1.5042 2539 | 0/25 71 h-m-p 0.5790 8.0000 1.6655 +Y 2660.988284 0 3.5927 2593 | 0/25 72 h-m-p 1.6000 8.0000 2.9491 C 2660.988277 0 0.5801 2621 | 0/25 73 h-m-p 0.7365 8.0000 2.3230 ------Y 2660.988277 0 0.0001 2655 | 0/25 74 h-m-p 0.0160 8.0000 0.5866 ++C 2660.988275 0 0.3844 2685 | 0/25 75 h-m-p 1.3261 8.0000 0.1700 Y 2660.988273 0 0.8174 2738 | 0/25 76 h-m-p 1.4538 8.0000 0.0956 Y 2660.988273 0 2.5521 2791 | 0/25 77 h-m-p 1.6000 8.0000 0.0319 Y 2660.988272 0 0.7287 2844 | 0/25 78 h-m-p 1.6000 8.0000 0.0021 C 2660.988272 0 1.4254 2897 | 0/25 79 h-m-p 1.6000 8.0000 0.0007 ++ 2660.988272 m 8.0000 2950 | 0/25 80 h-m-p 0.1682 8.0000 0.0309 ++C 2660.988272 0 3.0816 3005 | 0/25 81 h-m-p 0.9418 8.0000 0.1013 ++ 2660.988270 m 8.0000 3058 | 0/25 82 h-m-p 0.3253 8.0000 2.4898 ++Y 2660.988259 0 4.3574 3113 | 0/25 83 h-m-p 1.3358 7.7805 8.1217 Y 2660.988259 0 0.2016 3141 | 0/25 84 h-m-p 0.3176 8.0000 5.1549 +Y 2660.988258 0 1.0763 3170 | 0/25 85 h-m-p 0.0608 0.7349 91.3106 -C 2660.988258 0 0.0035 3199 | 0/25 86 h-m-p 0.1764 8.0000 1.7868 +C 2660.988257 0 0.7935 3228 | 0/25 87 h-m-p 0.0013 0.0588 1112.5980 --C 2660.988257 0 0.0000 3258 | 0/25 88 h-m-p 0.1088 8.0000 0.2666 C 2660.988257 0 0.1537 3286 | 0/25 89 h-m-p 1.6000 8.0000 0.0000 Y 2660.988257 0 0.7599 3339 | 0/25 90 h-m-p 0.0504 8.0000 0.0007 Y 2660.988257 0 0.0126 3392 | 0/25 91 h-m-p 0.0160 8.0000 0.0010 +C 2660.988257 0 0.0640 3446 | 0/25 92 h-m-p 0.1454 8.0000 0.0004 +Y 2660.988257 0 1.4231 3500 | 0/25 93 h-m-p 1.6000 8.0000 0.0001 -C 2660.988257 0 0.1000 3554 | 0/25 94 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/25 95 h-m-p 0.0160 8.0000 0.0037 ------------- | 0/25 96 h-m-p 0.0160 8.0000 0.0037 ------------- Out.. lnL = -2660.988257 3750 lfun, 15000 eigenQcodon, 225000 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2688.523296 S = -2616.944183 -63.252140 Calculating f(w|X), posterior probabilities of site classes. did 10 / 191 patterns 2:22 did 20 / 191 patterns 2:22 did 30 / 191 patterns 2:22 did 40 / 191 patterns 2:22 did 50 / 191 patterns 2:22 did 60 / 191 patterns 2:22 did 70 / 191 patterns 2:22 did 80 / 191 patterns 2:22 did 90 / 191 patterns 2:22 did 100 / 191 patterns 2:22 did 110 / 191 patterns 2:22 did 120 / 191 patterns 2:22 did 130 / 191 patterns 2:22 did 140 / 191 patterns 2:22 did 150 / 191 patterns 2:22 did 160 / 191 patterns 2:22 did 170 / 191 patterns 2:22 did 180 / 191 patterns 2:22 did 190 / 191 patterns 2:22 did 191 / 191 patterns 2:22 Time used: 2:22 Model 3: discrete TREE # 1 (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 0.069804 0.046204 0.064363 0.073350 0.101961 0.027687 0.012734 0.108174 0.027354 0.074464 0.087934 0.173418 0.000000 0.203228 0.037284 0.065799 0.085039 0.017239 0.054811 0.032412 1.801659 0.446685 0.067456 0.015712 0.040445 0.055732 ntime & nrate & np: 20 4 26 Bounds (np=26): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 20.374370 np = 26 lnL0 = -2673.274591 Iterating by ming2 Initial: fx= 2673.274591 x= 0.06980 0.04620 0.06436 0.07335 0.10196 0.02769 0.01273 0.10817 0.02735 0.07446 0.08793 0.17342 0.00000 0.20323 0.03728 0.06580 0.08504 0.01724 0.05481 0.03241 1.80166 0.44668 0.06746 0.01571 0.04044 0.05573 1 h-m-p 0.0000 0.0001 1543.0315 +CYCCC 2667.636537 4 0.0000 65 | 0/26 2 h-m-p 0.0000 0.0000 409.0431 ++ 2664.129684 m 0.0000 120 | 1/26 3 h-m-p 0.0000 0.0000 3580.7049 +YYCCCC 2659.317071 5 0.0000 184 | 1/26 4 h-m-p 0.0001 0.0004 287.8750 ++ 2652.374121 m 0.0004 238 | 2/26 5 h-m-p 0.0009 0.0044 63.0482 CYC 2652.007285 2 0.0003 295 | 2/26 6 h-m-p 0.0002 0.0010 43.4096 CYC 2651.892246 2 0.0002 351 | 2/26 7 h-m-p 0.0003 0.0032 23.4799 CCC 2651.809047 2 0.0004 408 | 2/26 8 h-m-p 0.0002 0.0061 44.2869 CYC 2651.734114 2 0.0002 464 | 2/26 9 h-m-p 0.0003 0.0025 29.9696 C 2651.668624 0 0.0003 517 | 2/26 10 h-m-p 0.0006 0.0050 16.1000 CC 2651.609522 1 0.0007 572 | 2/26 11 h-m-p 0.0003 0.0135 40.1624 +YCC 2651.178896 2 0.0019 629 | 2/26 12 h-m-p 0.0005 0.0046 145.8266 CCC 2650.741066 2 0.0005 686 | 2/26 13 h-m-p 0.0004 0.0038 208.0548 +YYCC 2649.290528 3 0.0012 744 | 2/26 14 h-m-p 0.0003 0.0014 393.2166 YCCCC 2648.122499 4 0.0005 804 | 2/26 15 h-m-p 0.0008 0.0039 40.3427 CCC 2648.077695 2 0.0002 861 | 2/26 16 h-m-p 0.0014 0.0128 6.3915 CC 2648.070177 1 0.0004 916 | 2/26 17 h-m-p 0.0006 0.0877 3.8501 YC 2648.060167 1 0.0011 970 | 2/26 18 h-m-p 0.0011 0.0432 3.8424 YC 2648.052206 1 0.0009 1024 | 2/26 19 h-m-p 0.0003 0.0251 11.6960 +YC 2647.977271 1 0.0025 1079 | 2/26 20 h-m-p 0.0004 0.0034 74.7763 +YCCC 2647.737043 3 0.0012 1138 | 2/26 21 h-m-p 0.0025 0.0124 17.2681 CCC 2647.700675 2 0.0009 1195 | 2/26 22 h-m-p 0.0037 0.0854 4.0686 YC 2647.685121 1 0.0016 1249 | 2/26 23 h-m-p 0.0005 0.0524 12.2080 +YCC 2647.550399 2 0.0040 1306 | 2/26 24 h-m-p 0.0009 0.0754 53.4039 ++YYYC 2645.266951 3 0.0143 1364 | 2/26 25 h-m-p 0.0062 0.0311 38.5304 CC 2645.131693 1 0.0013 1419 | 2/26 26 h-m-p 0.0175 0.9995 2.7791 +CCC 2644.760778 2 0.0585 1477 | 2/26 27 h-m-p 0.1237 1.0778 1.3144 CC 2644.509414 1 0.1328 1532 | 2/26 28 h-m-p 1.4511 7.2557 0.1068 YC 2644.359682 1 0.7632 1586 | 2/26 29 h-m-p 1.6000 8.0000 0.0126 YC 2644.350390 1 0.9687 1640 | 2/26 30 h-m-p 1.6000 8.0000 0.0057 YC 2644.349838 1 1.1063 1694 | 2/26 31 h-m-p 1.6000 8.0000 0.0023 YC 2644.349784 1 0.8792 1748 | 2/26 32 h-m-p 1.6000 8.0000 0.0002 Y 2644.349780 0 0.9397 1801 | 2/26 33 h-m-p 1.6000 8.0000 0.0001 Y 2644.349780 0 1.2530 1854 | 2/26 34 h-m-p 1.6000 8.0000 0.0000 Y 2644.349780 0 1.0818 1907 | 2/26 35 h-m-p 1.6000 8.0000 0.0000 C 2644.349780 0 1.3502 1960 | 2/26 36 h-m-p 1.6000 8.0000 0.0000 -----Y 2644.349780 0 0.0004 2018 Out.. lnL = -2644.349780 2019 lfun, 8076 eigenQcodon, 121140 P(t) Time used: 3:12 Model 7: beta TREE # 1 (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 0.084252 0.039973 0.054989 0.081777 0.089277 0.019720 0.019470 0.110742 0.025604 0.063625 0.076204 0.156990 0.000000 0.154991 0.043713 0.063563 0.071343 0.015515 0.037081 0.043951 1.761986 1.051152 1.246982 ntime & nrate & np: 20 1 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 7.904635 np = 23 lnL0 = -2881.414984 Iterating by ming2 Initial: fx= 2881.414984 x= 0.08425 0.03997 0.05499 0.08178 0.08928 0.01972 0.01947 0.11074 0.02560 0.06362 0.07620 0.15699 0.00000 0.15499 0.04371 0.06356 0.07134 0.01552 0.03708 0.04395 1.76199 1.05115 1.24698 1 h-m-p 0.0000 0.0004 620.2190 ++CCYC 2864.913385 3 0.0002 58 | 0/23 2 h-m-p 0.0001 0.0006 270.0892 +YCYYCCC 2842.513246 6 0.0006 117 | 0/23 3 h-m-p 0.0000 0.0001 3762.8783 +YCCCC 2816.719603 4 0.0001 174 | 0/23 4 h-m-p 0.0000 0.0000 2120.0678 ++ 2807.570035 m 0.0000 223 | 0/23 5 h-m-p 0.0000 0.0000 782.4409 h-m-p: 1.44843414e-21 7.24217071e-21 7.82440947e+02 2807.570035 .. | 0/23 6 h-m-p 0.0000 0.0006 473.7656 ++YCCC 2791.449041 3 0.0003 325 | 0/23 7 h-m-p 0.0001 0.0007 331.5010 ++ 2742.308782 m 0.0007 374 | 0/23 8 h-m-p 0.0000 0.0000 2815.6442 h-m-p: 8.99406516e-21 4.49703258e-20 2.81564417e+03 2742.308782 .. | 0/23 9 h-m-p 0.0000 0.0007 304.8721 +++CYCCC 2705.063163 4 0.0007 479 | 0/23 10 h-m-p 0.0000 0.0000 2592.3658 ++ 2694.725488 m 0.0000 528 | 0/23 11 h-m-p 0.0001 0.0003 612.9630 +YYCCC 2671.539003 4 0.0003 584 | 0/23 12 h-m-p 0.0000 0.0002 300.2057 +CYCCC 2667.289851 4 0.0001 641 | 0/23 13 h-m-p 0.0001 0.0006 147.3231 YCCCC 2665.661087 4 0.0002 697 | 0/23 14 h-m-p 0.0003 0.0025 115.1460 CCCC 2664.236570 3 0.0004 752 | 0/23 15 h-m-p 0.0001 0.0005 75.8984 YCCC 2663.912643 3 0.0002 806 | 0/23 16 h-m-p 0.0001 0.0027 126.6798 +YCC 2663.062479 2 0.0004 859 | 0/23 17 h-m-p 0.0006 0.0032 78.6786 CCCC 2662.259076 3 0.0007 914 | 0/23 18 h-m-p 0.0006 0.0065 86.7679 CCC 2661.323704 2 0.0008 967 | 0/23 19 h-m-p 0.0004 0.0039 173.4290 +YCCCC 2657.479813 4 0.0017 1024 | 0/23 20 h-m-p 0.0002 0.0011 536.2109 +YCCC 2653.402911 3 0.0006 1079 | 0/23 21 h-m-p 0.0002 0.0011 310.0606 CCCC 2652.004115 3 0.0004 1134 | 0/23 22 h-m-p 0.0004 0.0020 82.6709 YYC 2651.725322 2 0.0003 1185 | 0/23 23 h-m-p 0.0005 0.0027 36.3189 YCC 2651.625388 2 0.0003 1237 | 0/23 24 h-m-p 0.0009 0.0160 13.4551 YC 2651.579436 1 0.0006 1287 | 0/23 25 h-m-p 0.0011 0.0291 7.3919 YC 2651.548593 1 0.0008 1337 | 0/23 26 h-m-p 0.0005 0.0525 10.5083 ++CCC 2650.889595 2 0.0089 1392 | 0/23 27 h-m-p 0.0005 0.0045 171.3190 YCCC 2649.603748 3 0.0010 1446 | 0/23 28 h-m-p 0.0002 0.0012 241.3079 CCCC 2649.067615 3 0.0003 1501 | 0/23 29 h-m-p 0.0011 0.0057 32.9229 CC 2648.998259 1 0.0003 1552 | 0/23 30 h-m-p 0.0028 0.0596 3.8577 YC 2648.959481 1 0.0021 1602 | 0/23 31 h-m-p 0.0005 0.0160 15.6934 YC 2648.888894 1 0.0010 1652 | 0/23 32 h-m-p 0.0003 0.0207 44.4270 ++YYC 2648.027836 2 0.0043 1705 | 0/23 33 h-m-p 0.7192 8.0000 0.2672 CYCCC 2646.471928 4 0.4982 1761 | 0/23 34 h-m-p 1.3895 8.0000 0.0958 YCC 2645.891947 2 1.0688 1813 | 0/23 35 h-m-p 1.6000 8.0000 0.0528 CCC 2645.675634 2 1.5350 1866 | 0/23 36 h-m-p 0.8617 8.0000 0.0941 YC 2645.580414 1 1.8207 1916 | 0/23 37 h-m-p 1.6000 8.0000 0.0844 CCC 2645.509079 2 2.2694 1969 | 0/23 38 h-m-p 1.6000 8.0000 0.0868 CCC 2645.459611 2 1.7708 2022 | 0/23 39 h-m-p 1.6000 8.0000 0.0355 YC 2645.441553 1 1.3015 2072 | 0/23 40 h-m-p 1.6000 8.0000 0.0072 CC 2645.434800 1 1.7224 2123 | 0/23 41 h-m-p 1.0653 8.0000 0.0116 YC 2645.431541 1 1.9334 2173 | 0/23 42 h-m-p 1.6000 8.0000 0.0047 C 2645.430474 0 1.8393 2222 | 0/23 43 h-m-p 1.6000 8.0000 0.0030 Y 2645.430390 0 1.1057 2271 | 0/23 44 h-m-p 1.6000 8.0000 0.0018 Y 2645.430382 0 1.1393 2320 | 0/23 45 h-m-p 1.6000 8.0000 0.0001 C 2645.430377 0 2.2472 2369 | 0/23 46 h-m-p 1.6000 8.0000 0.0000 Y 2645.430377 0 1.0714 2418 | 0/23 47 h-m-p 1.6000 8.0000 0.0000 Y 2645.430377 0 1.6000 2467 | 0/23 48 h-m-p 0.9241 8.0000 0.0000 ----------------.. | 0/23 49 h-m-p 0.0160 8.0000 0.0019 ------------- Out.. lnL = -2645.430377 2591 lfun, 28501 eigenQcodon, 518200 P(t) Time used: 6:43 Model 8: beta&w>1 TREE # 1 (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 initial w for M8:NSbetaw>1 reset. 0.081297 0.036820 0.067416 0.051162 0.076435 0.027583 0.038160 0.108071 0.031917 0.073121 0.093284 0.166836 0.000000 0.180897 0.047397 0.061485 0.093385 0.008061 0.065349 0.028569 1.760255 0.900000 0.607855 1.105757 2.513519 ntime & nrate & np: 20 2 25 Bounds (np=25): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.791290 np = 25 lnL0 = -2874.791273 Iterating by ming2 Initial: fx= 2874.791273 x= 0.08130 0.03682 0.06742 0.05116 0.07643 0.02758 0.03816 0.10807 0.03192 0.07312 0.09328 0.16684 0.00000 0.18090 0.04740 0.06149 0.09339 0.00806 0.06535 0.02857 1.76025 0.90000 0.60785 1.10576 2.51352 1 h-m-p 0.0000 0.0002 849.1942 +++ 2796.354114 m 0.0002 56 | 1/25 2 h-m-p 0.0001 0.0006 386.2341 ++ 2740.249065 m 0.0006 109 | 1/25 3 h-m-p 0.0000 0.0001 2194.8272 ++ 2690.864465 m 0.0001 161 | 1/25 4 h-m-p 0.0000 0.0002 1141.4734 YCCCCC 2675.747976 5 0.0001 222 | 0/25 5 h-m-p 0.0000 0.0001 1411.0672 YCYCYCC 2665.175546 6 0.0001 284 | 0/25 6 h-m-p 0.0000 0.0002 150.1415 CCCC 2664.595275 3 0.0001 343 | 0/25 7 h-m-p 0.0001 0.0005 92.3193 YCCC 2664.072374 3 0.0002 401 | 0/25 8 h-m-p 0.0002 0.0053 82.0431 +CCC 2662.640178 2 0.0008 459 | 0/25 9 h-m-p 0.0006 0.0029 69.6149 YCCC 2661.509562 3 0.0010 517 | 0/25 10 h-m-p 0.0007 0.0036 65.5658 CCC 2660.698888 2 0.0010 574 | 0/25 11 h-m-p 0.0011 0.0055 48.3573 CYC 2660.229346 2 0.0010 630 | 0/25 12 h-m-p 0.0013 0.0094 36.5142 CCC 2659.830060 2 0.0014 687 | 0/25 13 h-m-p 0.0005 0.0024 54.5731 YC 2659.484022 1 0.0010 741 | 0/25 14 h-m-p 0.0018 0.0088 26.1767 YCC 2659.377221 2 0.0008 797 | 0/25 15 h-m-p 0.0019 0.0157 10.6030 YC 2659.337734 1 0.0010 851 | 0/25 16 h-m-p 0.0016 0.0080 6.6226 YC 2659.313133 1 0.0013 905 | 0/25 17 h-m-p 0.0028 0.0646 3.0103 +YC 2659.224908 1 0.0081 960 | 0/25 18 h-m-p 0.0008 0.0176 28.9895 YC 2658.996977 1 0.0020 1014 | 0/25 19 h-m-p 0.0014 0.0541 40.6175 +YC 2658.356165 1 0.0040 1069 | 0/25 20 h-m-p 0.0034 0.0169 28.6528 CCC 2658.239436 2 0.0011 1126 | 0/25 21 h-m-p 0.0028 0.0448 10.8792 YC 2658.177400 1 0.0016 1180 | 0/25 22 h-m-p 0.0045 0.0273 3.8804 YC 2658.149732 1 0.0021 1234 | 0/25 23 h-m-p 0.0012 0.2441 6.8505 ++CCC 2657.530775 2 0.0258 1293 | 0/25 24 h-m-p 0.0039 0.0196 44.1929 YCCC 2657.154160 3 0.0024 1351 | 0/25 25 h-m-p 0.0026 0.0130 14.6353 CCC 2657.114612 2 0.0008 1408 | 0/25 26 h-m-p 0.0029 0.4243 4.0278 ++++ 2651.521263 m 0.4243 1463 | 1/25 27 h-m-p 0.3344 1.6722 0.2206 +YCCC 2648.451877 3 0.9238 1522 | 1/25 28 h-m-p 0.0390 0.1950 1.3351 ++ 2647.683997 m 0.1950 1574 | 2/25 29 h-m-p 0.3765 1.8825 0.1632 CCCC 2646.464152 3 0.5124 1632 | 2/25 30 h-m-p 0.4163 2.0814 0.0465 CCCC 2645.675921 3 0.7146 1689 | 2/25 31 h-m-p 0.2933 4.9017 0.1132 YCC 2645.520586 2 0.4628 1743 | 2/25 32 h-m-p 0.5962 4.2823 0.0879 CYC 2645.460202 2 0.5416 1797 | 2/25 33 h-m-p 1.6000 8.0000 0.0057 YC 2645.453994 1 0.6778 1849 | 2/25 34 h-m-p 0.7099 8.0000 0.0055 CC 2645.451897 1 0.8737 1902 | 2/25 35 h-m-p 0.5735 8.0000 0.0084 YC 2645.450582 1 0.9489 1954 | 2/25 36 h-m-p 0.8941 8.0000 0.0089 YC 2645.448601 1 1.6626 2006 | 2/25 37 h-m-p 0.8679 8.0000 0.0170 YC 2645.445641 1 1.4521 2058 | 2/25 38 h-m-p 0.8955 8.0000 0.0275 +YC 2645.438333 1 2.3746 2111 | 2/25 39 h-m-p 1.2009 8.0000 0.0545 YC 2645.432414 1 0.9684 2163 | 2/25 40 h-m-p 1.6000 8.0000 0.0095 YC 2645.431472 1 0.7262 2215 | 2/25 41 h-m-p 1.6000 8.0000 0.0012 Y 2645.431407 0 0.6534 2266 | 2/25 42 h-m-p 1.1593 8.0000 0.0007 Y 2645.431403 0 0.6756 2317 | 2/25 43 h-m-p 1.6000 8.0000 0.0000 Y 2645.431403 0 0.7669 2368 | 2/25 44 h-m-p 1.6000 8.0000 0.0000 Y 2645.431403 0 0.6632 2419 | 2/25 45 h-m-p 0.9123 8.0000 0.0000 C 2645.431403 0 1.0599 2470 | 2/25 46 h-m-p 1.6000 8.0000 0.0000 -----------Y 2645.431403 0 0.0000 2532 Out.. lnL = -2645.431403 2533 lfun, 30396 eigenQcodon, 557260 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2699.490469 S = -2620.215533 -71.143853 Calculating f(w|X), posterior probabilities of site classes. did 10 / 191 patterns 10:31 did 20 / 191 patterns 10:31 did 30 / 191 patterns 10:31 did 40 / 191 patterns 10:32 did 50 / 191 patterns 10:32 did 60 / 191 patterns 10:32 did 70 / 191 patterns 10:32 did 80 / 191 patterns 10:33 did 90 / 191 patterns 10:33 did 100 / 191 patterns 10:33 did 110 / 191 patterns 10:34 did 120 / 191 patterns 10:34 did 130 / 191 patterns 10:34 did 140 / 191 patterns 10:34 did 150 / 191 patterns 10:35 did 160 / 191 patterns 10:35 did 170 / 191 patterns 10:35 did 180 / 191 patterns 10:35 did 190 / 191 patterns 10:35 did 191 / 191 patterns 10:35 Time used: 10:36 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=12, Len=272 D_melanogaster_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN D_sechellia_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN D_simulans_CG30271-PF MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN D_yakuba_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_erecta_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_takahashii_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN D_biarmipes_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_suzukii_CG30271-PF MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_eugracilis_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_ficusphila_CG30271-PF MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_rhopaloa_CG30271-PF MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN D_elegans_CG30271-PF MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN ****** **** *********************************.* ** D_melanogaster_CG30271-PF RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_sechellia_CG30271-PF RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_simulans_CG30271-PF RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_yakuba_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_erecta_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_takahashii_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_biarmipes_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_suzukii_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP D_eugracilis_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_ficusphila_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP D_rhopaloa_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP D_elegans_CG30271-PF RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP **.*********************************.**:********** D_melanogaster_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH D_sechellia_CG30271-PF SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH D_simulans_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH D_yakuba_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH D_erecta_CG30271-PF GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH D_takahashii_CG30271-PF HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH D_biarmipes_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH D_suzukii_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH D_eugracilis_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH D_ficusphila_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH D_rhopaloa_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH D_elegans_CG30271-PF SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH *:**********************:** ***********.********* D_melanogaster_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_sechellia_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_simulans_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_yakuba_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_erecta_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_takahashii_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_biarmipes_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_suzukii_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_eugracilis_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_ficusphila_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_rhopaloa_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV D_elegans_CG30271-PF WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV ************************************************** D_melanogaster_CG30271-PF PDAPRVSPDSATDWDALCDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS D_sechellia_CG30271-PF PDAPRVSPDSATDWEALCDEGG-VDNGAGDDASSKKLDIKVPPSVNGRKS D_simulans_CG30271-PF PDAPRVSPDSATDWEALCDEGG-VDNGAGGDASSKKLDIKVPPSVNGRKS D_yakuba_CG30271-PF PDAPRVSPDSATDWEALSDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS D_erecta_CG30271-PF PDAPRVSPDSATDWEALGDGSG-LENGAGGDAGSKKLDIKVPPSVNGRKS D_takahashii_CG30271-PF PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS D_biarmipes_CG30271-PF PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS D_suzukii_CG30271-PF PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS D_eugracilis_CG30271-PF PDAPRVSPDSATDWEALSDEGG-VDNGAGGDAGSKKLDIKVPPSVNGRKS D_ficusphila_CG30271-PF PDAPRVSPDSATDWEALSDDSG-LENGAGGDASSKKLDIKVPPAVNGRKS D_rhopaloa_CG30271-PF PDAPRVSPDSATDWEALSDDSG-VDSGAGGDAGSKKLDIKVPPSVNGRKS D_elegans_CG30271-PF PDAPRVSPDSATDWEALSDDSG-VDSGAVGDAGSKKLDIKVPPSVNGSKS *:************:** * .* ::.** .**.********.*:*** ** D_melanogaster_CG30271-PF LDDSLENTSELDTNDGILEELo D_sechellia_CG30271-PF LDDSLENSSELDTNDGIFEELo D_simulans_CG30271-PF LDDSLENTSELDTNDGIFEELo D_yakuba_CG30271-PF LDDSLENTSELDTNDGILEELo D_erecta_CG30271-PF LDDSLENTSELDTNDGILEELo D_takahashii_CG30271-PF LDDSLENTSELDTNDGILQEL- D_biarmipes_CG30271-PF LDDSLENTSELDTNDGILQEL- D_suzukii_CG30271-PF LDDSLENTSELDTNDGILQEL- D_eugracilis_CG30271-PF LDDSLENTSELDTNDGILQELo D_ficusphila_CG30271-PF LDDSLENTSELDTNDGILQELo D_rhopaloa_CG30271-PF LDDSLENTSELDTNDGILQELo D_elegans_CG30271-PF LDDSLENTSELDTNEGILQELo *******:******:**::**
>D_melanogaster_CG30271-PF ATGCCCATGAATGGACAGGCGGGTGGACAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATTGGCAAGTTGACGCGTATTTTATGGGGTGGCCAGGGCAAC AGACTATGCCAACAGGCCAGCAACAATGGTCGAGTGAAGCGCTTCCTCGC AGCCGTTCCCCATGTCATGAATGCCATCAAAGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC AGTGCACTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATACACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAATACCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAGACGGACATTACCGGAAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACACTGCTCACCCA AGCGGGTTGCGACGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGACGCCTT GTGCGATGAGAGTGGA---GTGGACAACGGAGCGGGGGGCGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCTTCTGTGAATGGCCGAAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTAGACACCAACGACGGAAT ATTGGAAGAGCTG--- >D_sechellia_CG30271-PF ATGCCCATGAATGGACAGGCGGGTGGGCAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGGGGGCCAGGGCAAT CGCCTGTGCCAACAGGCCAGCAACAATGGTCGAGTAAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC AGTGCGGTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATCCACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAGACGGACATTACCGGAAAAACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCAGGCTGCGACGAGGAGGCCGTAGATTATAAAATGAAGACCCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GTGCGATGAGGGTGGA---GTGGACAACGGAGCGGGAGACGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGCCGCAAATCG CTGGACGATAGCCTTGAGAACTCCTCGGAGCTGGACACCAACGACGGAAT ATTCGAAGAGCTG--- >D_simulans_CG30271-PF ATGCCCATGAATGGACAGGCGGGTGGCCAAAATATACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGGGGGCCAGGGCAAC CGCCTGTGCCAACAGGCCAGCAACAATGGTCGAGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAAGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC AGTGCGCTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATTCACAA GGCGGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAGACGGACATCACCGGAAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGACGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GTGCGATGAGGGTGGA---GTGGACAACGGAGCGGGCGGCGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGCCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGACGGAAT ATTCGAAGAGCTG--- >D_yakuba_CG30271-PF ATGCCCATGAATGGACAGGCGGGTGGCCAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATCAGGATCTGGATTCACG AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGGCAGGGCAAC CGACTGAGCCAACAGGCCAGCAACAATGGGCGAGTGAAGCGCTTCCTGGC AGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACGGTGCAGGCGCAACTGGAGCCACCGGTGCCC AGTGCACTGGTCACCTGCAAGGATGGCAACGGCTTGAACATCATCCACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACCGGCAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGATGAGGAGGCGGTCGACTATAAAATGAAGACCCCCTCCT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGACGAGAGTGGA---GTGGACAATGGAGCTGGTGGCGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAATGGACGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAATGACGGAAT ATTGGAAGAGCTG--- >D_erecta_CG30271-PF ATGCCCATGAATGGACAGGCGGGTGGCCAAAATGGACGCAAGCGTCGGGA CAACGAAGATTTCTCGGTGAAGCTATCCACCATCAGGATCTGGATACACG AGAAGGACATCGGCAAGTTGACGCGTATTTTGTGGGCGGGCCAGGGAAAC CGGCTGAGCCAACAGGCCAGCAACAATGGGCGAGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAATCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCC GGCGCACTGGTCACCTGCAAGGACGGCAATGGCTTGAACATCATCCACAA GGCCGCCGGACTGGGCCACACCAAGCTGCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACCGGGAAGACGCCACTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA GGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAGACCCCCTCTT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCACCTCGCGTCTCCCCCGACAGCGCCACCGACTGGGAGGCCTT GGGCGACGGCAGTGGA---TTGGAGAACGGAGCGGGCGGCGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCTGTGAACGGCCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACGAATGACGGAAT ATTGGAAGAGCTG--- >D_takahashii_CG30271-PF ATGCCGATGAATGGACAGGCGGGTGGACAAAATGGACGCAAGCGTCGCGA TAACGAAGATTTCTCGGTGAAGTTATCCACTATTCGGATCTGGATCCACG AGAAGGACATTGGCAAGCTGACGCGCATTTTGTGGGCGGGCATGGGCAAC CGCCTCAGTCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCATCAGGCGGTAA TCGACAACAATCTGGAGACCGTTCAGGCACAGCTGGAGCCGCCGGTTCCC CACGCACTGGTCACCTGCAAGGATGGCAACGGCCTCAACATTATCCACAA GGCCGCCGGGCTGGGCCACACCAAGATCCTCGAGTATCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATTACCGGGAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGAGGTGCTACACGCTGCTCACTCA AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAAACTCCCTCGT ACTACCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCGCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGCGCGGTGGACAACGGAGCGGGTGGAGATGCCGGCT CCAAGAAACTGGACATCAAGGTGGCGCCGTCCGTGAACGGTCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >D_biarmipes_CG30271-PF ATGCCGATGAATGGACAGGCGGGGGGTCAGAATGGACGCAAGCGGCGCGA CAACGAAGATTTCTCGGTGAAGCTATCCACCATTCGGATCTGGATTCACG AGAAGGACATTGGCAAGCTGACGCGTATTCTGTGGGCGGGCCAGGGCAAC CGCCTCAGCCAGCAGGCCAGCAACAACGGGCGTGTGAAGCGCTTCCTGGC CGCCGTGCCCCACGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAACCTGGAGACCGTGCAGGCGCAGCTGGAGCCACCGGTGCCG AGTGCCCTGGTCACCTGCAAGGACGGCAACGGCCTCAATATCATCCACAA GGCCGCCGGGCTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACCGGCAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGGTGCTACACCCTGCTGACCCA AGCGGGCTGCGACGAGGAGGCCGTGGATTATAAAATGAAAACTCCCTCGT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCCCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGACGACAGCGGAGCGGTGGACACCGGCGCGGGCGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTCCCTCCGTCCGTGAACGGTCGCAAATCG CTGGACGACAGCCTAGAGAACACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >D_suzukii_CG30271-PF ATGCCGATGAATGGACAGGAGGGTGGACAAAATGGACGTAAGCGTCGCGA CAACGAAGATTTCTCGGTGAAGCTATCCACCATTCGGATCTGGATTCACG AGAAGGACATTGGCAAGCTGACGCGTATCTTGTGGGCGGGCCAGGGCAAC CGCCTCAGTCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTGCCCCATGTCATGAATGCCATCAAGGATCTGCATCAGGCGGTCA TCGACAACAGTCTGGAGACCGTTCAGGCCCAGTTGGAACCACCGGTTCCC AGTGCCTTGGTCACCTGCAAGGACGGCAATGGCCTCAATATTATCCACAA GGCCGCCGGACTGGGTCACACCAAGATCCTGGAGTATCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGGTGGACATCACCGGGAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGAGGTGCTACACCCTGCTGACCCA AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAAACTCCCTCGT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGAGGCGCCCCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGAGTGGTGGACACCGGGGCGGCCGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTCCCTCCGTCCGTGAATGGTCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAATGATGGAAT ATTGCAAGAGCTG--- >D_eugracilis_CG30271-PF ATGCCGATGAATGGACAGGCGGGTGGACAGAATGGACGCAAGCGTCGCGA TAATGAAGATTTCTCGGTGAAGTTATCCACCATACGAATCTGGATTCACG AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGCCAGGGAAAC CGTCTCAGTCAGCAAGCTAGTAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TTGACAACAATCTGGAAACAGTGCAAGCACAGCTGGAGCCTCCGGTTCCA AGTGCCTTGGTTACCTGCAAGGACGGCAATGGCCTCAATATTATTCACAA GGCCGCAGGACTGGGTCACACCAAGATTCTAGAGTATCTGGTGGGCATTT GGCCCGAGGGCGCCCATGAAACAGACATCACCGGGAAGACGCCGCTTCAC TGGGCCGCCAGTGCCAAGAACAACATGAGATGCTACACTCTGCTCACCCA AGCGGGCTGTGATGAGGAGGCCGTCGATTATAAAATGAAGACTCCCTCAT ACTATCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCCCGTGTCTCCCCCGACAGTGCCACCGATTGGGAGGCCTT AAGCGATGAAGGTGGA---GTGGATAACGGTGCGGGAGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCCGTGAACGGTCGCAAGTCG CTGGATGACAGCCTTGAGAACACCTCAGAGCTGGACACCAATGATGGAAT ATTGCAAGAGCTG--- >D_ficusphila_CG30271-PF ATGCCGATGAATGGACAGACAGGTGGCCAAAATGGACGCAAGCGTCGCGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATACGGATCTGGATCCACG AGAAGGACATCGGCAAGCTGACTCGCATTTTGTGGGCGGGCCAGGGAAAT CGTTTGAGTCAACAAGCCAGCAACAATGGGCGTGTGAAGCGTTTCCTGGC CGCCGTGCCCCACGTCATGAATGCCATCAAAGATCTGCATCAGGCTGTCA TCGACAACAATCTGGAGACCGTTCAGGCGCAACTGGAGCCGCCAGTGCCA AGTGCCTTGGTTACTTGCAAGGATGGCAATGGCCTGAATATCATCCACAA GGCCGCCGGCTTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT GGCCCGAGGGCGCCCACGAGACGGACATCACTGGCAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGCTGCTACACTCTGCTCACTCA AGCGGGCTGCGACGAGGAGGCCGTCGACTATAAAATGAAGACACCTTCGT ACTATCGCCACAAGCCGCACGAAATCGAGCGGGCTTTCCTGGTTTATGTG CCGGATGCTCCGCGTGTTTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGA---CTGGAGAACGGTGCTGGTGGGGATGCCAGCT CCAAGAAACTGGACATCAAGGTGCCGCCTGCGGTGAATGGTCGCAAATCG CTGGATGACAGCCTCGAAAATACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >D_rhopaloa_CG30271-PF ATGCCGATGAATGGACAGACGGGTGGACAAAATGGACGCAAGCGCCGCGA CAACGAAGATTTCTCGGTGAAGTTATCCACCATTCGGATCTGGATTCATG AGAAGGACATCGGCAAGCTGACGCGCATTCTGTGGGCGGGCCAGGGCAAC CGCCTCAGCCAGCAGGCCAGCAACAATGGGCGTGTGAAGCGCTTCCTGGC CGCCGTTCCCCATGTCATGAATGCGATCAAGGATCTGCACCAGGCCGTCA TCGACAACAGCCTGGAGACCGTGCAAGCGCAGCTGGAGCCACCGGTTCCC AGTGCTTTGGTCACCTGCAAGGACGGCAACGGCCTCAATATCATCCACAA GGCCGCCGGGCTGGGACACACCAAGATCCTTGAGAACCTGGTGGGCATTT GGCCGGAGGGAGCCCACGAGACGGACATCACCGGGAAGACACCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGATGAGGAGGCCGTCGATTATAAAATGAAGACACCCTCGT ACTATCGGCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCGCGCGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGA---GTGGACAGCGGTGCGGGCGGGGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCGGTGAATGGCCGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGATGGAAT ATTGCAAGAGCTG--- >D_elegans_CG30271-PF ATGCCGATGAATGGACAGACGGGTGGACAAAATGGACGCAAGCGCCGTGA TAATGAAGATTTCTCGGTAAAGTTATCCACCATTCGGATCTGGATTCACG AGAAGGACATCGGCAAGCTGACGCGCATTTTGTGGGCGGGCCAGGGCAAC CGGCTCAGCCAGCAGGCCAGCAACAATGGGCGGGTGAAGCGCTTCCTGGC CGCCGTGCCCCATGTCATGAATGCCATCAAGGATCTGCACCAGGCGGTCA TCGACAACAGCCTGGAGAGCGTGCAGGCGCAGCTGGAGCCCCCGGTGCCC AGTGCTCTGGTAACGTGCAAGGACGGCAACGGGCTCAACATCATCCACAA GGCCGCCGGGCTGGGCCACACCAAGATCCTGGAGTACCTGGTGGGCATTT GGCCGGAGGGGGCCCACGAGACGGACATCACCGGGAAGACGCCGCTCCAC TGGGCCGCCAGTGCCAAGAACAACATGCGATGCTACACCCTGCTCACCCA AGCGGGCTGCGATGAGGAGGCCGTCGACTATAAAATGAAGACACCCTCCT ACTACCGCCACAAGCCGCACGAAATCGAGCGCGCCTTCCTGGTTTATGTG CCGGATGCGCCGCGTGTCTCCCCCGACAGCGCCACCGATTGGGAGGCCTT GAGCGATGACAGTGGC---GTGGACAGTGGCGCGGTCGGCGATGCCGGCT CCAAGAAACTGGACATCAAGGTGCCGCCGTCGGTGAACGGTAGCAAATCG CTGGACGACAGCCTTGAGAACACCTCGGAGCTGGACACCAACGAGGGAAT ATTGCAAGAGCTG---
>D_melanogaster_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWDALCDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEEL >D_sechellia_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SAVVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGG-VDNGAGDDASSKKLDIKVPPSVNGRKS LDDSLENSSELDTNDGIFEEL >D_simulans_CG30271-PF MPMNGQAGGQNIRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWGGQGN RLCQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALCDEGG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGIFEEL >D_yakuba_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDESG-VDNGAGGDASSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEEL >D_erecta_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP GALVTCKDGNGLNIIHKAAGLGHTKLLEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALGDGSG-LENGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILEEL >D_takahashii_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGMGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP HALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDNGAGGDAGSKKLDIKVAPSVNGRKS LDDSLENTSELDTNDGILQEL >D_biarmipes_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSGAVDTGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >D_suzukii_CG30271-PF MPMNGQEGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHEVDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PEAPRVSPDSATDWEALSDDSGVVDTGAAGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >D_eugracilis_CG30271-PF MPMNGQAGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDEGG-VDNGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >D_ficusphila_CG30271-PF MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNNLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-LENGAGGDASSKKLDIKVPPAVNGRKS LDDSLENTSELDTNDGILQEL >D_rhopaloa_CG30271-PF MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLETVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILENLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-VDSGAGGDAGSKKLDIKVPPSVNGRKS LDDSLENTSELDTNDGILQEL >D_elegans_CG30271-PF MPMNGQTGGQNGRKRRDNEDFSVKLSTIRIWIHEKDIGKLTRILWAGQGN RLSQQASNNGRVKRFLAAVPHVMNAIKDLHQAVIDNSLESVQAQLEPPVP SALVTCKDGNGLNIIHKAAGLGHTKILEYLVGIWPEGAHETDITGKTPLH WAASAKNNMRCYTLLTQAGCDEEAVDYKMKTPSYYRHKPHEIERAFLVYV PDAPRVSPDSATDWEALSDDSG-VDSGAVGDAGSKKLDIKVPPSVNGSKS LDDSLENTSELDTNEGILQEL
#NEXUS [ID: 5313344058] begin taxa; dimensions ntax=12; taxlabels D_melanogaster_CG30271-PF D_sechellia_CG30271-PF D_simulans_CG30271-PF D_yakuba_CG30271-PF D_erecta_CG30271-PF D_takahashii_CG30271-PF D_biarmipes_CG30271-PF D_suzukii_CG30271-PF D_eugracilis_CG30271-PF D_ficusphila_CG30271-PF D_rhopaloa_CG30271-PF D_elegans_CG30271-PF ; end; begin trees; translate 1 D_melanogaster_CG30271-PF, 2 D_sechellia_CG30271-PF, 3 D_simulans_CG30271-PF, 4 D_yakuba_CG30271-PF, 5 D_erecta_CG30271-PF, 6 D_takahashii_CG30271-PF, 7 D_biarmipes_CG30271-PF, 8 D_suzukii_CG30271-PF, 9 D_eugracilis_CG30271-PF, 10 D_ficusphila_CG30271-PF, 11 D_rhopaloa_CG30271-PF, 12 D_elegans_CG30271-PF ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.04784665,(4:0.04169322,5:0.04705453,(((6:0.07731008,(7:0.0614275,8:0.04916492)0.887:0.0221056)0.599:0.01095661,9:0.1220757)0.568:0.01282729,(10:0.1676931,(11:0.03710276,12:0.07698621)0.938:0.02119418)0.524:0.01675518)1.000:0.0836193)1.000:0.02763659,(2:0.03105838,3:0.01201594)0.914:0.009299402); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.04784665,(4:0.04169322,5:0.04705453,(((6:0.07731008,(7:0.0614275,8:0.04916492):0.0221056):0.01095661,9:0.1220757):0.01282729,(10:0.1676931,(11:0.03710276,12:0.07698621):0.02119418):0.01675518):0.0836193):0.02763659,(2:0.03105838,3:0.01201594):0.009299402); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2826.99 -2847.09 2 -2826.03 -2842.39 -------------------------------------- TOTAL -2826.40 -2846.40 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/105/CG30271-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 1.006019 0.009274 0.811624 1.189277 1.004319 1476.02 1488.51 1.000 r(A<->C){all} 0.092153 0.000337 0.058252 0.128712 0.091092 747.90 922.65 1.000 r(A<->G){all} 0.171612 0.000763 0.117693 0.224880 0.170491 950.21 980.21 1.000 r(A<->T){all} 0.081748 0.000654 0.036707 0.131569 0.079744 703.63 764.41 1.000 r(C<->G){all} 0.071254 0.000184 0.047356 0.099208 0.070426 1128.76 1201.33 1.000 r(C<->T){all} 0.488384 0.001558 0.416168 0.567437 0.487702 911.30 941.30 1.001 r(G<->T){all} 0.094849 0.000416 0.055688 0.134208 0.093584 937.17 1033.83 1.000 pi(A){all} 0.240563 0.000217 0.210593 0.268612 0.239931 1046.64 1090.30 1.001 pi(C){all} 0.290600 0.000209 0.263007 0.318780 0.290298 1040.86 1182.79 1.000 pi(G){all} 0.306362 0.000230 0.277052 0.336315 0.306136 1366.16 1408.92 1.001 pi(T){all} 0.162474 0.000132 0.139735 0.183871 0.162357 976.29 1075.19 1.000 alpha{1,2} 0.140327 0.000315 0.108565 0.175374 0.138831 1060.91 1237.79 1.000 alpha{3} 2.913458 0.694472 1.573391 4.715483 2.786817 1140.77 1213.26 1.000 pinvar{all} 0.422813 0.001944 0.330373 0.505072 0.423858 1324.85 1382.94 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/105/CG30271-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 12 ls = 270 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 2 0 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0 TTC 3 4 4 3 3 3 | TCC 3 4 3 4 3 4 | TAC 3 3 3 3 3 3 | TGC 5 5 5 3 3 3 Leu TTA 2 1 1 1 0 1 | TCA 1 1 1 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 4 4 4 4 6 3 | TCG 3 3 3 3 3 4 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 1 1 1 1 1 | Pro CCT 2 1 1 1 1 0 | His CAT 2 2 2 1 1 2 | Arg CGT 2 2 2 1 2 2 CTC 3 2 2 2 2 5 | CCC 6 6 6 6 6 5 | CAC 7 7 7 8 8 8 | CGC 5 7 7 7 6 9 CTA 2 0 0 0 1 0 | CCA 1 1 1 1 2 0 | Gln CAA 3 3 3 4 2 3 | CGA 3 2 2 3 2 0 CTG 13 15 16 17 16 14 | CCG 5 6 6 6 5 8 | CAG 6 6 6 5 7 6 | CGG 1 1 1 1 2 1 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 4 4 3 2 6 | Thr ACT 0 0 0 0 0 3 | Asn AAT 7 8 7 8 7 5 | Ser AGT 3 2 2 3 2 3 ATC 7 9 9 10 10 8 | ACC 10 10 11 10 10 7 | AAC 10 9 10 9 10 12 | AGC 4 4 4 6 4 4 ATA 2 1 2 1 2 1 | ACA 1 0 0 0 0 0 | Lys AAA 4 4 4 3 3 4 | Arg AGA 1 0 0 0 0 0 Met ATG 5 5 5 5 5 6 | ACG 3 3 3 4 4 4 | AAG 14 14 14 15 15 14 | AGG 1 1 1 1 1 1 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 4 | Ala GCT 0 0 0 1 0 0 | Asp GAT 7 8 7 7 6 11 | Gly GGT 4 3 3 2 1 3 GTC 5 4 5 5 5 4 | GCC 14 15 14 13 15 15 | GAC 14 13 13 13 13 10 | GGC 10 10 13 11 16 11 GTA 0 2 0 0 0 1 | GCA 3 2 1 3 2 2 | Glu GAA 4 3 3 3 3 2 | GGA 8 8 6 7 7 6 GTG 9 9 9 9 8 7 | GCG 5 5 7 6 6 7 | GAG 12 14 14 14 14 13 | GGG 1 2 1 2 2 3 -------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 3 4 4 3 3 2 | Cys TGT 0 0 1 0 0 0 TTC 3 3 3 3 3 3 | TCC 4 4 4 3 3 4 | TAC 3 2 2 3 2 4 | TGC 3 3 2 3 3 3 Leu TTA 0 0 2 1 1 1 | TCA 0 0 2 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 2 5 3 6 3 3 | TCG 4 4 2 4 5 4 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 1 2 0 2 1 | Pro CCT 1 1 1 2 0 0 | His CAT 0 2 2 1 2 1 | Arg CGT 2 4 4 5 1 2 CTC 3 3 3 3 4 4 | CCC 5 6 5 3 4 5 | CAC 9 7 7 8 7 8 | CGC 8 7 7 6 9 6 CTA 2 1 1 0 0 0 | CCA 1 1 1 2 1 0 | Gln CAA 2 3 4 6 4 3 | CGA 0 0 1 0 1 1 CTG 17 14 13 15 14 15 | CCG 7 6 7 7 9 9 | CAG 8 7 6 4 6 7 | CGG 3 1 0 2 2 3 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 5 5 7 2 4 4 | Thr ACT 1 1 2 5 0 0 | Asn AAT 4 8 9 10 6 5 | Ser AGT 2 5 5 4 3 4 ATC 9 9 6 11 10 10 | ACC 11 11 8 6 10 8 | AAC 12 7 8 7 10 10 | AGC 6 4 2 5 7 8 ATA 1 1 2 2 1 1 | ACA 0 0 2 2 2 1 | Lys AAA 4 4 2 4 3 3 | Arg AGA 0 0 1 0 0 0 Met ATG 5 5 5 5 5 5 | ACG 3 2 2 2 3 5 | AAG 14 14 16 14 15 15 | AGG 0 1 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 3 4 4 3 1 | Ala GCT 0 0 1 4 1 1 | Asp GAT 7 8 12 9 9 8 | Gly GGT 2 3 5 4 2 2 GTC 5 6 4 3 5 5 | GCC 16 18 14 15 15 15 | GAC 14 12 8 11 12 12 | GGC 13 9 8 11 10 11 GTA 0 0 0 0 0 2 | GCA 0 0 2 0 0 0 | Glu GAA 2 3 5 3 2 2 | GGA 4 6 8 5 7 4 GTG 10 8 8 8 8 9 | GCG 7 5 6 4 6 6 | GAG 13 14 11 13 13 14 | GGG 4 4 3 2 4 5 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_CG30271-PF position 1: T:0.12222 C:0.22963 A:0.28519 G:0.36296 position 2: T:0.23333 C:0.21481 A:0.35556 G:0.19630 position 3: T:0.14444 C:0.40370 A:0.12963 G:0.32222 Average T:0.16667 C:0.28272 A:0.25679 G:0.29383 #2: D_sechellia_CG30271-PF position 1: T:0.12593 C:0.22963 A:0.27407 G:0.37037 position 2: T:0.23333 C:0.21481 A:0.35926 G:0.19259 position 3: T:0.13704 C:0.41481 A:0.10370 G:0.34444 Average T:0.16543 C:0.28642 A:0.24568 G:0.30247 #3: D_simulans_CG30271-PF position 1: T:0.12222 C:0.23333 A:0.28148 G:0.36296 position 2: T:0.23704 C:0.21481 A:0.35556 G:0.19259 position 3: T:0.12963 C:0.42963 A:0.08889 G:0.35185 Average T:0.16296 C:0.29259 A:0.24198 G:0.30247 #4: D_yakuba_CG30271-PF position 1: T:0.11111 C:0.23704 A:0.28889 G:0.36296 position 2: T:0.23333 C:0.21852 A:0.35556 G:0.19259 position 3: T:0.12593 C:0.41852 A:0.09630 G:0.35926 Average T:0.15679 C:0.29136 A:0.24691 G:0.30494 #5: D_erecta_CG30271-PF position 1: T:0.11481 C:0.23704 A:0.27778 G:0.37037 position 2: T:0.23333 C:0.21852 A:0.35185 G:0.19630 position 3: T:0.11111 C:0.43333 A:0.08889 G:0.36667 Average T:0.15309 C:0.29630 A:0.23951 G:0.31111 #6: D_takahashii_CG30271-PF position 1: T:0.10741 C:0.23704 A:0.28889 G:0.36667 position 2: T:0.23704 C:0.21852 A:0.35556 G:0.18889 position 3: T:0.15926 C:0.41111 A:0.07407 G:0.35556 Average T:0.16790 C:0.28889 A:0.23951 G:0.30370 #7: D_biarmipes_CG30271-PF position 1: T:0.10000 C:0.25185 A:0.28519 G:0.36296 position 2: T:0.23333 C:0.22222 A:0.35185 G:0.19259 position 3: T:0.10370 C:0.45926 A:0.05926 G:0.37778 Average T:0.14568 C:0.31111 A:0.23210 G:0.31111 #8: D_suzukii_CG30271-PF position 1: T:0.11111 C:0.23704 A:0.28519 G:0.36667 position 2: T:0.23704 C:0.21852 A:0.35185 G:0.19259 position 3: T:0.16667 C:0.41111 A:0.07037 G:0.35185 Average T:0.17160 C:0.28889 A:0.23580 G:0.30370 #9: D_eugracilis_CG30271-PF position 1: T:0.11111 C:0.23704 A:0.28519 G:0.36667 position 2: T:0.23333 C:0.21852 A:0.35556 G:0.19259 position 3: T:0.21852 C:0.33704 A:0.12222 G:0.32222 Average T:0.18765 C:0.26420 A:0.25432 G:0.29383 #10: D_ficusphila_CG30271-PF position 1: T:0.11481 C:0.23704 A:0.29259 G:0.35556 position 2: T:0.23333 C:0.21852 A:0.35556 G:0.19259 position 3: T:0.19630 C:0.37407 A:0.09259 G:0.33704 Average T:0.18148 C:0.27654 A:0.24691 G:0.29506 #11: D_rhopaloa_CG30271-PF position 1: T:0.10370 C:0.24444 A:0.29259 G:0.35926 position 2: T:0.23333 C:0.21852 A:0.34815 G:0.20000 position 3: T:0.13333 C:0.42222 A:0.08148 G:0.36296 Average T:0.15679 C:0.29506 A:0.24074 G:0.30741 #12: D_elegans_CG30271-PF position 1: T:0.10741 C:0.24074 A:0.29259 G:0.35926 position 2: T:0.23704 C:0.21481 A:0.34815 G:0.20000 position 3: T:0.11481 C:0.42963 A:0.06667 G:0.38889 Average T:0.15309 C:0.29506 A:0.23580 G:0.31605 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 0 | Ser S TCT 6 | Tyr Y TAT 37 | Cys C TGT 1 TTC 38 | TCC 43 | TAC 34 | TGC 41 Leu L TTA 11 | TCA 5 | *** * TAA 0 | *** * TGA 0 TTG 47 | TCG 42 | TAG 0 | Trp W TGG 60 ------------------------------------------------------------------------------ Leu L CTT 12 | Pro P CCT 11 | His H CAT 18 | Arg R CGT 29 CTC 36 | CCC 63 | CAC 91 | CGC 84 CTA 7 | CCA 12 | Gln Q CAA 40 | CGA 15 CTG 179 | CCG 81 | CAG 74 | CGG 18 ------------------------------------------------------------------------------ Ile I ATT 51 | Thr T ACT 12 | Asn N AAT 84 | Ser S AGT 38 ATC 108 | ACC 112 | AAC 114 | AGC 58 ATA 17 | ACA 8 | Lys K AAA 42 | Arg R AGA 2 Met M ATG 61 | ACG 38 | AAG 174 | AGG 7 ------------------------------------------------------------------------------ Val V GTT 30 | Ala A GCT 8 | Asp D GAT 99 | Gly G GGT 34 GTC 56 | GCC 179 | GAC 145 | GGC 133 GTA 5 | GCA 15 | Glu E GAA 35 | GGA 76 GTG 102 | GCG 70 | GAG 159 | GGG 33 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.11265 C:0.23765 A:0.28580 G:0.36389 position 2: T:0.23457 C:0.21759 A:0.35370 G:0.19414 position 3: T:0.14506 C:0.41204 A:0.08951 G:0.35340 Average T:0.16409 C:0.28909 A:0.24300 G:0.30381 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_CG30271-PF D_sechellia_CG30271-PF 0.0836 (0.0114 0.1366) D_simulans_CG30271-PF 0.0924 (0.0098 0.1058) 0.1248 (0.0081 0.0652) D_yakuba_CG30271-PF 0.0303 (0.0065 0.2146) 0.0722 (0.0131 0.1811) 0.0769 (0.0114 0.1486) D_erecta_CG30271-PF 0.0743 (0.0156 0.2096) 0.1414 (0.0222 0.1573) 0.1716 (0.0206 0.1199) 0.0707 (0.0106 0.1504) D_takahashii_CG30271-PF 0.0623 (0.0255 0.4092) 0.0827 (0.0314 0.3792) 0.0789 (0.0289 0.3656) 0.0483 (0.0172 0.3561) 0.0582 (0.0206 0.3534) D_biarmipes_CG30271-PF 0.0458 (0.0189 0.4123) 0.0709 (0.0247 0.3488) 0.0695 (0.0222 0.3200) 0.0296 (0.0106 0.3596) 0.0470 (0.0156 0.3325) 0.0324 (0.0098 0.3018) D_suzukii_CG30271-PF 0.0692 (0.0289 0.4174) 0.0962 (0.0348 0.3613) 0.0972 (0.0322 0.3318) 0.0539 (0.0205 0.3809) 0.0761 (0.0256 0.3364) 0.0908 (0.0197 0.2165) 0.0489 (0.0098 0.2002) D_eugracilis_CG30271-PF 0.0292 (0.0172 0.5881) 0.0379 (0.0197 0.5188) 0.0357 (0.0172 0.4823) 0.0165 (0.0090 0.5423) 0.0334 (0.0164 0.4915) 0.0288 (0.0114 0.3957) 0.0101 (0.0049 0.4823) 0.0427 (0.0150 0.3507) D_ficusphila_CG30271-PF 0.0360 (0.0205 0.5691) 0.0525 (0.0263 0.5011) 0.0512 (0.0238 0.4654) 0.0275 (0.0122 0.4449) 0.0262 (0.0139 0.5301) 0.0443 (0.0196 0.4437) 0.0241 (0.0114 0.4752) 0.0498 (0.0230 0.4618) 0.0277 (0.0147 0.5309) D_rhopaloa_CG30271-PF 0.0627 (0.0239 0.3807) 0.0955 (0.0297 0.3114) 0.0959 (0.0272 0.2838) 0.0483 (0.0156 0.3218) 0.0644 (0.0206 0.3194) 0.0523 (0.0147 0.2812) 0.0263 (0.0065 0.2483) 0.0506 (0.0131 0.2583) 0.0243 (0.0098 0.4025) 0.0290 (0.0131 0.4507) D_elegans_CG30271-PF 0.0681 (0.0272 0.3992) 0.0997 (0.0339 0.3403) 0.1075 (0.0322 0.2999) 0.0763 (0.0214 0.2799) 0.0840 (0.0256 0.3045) 0.0717 (0.0197 0.2743) 0.0400 (0.0114 0.2858) 0.0474 (0.0164 0.3447) 0.0349 (0.0155 0.4447) 0.0382 (0.0180 0.4712) 0.0404 (0.0081 0.2017) Model 0: one-ratio TREE # 1: (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 lnL(ntime: 20 np: 22): -2666.629381 +0.000000 13..1 13..14 14..4 14..5 14..15 15..16 16..17 17..6 17..18 18..7 18..8 16..9 15..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3 0.069976 0.040758 0.064875 0.076677 0.134090 0.023935 0.012843 0.117748 0.033761 0.110296 0.058744 0.176045 0.015140 0.241614 0.040159 0.049136 0.119178 0.016237 0.048830 0.017444 1.762833 0.031425 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.46749 (1: 0.069976, (4: 0.064875, 5: 0.076677, (((6: 0.117748, (7: 0.110296, 8: 0.058744): 0.033761): 0.012843, 9: 0.176045): 0.023935, (10: 0.241614, (11: 0.049136, 12: 0.119178): 0.040159): 0.015140): 0.134090): 0.040758, (2: 0.048830, 3: 0.017444): 0.016237); (D_melanogaster_CG30271-PF: 0.069976, (D_yakuba_CG30271-PF: 0.064875, D_erecta_CG30271-PF: 0.076677, (((D_takahashii_CG30271-PF: 0.117748, (D_biarmipes_CG30271-PF: 0.110296, D_suzukii_CG30271-PF: 0.058744): 0.033761): 0.012843, D_eugracilis_CG30271-PF: 0.176045): 0.023935, (D_ficusphila_CG30271-PF: 0.241614, (D_rhopaloa_CG30271-PF: 0.049136, D_elegans_CG30271-PF: 0.119178): 0.040159): 0.015140): 0.134090): 0.040758, (D_sechellia_CG30271-PF: 0.048830, D_simulans_CG30271-PF: 0.017444): 0.016237); Detailed output identifying parameters kappa (ts/tv) = 1.76283 omega (dN/dS) = 0.03142 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.070 659.3 150.7 0.0314 0.0035 0.1102 2.3 16.6 13..14 0.041 659.3 150.7 0.0314 0.0020 0.0642 1.3 9.7 14..4 0.065 659.3 150.7 0.0314 0.0032 0.1022 2.1 15.4 14..5 0.077 659.3 150.7 0.0314 0.0038 0.1208 2.5 18.2 14..15 0.134 659.3 150.7 0.0314 0.0066 0.2112 4.4 31.8 15..16 0.024 659.3 150.7 0.0314 0.0012 0.0377 0.8 5.7 16..17 0.013 659.3 150.7 0.0314 0.0006 0.0202 0.4 3.0 17..6 0.118 659.3 150.7 0.0314 0.0058 0.1854 3.8 27.9 17..18 0.034 659.3 150.7 0.0314 0.0017 0.0532 1.1 8.0 18..7 0.110 659.3 150.7 0.0314 0.0055 0.1737 3.6 26.2 18..8 0.059 659.3 150.7 0.0314 0.0029 0.0925 1.9 13.9 16..9 0.176 659.3 150.7 0.0314 0.0087 0.2773 5.7 41.8 15..19 0.015 659.3 150.7 0.0314 0.0007 0.0238 0.5 3.6 19..10 0.242 659.3 150.7 0.0314 0.0120 0.3805 7.9 57.4 19..20 0.040 659.3 150.7 0.0314 0.0020 0.0632 1.3 9.5 20..11 0.049 659.3 150.7 0.0314 0.0024 0.0774 1.6 11.7 20..12 0.119 659.3 150.7 0.0314 0.0059 0.1877 3.9 28.3 13..21 0.016 659.3 150.7 0.0314 0.0008 0.0256 0.5 3.9 21..2 0.049 659.3 150.7 0.0314 0.0024 0.0769 1.6 11.6 21..3 0.017 659.3 150.7 0.0314 0.0009 0.0275 0.6 4.1 tree length for dN: 0.0726 tree length for dS: 2.3112 Time used: 0:18 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 lnL(ntime: 20 np: 23): -2660.988257 +0.000000 13..1 13..14 14..4 14..5 14..15 15..16 16..17 17..6 17..18 18..7 18..8 16..9 15..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3 0.071079 0.042441 0.066566 0.076797 0.135199 0.025341 0.013203 0.118784 0.034940 0.111247 0.059170 0.179770 0.013303 0.246911 0.040628 0.050064 0.120590 0.016248 0.049639 0.017817 1.801657 0.970220 0.021037 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.48974 (1: 0.071079, (4: 0.066566, 5: 0.076797, (((6: 0.118784, (7: 0.111247, 8: 0.059170): 0.034940): 0.013203, 9: 0.179770): 0.025341, (10: 0.246911, (11: 0.050064, 12: 0.120590): 0.040628): 0.013303): 0.135199): 0.042441, (2: 0.049639, 3: 0.017817): 0.016248); (D_melanogaster_CG30271-PF: 0.071079, (D_yakuba_CG30271-PF: 0.066566, D_erecta_CG30271-PF: 0.076797, (((D_takahashii_CG30271-PF: 0.118784, (D_biarmipes_CG30271-PF: 0.111247, D_suzukii_CG30271-PF: 0.059170): 0.034940): 0.013203, D_eugracilis_CG30271-PF: 0.179770): 0.025341, (D_ficusphila_CG30271-PF: 0.246911, (D_rhopaloa_CG30271-PF: 0.050064, D_elegans_CG30271-PF: 0.120590): 0.040628): 0.013303): 0.135199): 0.042441, (D_sechellia_CG30271-PF: 0.049639, D_simulans_CG30271-PF: 0.017817): 0.016248); Detailed output identifying parameters kappa (ts/tv) = 1.80166 dN/dS (w) for site classes (K=2) p: 0.97022 0.02978 w: 0.02104 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.071 658.8 151.2 0.0502 0.0052 0.1042 3.4 15.7 13..14 0.042 658.8 151.2 0.0502 0.0031 0.0622 2.1 9.4 14..4 0.067 658.8 151.2 0.0502 0.0049 0.0976 3.2 14.7 14..5 0.077 658.8 151.2 0.0502 0.0056 0.1126 3.7 17.0 14..15 0.135 658.8 151.2 0.0502 0.0099 0.1981 6.6 30.0 15..16 0.025 658.8 151.2 0.0502 0.0019 0.0371 1.2 5.6 16..17 0.013 658.8 151.2 0.0502 0.0010 0.0194 0.6 2.9 17..6 0.119 658.8 151.2 0.0502 0.0087 0.1741 5.8 26.3 17..18 0.035 658.8 151.2 0.0502 0.0026 0.0512 1.7 7.7 18..7 0.111 658.8 151.2 0.0502 0.0082 0.1630 5.4 24.6 18..8 0.059 658.8 151.2 0.0502 0.0044 0.0867 2.9 13.1 16..9 0.180 658.8 151.2 0.0502 0.0132 0.2635 8.7 39.8 15..19 0.013 658.8 151.2 0.0502 0.0010 0.0195 0.6 2.9 19..10 0.247 658.8 151.2 0.0502 0.0182 0.3619 12.0 54.7 19..20 0.041 658.8 151.2 0.0502 0.0030 0.0595 2.0 9.0 20..11 0.050 658.8 151.2 0.0502 0.0037 0.0734 2.4 11.1 20..12 0.121 658.8 151.2 0.0502 0.0089 0.1767 5.8 26.7 13..21 0.016 658.8 151.2 0.0502 0.0012 0.0238 0.8 3.6 21..2 0.050 658.8 151.2 0.0502 0.0037 0.0727 2.4 11.0 21..3 0.018 658.8 151.2 0.0502 0.0013 0.0261 0.9 3.9 Time used: 0:48 Model 2: PositiveSelection (3 categories) TREE # 1: (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 check convergence.. lnL(ntime: 20 np: 25): -2660.988257 +0.000000 13..1 13..14 14..4 14..5 14..15 15..16 16..17 17..6 17..18 18..7 18..8 16..9 15..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3 0.071080 0.042441 0.066567 0.076797 0.135199 0.025341 0.013203 0.118784 0.034940 0.111247 0.059170 0.179771 0.013303 0.246911 0.040628 0.050064 0.120590 0.016248 0.049639 0.017817 1.801659 0.970220 0.029780 0.021037 60.368590 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.48974 (1: 0.071080, (4: 0.066567, 5: 0.076797, (((6: 0.118784, (7: 0.111247, 8: 0.059170): 0.034940): 0.013203, 9: 0.179771): 0.025341, (10: 0.246911, (11: 0.050064, 12: 0.120590): 0.040628): 0.013303): 0.135199): 0.042441, (2: 0.049639, 3: 0.017817): 0.016248); (D_melanogaster_CG30271-PF: 0.071080, (D_yakuba_CG30271-PF: 0.066567, D_erecta_CG30271-PF: 0.076797, (((D_takahashii_CG30271-PF: 0.118784, (D_biarmipes_CG30271-PF: 0.111247, D_suzukii_CG30271-PF: 0.059170): 0.034940): 0.013203, D_eugracilis_CG30271-PF: 0.179771): 0.025341, (D_ficusphila_CG30271-PF: 0.246911, (D_rhopaloa_CG30271-PF: 0.050064, D_elegans_CG30271-PF: 0.120590): 0.040628): 0.013303): 0.135199): 0.042441, (D_sechellia_CG30271-PF: 0.049639, D_simulans_CG30271-PF: 0.017817): 0.016248); Detailed output identifying parameters kappa (ts/tv) = 1.80166 dN/dS (w) for site classes (K=3) p: 0.97022 0.02978 0.00000 w: 0.02104 1.00000 60.36859 (note that p[2] is zero) dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.071 658.8 151.2 0.0502 0.0052 0.1042 3.4 15.7 13..14 0.042 658.8 151.2 0.0502 0.0031 0.0622 2.1 9.4 14..4 0.067 658.8 151.2 0.0502 0.0049 0.0976 3.2 14.7 14..5 0.077 658.8 151.2 0.0502 0.0056 0.1126 3.7 17.0 14..15 0.135 658.8 151.2 0.0502 0.0099 0.1981 6.6 30.0 15..16 0.025 658.8 151.2 0.0502 0.0019 0.0371 1.2 5.6 16..17 0.013 658.8 151.2 0.0502 0.0010 0.0194 0.6 2.9 17..6 0.119 658.8 151.2 0.0502 0.0087 0.1741 5.8 26.3 17..18 0.035 658.8 151.2 0.0502 0.0026 0.0512 1.7 7.7 18..7 0.111 658.8 151.2 0.0502 0.0082 0.1630 5.4 24.6 18..8 0.059 658.8 151.2 0.0502 0.0044 0.0867 2.9 13.1 16..9 0.180 658.8 151.2 0.0502 0.0132 0.2635 8.7 39.8 15..19 0.013 658.8 151.2 0.0502 0.0010 0.0195 0.6 2.9 19..10 0.247 658.8 151.2 0.0502 0.0182 0.3619 12.0 54.7 19..20 0.041 658.8 151.2 0.0502 0.0030 0.0595 2.0 9.0 20..11 0.050 658.8 151.2 0.0502 0.0037 0.0734 2.4 11.1 20..12 0.121 658.8 151.2 0.0502 0.0089 0.1767 5.8 26.7 13..21 0.016 658.8 151.2 0.0502 0.0012 0.0238 0.8 3.6 21..2 0.050 658.8 151.2 0.0502 0.0037 0.0727 2.4 11.0 21..3 0.018 658.8 151.2 0.0502 0.0013 0.0261 0.9 3.9 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG30271-PF) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.413 0.120 0.076 0.063 0.057 0.055 0.054 0.054 0.054 0.054 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 2:22 Model 3: discrete (3 categories) TREE # 1: (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 lnL(ntime: 20 np: 26): -2644.349780 +0.000000 13..1 13..14 14..4 14..5 14..15 15..16 16..17 17..6 17..18 18..7 18..8 16..9 15..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3 0.070691 0.041641 0.065870 0.076847 0.135405 0.024501 0.012953 0.119147 0.034380 0.111598 0.059455 0.179095 0.014445 0.245062 0.040594 0.049711 0.120574 0.016287 0.049256 0.017628 1.761986 0.369098 0.463772 0.000001 0.000001 0.209458 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.48514 (1: 0.070691, (4: 0.065870, 5: 0.076847, (((6: 0.119147, (7: 0.111598, 8: 0.059455): 0.034380): 0.012953, 9: 0.179095): 0.024501, (10: 0.245062, (11: 0.049711, 12: 0.120574): 0.040594): 0.014445): 0.135405): 0.041641, (2: 0.049256, 3: 0.017628): 0.016287); (D_melanogaster_CG30271-PF: 0.070691, (D_yakuba_CG30271-PF: 0.065870, D_erecta_CG30271-PF: 0.076847, (((D_takahashii_CG30271-PF: 0.119147, (D_biarmipes_CG30271-PF: 0.111598, D_suzukii_CG30271-PF: 0.059455): 0.034380): 0.012953, D_eugracilis_CG30271-PF: 0.179095): 0.024501, (D_ficusphila_CG30271-PF: 0.245062, (D_rhopaloa_CG30271-PF: 0.049711, D_elegans_CG30271-PF: 0.120574): 0.040594): 0.014445): 0.135405): 0.041641, (D_sechellia_CG30271-PF: 0.049256, D_simulans_CG30271-PF: 0.017628): 0.016287); Detailed output identifying parameters kappa (ts/tv) = 1.76199 dN/dS (w) for site classes (K=3) p: 0.36910 0.46377 0.16713 w: 0.00000 0.00000 0.20946 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.071 659.3 150.7 0.0350 0.0038 0.1098 2.5 16.6 13..14 0.042 659.3 150.7 0.0350 0.0023 0.0647 1.5 9.7 14..4 0.066 659.3 150.7 0.0350 0.0036 0.1023 2.4 15.4 14..5 0.077 659.3 150.7 0.0350 0.0042 0.1194 2.8 18.0 14..15 0.135 659.3 150.7 0.0350 0.0074 0.2104 4.9 31.7 15..16 0.025 659.3 150.7 0.0350 0.0013 0.0381 0.9 5.7 16..17 0.013 659.3 150.7 0.0350 0.0007 0.0201 0.5 3.0 17..6 0.119 659.3 150.7 0.0350 0.0065 0.1851 4.3 27.9 17..18 0.034 659.3 150.7 0.0350 0.0019 0.0534 1.2 8.0 18..7 0.112 659.3 150.7 0.0350 0.0061 0.1734 4.0 26.1 18..8 0.059 659.3 150.7 0.0350 0.0032 0.0924 2.1 13.9 16..9 0.179 659.3 150.7 0.0350 0.0097 0.2783 6.4 41.9 15..19 0.014 659.3 150.7 0.0350 0.0008 0.0224 0.5 3.4 19..10 0.245 659.3 150.7 0.0350 0.0133 0.3807 8.8 57.4 19..20 0.041 659.3 150.7 0.0350 0.0022 0.0631 1.5 9.5 20..11 0.050 659.3 150.7 0.0350 0.0027 0.0772 1.8 11.6 20..12 0.121 659.3 150.7 0.0350 0.0066 0.1873 4.3 28.2 13..21 0.016 659.3 150.7 0.0350 0.0009 0.0253 0.6 3.8 21..2 0.049 659.3 150.7 0.0350 0.0027 0.0765 1.8 11.5 21..3 0.018 659.3 150.7 0.0350 0.0010 0.0274 0.6 4.1 Naive Empirical Bayes (NEB) analysis Time used: 3:12 Model 7: beta (10 categories) TREE # 1: (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 check convergence.. lnL(ntime: 20 np: 23): -2645.430377 +0.000000 13..1 13..14 14..4 14..5 14..15 15..16 16..17 17..6 17..18 18..7 18..8 16..9 15..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3 0.070217 0.041447 0.065535 0.076303 0.134429 0.024466 0.012858 0.118186 0.034176 0.110777 0.059013 0.177842 0.014151 0.243649 0.040290 0.049399 0.119826 0.016171 0.048947 0.017524 1.760255 0.075409 1.813558 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.47520 (1: 0.070217, (4: 0.065535, 5: 0.076303, (((6: 0.118186, (7: 0.110777, 8: 0.059013): 0.034176): 0.012858, 9: 0.177842): 0.024466, (10: 0.243649, (11: 0.049399, 12: 0.119826): 0.040290): 0.014151): 0.134429): 0.041447, (2: 0.048947, 3: 0.017524): 0.016171); (D_melanogaster_CG30271-PF: 0.070217, (D_yakuba_CG30271-PF: 0.065535, D_erecta_CG30271-PF: 0.076303, (((D_takahashii_CG30271-PF: 0.118186, (D_biarmipes_CG30271-PF: 0.110777, D_suzukii_CG30271-PF: 0.059013): 0.034176): 0.012858, D_eugracilis_CG30271-PF: 0.177842): 0.024466, (D_ficusphila_CG30271-PF: 0.243649, (D_rhopaloa_CG30271-PF: 0.049399, D_elegans_CG30271-PF: 0.119826): 0.040290): 0.014151): 0.134429): 0.041447, (D_sechellia_CG30271-PF: 0.048947, D_simulans_CG30271-PF: 0.017524): 0.016171); Detailed output identifying parameters kappa (ts/tv) = 1.76025 Parameters in M7 (beta): p = 0.07541 q = 1.81356 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00016 0.00143 0.00959 0.05208 0.26950 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.070 659.3 150.7 0.0333 0.0037 0.1098 2.4 16.5 13..14 0.041 659.3 150.7 0.0333 0.0022 0.0648 1.4 9.8 14..4 0.066 659.3 150.7 0.0333 0.0034 0.1025 2.2 15.4 14..5 0.076 659.3 150.7 0.0333 0.0040 0.1193 2.6 18.0 14..15 0.134 659.3 150.7 0.0333 0.0070 0.2103 4.6 31.7 15..16 0.024 659.3 150.7 0.0333 0.0013 0.0383 0.8 5.8 16..17 0.013 659.3 150.7 0.0333 0.0007 0.0201 0.4 3.0 17..6 0.118 659.3 150.7 0.0333 0.0062 0.1849 4.1 27.9 17..18 0.034 659.3 150.7 0.0333 0.0018 0.0535 1.2 8.1 18..7 0.111 659.3 150.7 0.0333 0.0058 0.1733 3.8 26.1 18..8 0.059 659.3 150.7 0.0333 0.0031 0.0923 2.0 13.9 16..9 0.178 659.3 150.7 0.0333 0.0093 0.2782 6.1 41.9 15..19 0.014 659.3 150.7 0.0333 0.0007 0.0221 0.5 3.3 19..10 0.244 659.3 150.7 0.0333 0.0127 0.3811 8.4 57.4 19..20 0.040 659.3 150.7 0.0333 0.0021 0.0630 1.4 9.5 20..11 0.049 659.3 150.7 0.0333 0.0026 0.0773 1.7 11.6 20..12 0.120 659.3 150.7 0.0333 0.0062 0.1874 4.1 28.2 13..21 0.016 659.3 150.7 0.0333 0.0008 0.0253 0.6 3.8 21..2 0.049 659.3 150.7 0.0333 0.0025 0.0766 1.7 11.5 21..3 0.018 659.3 150.7 0.0333 0.0009 0.0274 0.6 4.1 Time used: 6:43 Model 8: beta&w>1 (11 categories) TREE # 1: (1, (4, 5, (((6, (7, 8)), 9), (10, (11, 12)))), (2, 3)); MP score: 337 lnL(ntime: 20 np: 25): -2645.431403 +0.000000 13..1 13..14 14..4 14..5 14..15 15..16 16..17 17..6 17..18 18..7 18..8 16..9 15..19 19..10 19..20 20..11 20..12 13..21 21..2 21..3 0.070218 0.041447 0.065536 0.076304 0.134431 0.024467 0.012859 0.118189 0.034177 0.110779 0.059014 0.177846 0.014151 0.243654 0.040290 0.049400 0.119828 0.016171 0.048948 0.017525 1.760260 0.999990 0.075409 1.813716 1.000000 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 1.47523 (1: 0.070218, (4: 0.065536, 5: 0.076304, (((6: 0.118189, (7: 0.110779, 8: 0.059014): 0.034177): 0.012859, 9: 0.177846): 0.024467, (10: 0.243654, (11: 0.049400, 12: 0.119828): 0.040290): 0.014151): 0.134431): 0.041447, (2: 0.048948, 3: 0.017525): 0.016171); (D_melanogaster_CG30271-PF: 0.070218, (D_yakuba_CG30271-PF: 0.065536, D_erecta_CG30271-PF: 0.076304, (((D_takahashii_CG30271-PF: 0.118189, (D_biarmipes_CG30271-PF: 0.110779, D_suzukii_CG30271-PF: 0.059014): 0.034177): 0.012859, D_eugracilis_CG30271-PF: 0.177846): 0.024467, (D_ficusphila_CG30271-PF: 0.243654, (D_rhopaloa_CG30271-PF: 0.049400, D_elegans_CG30271-PF: 0.119828): 0.040290): 0.014151): 0.134431): 0.041447, (D_sechellia_CG30271-PF: 0.048948, D_simulans_CG30271-PF: 0.017525): 0.016171); Detailed output identifying parameters kappa (ts/tv) = 1.76026 Parameters in M8 (beta&w>1): p0 = 0.99999 p = 0.07541 q = 1.81372 (p1 = 0.00001) w = 1.00000 dN/dS (w) for site classes (K=11) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001 w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00016 0.00143 0.00959 0.05208 0.26948 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 13..1 0.070 659.3 150.7 0.0333 0.0037 0.1098 2.4 16.5 13..14 0.041 659.3 150.7 0.0333 0.0022 0.0648 1.4 9.8 14..4 0.066 659.3 150.7 0.0333 0.0034 0.1025 2.2 15.4 14..5 0.076 659.3 150.7 0.0333 0.0040 0.1193 2.6 18.0 14..15 0.134 659.3 150.7 0.0333 0.0070 0.2103 4.6 31.7 15..16 0.024 659.3 150.7 0.0333 0.0013 0.0383 0.8 5.8 16..17 0.013 659.3 150.7 0.0333 0.0007 0.0201 0.4 3.0 17..6 0.118 659.3 150.7 0.0333 0.0062 0.1849 4.1 27.9 17..18 0.034 659.3 150.7 0.0333 0.0018 0.0535 1.2 8.1 18..7 0.111 659.3 150.7 0.0333 0.0058 0.1733 3.8 26.1 18..8 0.059 659.3 150.7 0.0333 0.0031 0.0923 2.0 13.9 16..9 0.178 659.3 150.7 0.0333 0.0093 0.2782 6.1 41.9 15..19 0.014 659.3 150.7 0.0333 0.0007 0.0221 0.5 3.3 19..10 0.244 659.3 150.7 0.0333 0.0127 0.3811 8.4 57.4 19..20 0.040 659.3 150.7 0.0333 0.0021 0.0630 1.4 9.5 20..11 0.049 659.3 150.7 0.0333 0.0026 0.0773 1.7 11.6 20..12 0.120 659.3 150.7 0.0333 0.0062 0.1874 4.1 28.2 13..21 0.016 659.3 150.7 0.0333 0.0008 0.0253 0.6 3.8 21..2 0.049 659.3 150.7 0.0333 0.0025 0.0766 1.7 11.5 21..3 0.018 659.3 150.7 0.0333 0.0009 0.0274 0.6 4.1 Naive Empirical Bayes (NEB) analysis Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_CG30271-PF) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.021 0.164 0.813 ws: 0.411 0.127 0.078 0.062 0.056 0.054 0.053 0.053 0.053 0.053 Time used: 10:36
Model 1: NearlyNeutral -2660.988257 Model 2: PositiveSelection -2660.988257 Model 0: one-ratio -2666.629381 Model 3: discrete -2644.34978 Model 7: beta -2645.430377 Model 8: beta&w>1 -2645.431403 Model 0 vs 1 11.282248000000436 Model 2 vs 1 0.0 Model 8 vs 7 0.002051999999821419