--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 14:32:46 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/2res/glgC/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1659.13 -1662.67 2 -1659.14 -1663.02 -------------------------------------- TOTAL -1659.13 -1662.86 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.896109 0.086023 0.375677 1.476467 0.858731 1152.76 1287.02 1.000 r(A<->C){all} 0.173291 0.021549 0.000123 0.468520 0.132965 202.51 220.24 1.000 r(A<->G){all} 0.167321 0.019643 0.000026 0.455109 0.127910 225.96 254.00 1.002 r(A<->T){all} 0.163277 0.018904 0.000079 0.435149 0.125115 186.24 204.85 1.003 r(C<->G){all} 0.167478 0.019621 0.000082 0.448538 0.129419 284.62 300.83 1.000 r(C<->T){all} 0.170779 0.021834 0.000013 0.478076 0.128467 274.71 292.72 1.000 r(G<->T){all} 0.157854 0.019080 0.000160 0.451156 0.119197 207.31 356.51 1.000 pi(A){all} 0.184543 0.000119 0.163668 0.206025 0.184570 1048.32 1188.36 1.000 pi(C){all} 0.267428 0.000163 0.243312 0.292110 0.267165 1257.96 1297.48 1.001 pi(G){all} 0.315167 0.000173 0.288943 0.340087 0.315450 1260.13 1275.38 1.000 pi(T){all} 0.232862 0.000144 0.209490 0.256353 0.232769 1296.49 1313.37 1.001 alpha{1,2} 0.441437 0.249105 0.000225 1.447394 0.271992 1358.22 1380.54 1.000 alpha{3} 0.472171 0.259471 0.000179 1.470474 0.300997 1246.31 1277.62 1.000 pinvar{all} 0.998716 0.000003 0.995879 0.999999 0.999202 1296.11 1299.96 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1598.286913 Model 2: PositiveSelection -1598.286913 Model 0: one-ratio -1598.286913 Model 7: beta -1598.286913 Model 8: beta&w>1 -1598.286913 Model 0 vs 1 0.0 Model 2 vs 1 0.0 Model 8 vs 7 0.0
>C1 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C2 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C3 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C4 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C5 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C6 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=404 C1 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C2 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C3 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C4 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C5 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C6 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ************************************************** C1 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C2 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C3 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C4 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C5 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C6 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT ************************************************** C1 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C2 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C3 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C4 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C5 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C6 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV ************************************************** C1 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C2 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C3 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C4 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C5 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C6 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN ************************************************** C1 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C2 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C3 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C4 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C5 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C6 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP ************************************************** C1 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C2 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C3 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C4 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C5 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C6 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA ************************************************** C1 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C2 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C3 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C4 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C5 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C6 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP ************************************************** C1 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C2 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C3 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C4 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C5 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C6 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK ************************************************** C1 GVWI C2 GVWI C3 GVWI C4 GVWI C5 GVWI C6 GVWI **** PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 404 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 404 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [12120] Library Relaxation: Multi_proc [96] Relaxation Summary: [12120]--->[12120] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.524 Mb, Max= 30.975 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C2 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C3 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C4 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C5 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN C6 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ************************************************** C1 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C2 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C3 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C4 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C5 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT C6 ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT ************************************************** C1 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C2 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C3 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C4 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C5 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV C6 GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV ************************************************** C1 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C2 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C3 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C4 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C5 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN C6 AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN ************************************************** C1 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C2 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C3 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C4 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C5 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP C6 YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP ************************************************** C1 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C2 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C3 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C4 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C5 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA C6 GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA ************************************************** C1 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C2 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C3 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C4 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C5 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP C6 PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP ************************************************** C1 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C2 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C3 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C4 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C5 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK C6 GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK ************************************************** C1 GVWI C2 GVWI C3 GVWI C4 GVWI C5 GVWI C6 GVWI **** FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG C2 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG C3 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG C4 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG C5 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG C6 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG ************************************************** C1 CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT C2 CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT C3 CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT C4 CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT C5 CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT C6 CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT ************************************************** C1 TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC C2 TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC C3 TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC C4 TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC C5 TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC C6 TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC ************************************************** C1 GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT C2 GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT C3 GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT C4 GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT C5 GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT C6 GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT ************************************************** C1 AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT C2 AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT C3 AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT C4 AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT C5 AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT C6 AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ************************************************** C1 ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT C2 ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT C3 ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT C4 ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT C5 ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT C6 ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT ************************************************** C1 GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA C2 GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA C3 GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA C4 GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA C5 GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA C6 GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA ************************************************** C1 CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC C2 CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC C3 CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC C4 CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC C5 CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC C6 CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC ************************************************** C1 CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG C2 CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG C3 CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG C4 CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG C5 CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG C6 CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG ************************************************** C1 GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA C2 GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA C3 GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA C4 GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA C5 GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA C6 GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA ************************************************** C1 CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC C2 CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC C3 CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC C4 CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC C5 CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC C6 CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC ************************************************** C1 CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC C2 CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC C3 CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC C4 CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC C5 CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC C6 CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC ************************************************** C1 TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA C2 TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA C3 TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA C4 TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA C5 TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA C6 TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA ************************************************** C1 TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG C2 TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG C3 TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG C4 TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG C5 TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG C6 TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG ************************************************** C1 TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT C2 TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT C3 TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT C4 TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT C5 TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT C6 TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT ************************************************** C1 GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA C2 GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA C3 GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA C4 GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA C5 GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA C6 GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA ************************************************** C1 CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA C2 CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA C3 CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA C4 CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA C5 CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA C6 CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ************************************************** C1 ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG C2 ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG C3 ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG C4 ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG C5 ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG C6 ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG ************************************************** C1 CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC C2 CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC C3 CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC C4 CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC C5 CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC C6 CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC ************************************************** C1 AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA C2 AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA C3 AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA C4 AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA C5 AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA C6 AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ************************************************** C1 ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG C2 ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG C3 ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG C4 ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG C5 ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG C6 ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG ************************************************** C1 GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA C2 GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA C3 GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA C4 GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA C5 GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA C6 GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA ************************************************** C1 GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG C2 GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG C3 GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG C4 GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG C5 GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG C6 GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ************************************************** C1 ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG C2 ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG C3 ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG C4 ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG C5 ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG C6 ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG ************************************************** C1 GGTGTGTGGATT C2 GGTGTGTGGATT C3 GGTGTGTGGATT C4 GGTGTGTGGATT C5 GGTGTGTGGATT C6 GGTGTGTGGATT ************ >C1 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG GGTGTGTGGATT >C2 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG GGTGTGTGGATT >C3 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG GGTGTGTGGATT >C4 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG GGTGTGTGGATT >C5 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG GGTGTGTGGATT >C6 ATGAGGGAAGTGCCACAAGTGCTGGGCATTGTTTTGGCCGGTGGTGAGGG CAAACGGTTATATCCGCTGACCGCAGACCGGGCCAAACCCGCTGTTCCCT TCGGGGGCGCCTATCGGTTGGTTGATTTCGTACTTTCTAATCTAGTCAAC GCCCGTTACCTGAGGATTTGTGTTCTCACACAATACAAGTCGCATTCCCT AGACCGCCACATTTCGCAGAATTGGCGATTGTCGGGCCTTGCCGGTGAGT ACATTACCCCGGTGCCAGCACAGCAGCGGTTCGGCCCACACTGGTACACT GGCTCGGCGGACGCGATCTATCAATCACTCAACCTCATTTATGACGAAGA CCCTGACTATCTAGTGGTTTTCGGAGCTGACCACGTGTACCGGATGGACC CCGAGCAGATGCTCCGGTTCCACATCGGCAGCGGGGCCGGTGCCACGGTG GCTGGCATTCGCGTTCCGCGCAGCGACGCTACAGCGTTTGGTTGCATTGA CGCTGACGACTCCGGCCGTATTCGCCGTTTCACTGAGAAGCCGCTCAAAC CGCCCGGGACACCGGACGATCCCGATAAGACGTTTGTTTCGATGGGCAAC TACATCTTCACCACCAAGGTGCTCGTCGACGCGATTCGCGCTGACGCCGA TGACGATCACTCGTATCACGACATGGGCGGCGACATCCTTCCGCGGCTGG TGGACGGCGGGATGGCCGCGGTGTATGACTTTTCCCAAAACGAAGTGCCT GGCGCTACCGACTGGGACCGCGCTTATTGGCGCGACGTTGGTACGCTGGA CGCTTTTTATGACGCCCACATGGATCTGGTGTCGTTGCGTCCGGTGTTTA ATCTTTACAACAAGCGTTGGCCGATTCGTGGCGAATCGGAAAATCTGGCG CCGGCGAAGTTTGTCAACGGTGGTTCCGTTCAGGAATCGGTGGTGGGTGC AGGGAGTATCATTTCGGCGGCTTCGGTACGTAATTCGGTGCTGTCGTCGA ATGTCGTGGTCGACAACGGCGCGATCGTGGAGGGCAGTGTCATCATGCCG GGTGCTCGGGTTGGCCGCGGCGCAGTGATACGCCACGCGATCTTGGATAA GAACGTCGTCGTCGGGCCTGGCGAGATGGTTGGCGTGGATCCCGAGAGAG ATCGGGAACACTTTGCGATTAGTGCTGGCGGAGTAGTCGTGGTCGGCAAG GGTGTGTGGATT >C1 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C2 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C3 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C4 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C5 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI >C6 MREVPQVLGIVLAGGEGKRLYPLTADRAKPAVPFGGAYRLVDFVLSNLVN ARYLRICVLTQYKSHSLDRHISQNWRLSGLAGEYITPVPAQQRFGPHWYT GSADAIYQSLNLIYDEDPDYLVVFGADHVYRMDPEQMLRFHIGSGAGATV AGIRVPRSDATAFGCIDADDSGRIRRFTEKPLKPPGTPDDPDKTFVSMGN YIFTTKVLVDAIRADADDDHSYHDMGGDILPRLVDGGMAAVYDFSQNEVP GATDWDRAYWRDVGTLDAFYDAHMDLVSLRPVFNLYNKRWPIRGESENLA PAKFVNGGSVQESVVGAGSIISAASVRNSVLSSNVVVDNGAIVEGSVIMP GARVGRGAVIRHAILDKNVVVGPGEMVGVDPERDREHFAISAGGVVVVGK GVWI MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1212 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579789884 Setting output file names to "/data/2res/glgC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 161990974 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 0037157316 Seed = 1530046174 Swapseed = 1579789884 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2712.514098 -- -24.965149 Chain 2 -- -2712.514098 -- -24.965149 Chain 3 -- -2712.513685 -- -24.965149 Chain 4 -- -2712.514098 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2712.513941 -- -24.965149 Chain 2 -- -2712.513941 -- -24.965149 Chain 3 -- -2712.514098 -- -24.965149 Chain 4 -- -2712.514098 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2712.514] (-2712.514) (-2712.514) (-2712.514) * [-2712.514] (-2712.514) (-2712.514) (-2712.514) 500 -- (-1678.089) (-1684.500) (-1671.936) [-1669.844] * (-1681.560) (-1670.458) [-1670.343] (-1672.902) -- 0:00:00 1000 -- (-1677.813) (-1665.203) [-1671.233] (-1665.924) * (-1669.969) [-1672.481] (-1673.208) (-1675.172) -- 0:00:00 1500 -- [-1668.762] (-1686.645) (-1675.005) (-1668.836) * (-1662.387) (-1673.339) [-1670.064] (-1665.665) -- 0:00:00 2000 -- (-1669.156) (-1668.990) (-1669.006) [-1672.007] * (-1668.801) (-1674.295) (-1668.490) [-1666.081] -- 0:00:00 2500 -- (-1675.651) (-1681.183) (-1666.712) [-1668.627] * [-1670.108] (-1668.468) (-1672.081) (-1668.372) -- 0:00:00 3000 -- (-1664.225) (-1676.491) [-1662.458] (-1671.065) * (-1665.596) (-1670.262) (-1671.585) [-1662.731] -- 0:00:00 3500 -- [-1671.395] (-1672.132) (-1666.159) (-1673.696) * (-1676.509) (-1673.121) [-1672.390] (-1672.112) -- 0:00:00 4000 -- [-1667.431] (-1670.096) (-1668.533) (-1668.406) * [-1663.927] (-1667.317) (-1674.258) (-1663.319) -- 0:00:00 4500 -- (-1669.938) [-1670.075] (-1666.208) (-1669.900) * (-1669.695) (-1661.380) [-1677.038] (-1676.910) -- 0:00:00 5000 -- (-1667.902) [-1671.242] (-1665.687) (-1671.017) * (-1668.613) (-1666.871) [-1669.490] (-1664.686) -- 0:00:00 Average standard deviation of split frequencies: 0.112239 5500 -- [-1671.091] (-1670.673) (-1669.943) (-1669.512) * (-1670.182) [-1676.099] (-1678.530) (-1679.865) -- 0:00:00 6000 -- [-1663.790] (-1666.826) (-1674.733) (-1666.979) * (-1666.680) (-1670.587) (-1677.734) [-1674.257] -- 0:00:00 6500 -- [-1663.400] (-1675.010) (-1672.785) (-1665.606) * [-1667.407] (-1668.553) (-1673.236) (-1667.486) -- 0:00:00 7000 -- (-1669.688) (-1668.478) (-1667.041) [-1667.088] * (-1672.265) (-1667.703) (-1673.602) [-1665.590] -- 0:00:00 7500 -- (-1669.029) (-1667.449) [-1668.429] (-1664.285) * (-1665.504) [-1663.663] (-1668.023) (-1669.993) -- 0:00:00 8000 -- (-1668.038) (-1671.478) [-1662.117] (-1671.467) * [-1667.267] (-1669.610) (-1668.642) (-1663.739) -- 0:00:00 8500 -- [-1666.959] (-1666.178) (-1673.811) (-1666.358) * (-1671.339) (-1665.797) [-1674.133] (-1672.516) -- 0:00:00 9000 -- (-1665.085) (-1676.446) [-1665.433] (-1672.678) * (-1668.443) [-1665.411] (-1682.017) (-1668.666) -- 0:00:00 9500 -- (-1669.514) (-1676.020) [-1667.666] (-1667.429) * (-1665.506) [-1671.890] (-1671.671) (-1669.925) -- 0:01:44 10000 -- [-1670.904] (-1667.826) (-1669.712) (-1672.379) * [-1664.959] (-1673.375) (-1669.482) (-1669.400) -- 0:01:39 Average standard deviation of split frequencies: 0.073657 10500 -- (-1668.078) (-1669.984) [-1671.728] (-1678.569) * [-1670.178] (-1665.460) (-1673.830) (-1671.604) -- 0:01:34 11000 -- (-1668.569) [-1665.288] (-1666.265) (-1669.503) * (-1664.073) (-1667.981) [-1667.904] (-1672.189) -- 0:01:29 11500 -- (-1669.696) (-1669.250) (-1667.763) [-1667.477] * (-1673.205) (-1679.733) (-1672.954) [-1665.089] -- 0:01:25 12000 -- (-1673.172) [-1671.148] (-1667.561) (-1669.712) * (-1672.467) (-1674.874) [-1668.294] (-1673.054) -- 0:01:22 12500 -- (-1671.918) [-1666.666] (-1667.003) (-1673.705) * [-1672.760] (-1669.660) (-1669.140) (-1670.933) -- 0:01:19 13000 -- (-1683.345) [-1672.208] (-1670.541) (-1664.871) * [-1670.206] (-1671.072) (-1668.216) (-1673.151) -- 0:01:15 13500 -- (-1673.455) [-1670.531] (-1669.968) (-1673.278) * (-1666.017) [-1672.517] (-1664.612) (-1669.372) -- 0:01:13 14000 -- (-1678.786) [-1670.249] (-1665.248) (-1666.136) * (-1669.940) (-1665.468) (-1666.933) [-1672.588] -- 0:01:10 14500 -- [-1668.595] (-1663.595) (-1669.614) (-1675.348) * [-1664.114] (-1672.552) (-1681.661) (-1680.992) -- 0:01:07 15000 -- (-1663.840) (-1663.590) (-1667.551) [-1664.837] * [-1664.480] (-1677.463) (-1670.674) (-1666.392) -- 0:01:05 Average standard deviation of split frequencies: 0.046520 15500 -- (-1670.653) (-1660.333) [-1671.241] (-1667.826) * (-1664.244) [-1665.518] (-1666.178) (-1670.065) -- 0:01:03 16000 -- [-1668.379] (-1660.462) (-1670.963) (-1667.205) * (-1665.777) [-1664.498] (-1672.718) (-1666.552) -- 0:01:01 16500 -- (-1667.098) (-1665.892) [-1660.004] (-1670.638) * (-1670.327) (-1665.539) [-1664.176] (-1668.412) -- 0:00:59 17000 -- (-1673.195) (-1662.392) [-1660.869] (-1674.893) * (-1670.491) (-1668.311) [-1668.523] (-1671.133) -- 0:00:57 17500 -- [-1668.007] (-1661.695) (-1661.318) (-1672.660) * (-1671.816) (-1668.566) (-1682.654) [-1669.224] -- 0:00:56 18000 -- [-1662.266] (-1659.035) (-1659.265) (-1675.921) * (-1667.781) (-1664.107) (-1674.360) [-1667.522] -- 0:00:54 18500 -- (-1663.918) (-1658.784) (-1659.392) [-1675.160] * (-1681.484) [-1666.709] (-1678.238) (-1674.848) -- 0:00:53 19000 -- (-1672.823) [-1659.986] (-1661.626) (-1674.541) * [-1669.086] (-1675.528) (-1674.455) (-1687.022) -- 0:00:51 19500 -- (-1668.659) [-1659.290] (-1662.109) (-1666.110) * [-1659.881] (-1672.310) (-1670.319) (-1673.081) -- 0:00:50 20000 -- (-1672.553) (-1659.432) (-1660.929) [-1663.970] * (-1660.577) (-1665.639) [-1665.270] (-1672.645) -- 0:00:49 Average standard deviation of split frequencies: 0.040253 20500 -- [-1668.198] (-1659.944) (-1660.670) (-1666.379) * (-1660.940) [-1669.048] (-1675.127) (-1671.072) -- 0:00:47 21000 -- (-1668.364) [-1659.707] (-1660.366) (-1670.268) * [-1659.679] (-1671.843) (-1667.666) (-1666.658) -- 0:00:46 21500 -- [-1666.963] (-1658.908) (-1660.289) (-1677.351) * (-1660.463) (-1670.732) [-1664.519] (-1673.490) -- 0:00:45 22000 -- [-1668.302] (-1658.987) (-1658.636) (-1669.185) * (-1659.875) (-1664.314) [-1667.937] (-1665.514) -- 0:00:44 22500 -- (-1668.767) (-1658.407) (-1660.465) [-1673.059] * (-1662.376) [-1671.693] (-1669.289) (-1659.519) -- 0:00:43 23000 -- (-1669.480) (-1657.720) (-1659.289) [-1659.741] * (-1665.203) [-1672.461] (-1668.004) (-1660.067) -- 0:00:42 23500 -- (-1664.805) (-1661.697) (-1659.921) [-1660.143] * (-1664.137) [-1672.582] (-1665.257) (-1658.675) -- 0:01:23 24000 -- (-1668.441) (-1660.206) (-1658.238) [-1658.735] * [-1659.927] (-1666.649) (-1668.986) (-1658.689) -- 0:01:21 24500 -- [-1672.013] (-1661.117) (-1658.106) (-1658.979) * [-1659.887] (-1665.542) (-1673.521) (-1658.266) -- 0:01:19 25000 -- [-1667.471] (-1660.108) (-1658.570) (-1659.154) * (-1662.020) [-1668.098] (-1666.477) (-1661.160) -- 0:01:18 Average standard deviation of split frequencies: 0.039558 25500 -- (-1670.564) (-1657.743) [-1658.208] (-1659.408) * (-1659.151) (-1670.293) (-1670.178) [-1660.330] -- 0:01:16 26000 -- (-1664.289) (-1660.377) (-1657.754) [-1659.332] * (-1659.384) (-1672.443) (-1677.378) [-1660.782] -- 0:01:14 26500 -- (-1672.160) [-1661.245] (-1660.068) (-1661.448) * [-1658.643] (-1667.150) (-1668.674) (-1660.506) -- 0:01:13 27000 -- (-1670.326) (-1665.386) [-1659.514] (-1659.922) * (-1658.656) (-1659.230) (-1666.810) [-1660.298] -- 0:01:12 27500 -- (-1664.925) (-1663.724) [-1661.079] (-1658.935) * [-1659.184] (-1659.226) (-1678.167) (-1660.842) -- 0:01:10 28000 -- [-1674.661] (-1662.653) (-1662.992) (-1659.446) * (-1660.688) (-1659.115) (-1681.473) [-1661.749] -- 0:01:09 28500 -- (-1668.622) [-1659.377] (-1660.462) (-1660.719) * (-1663.723) [-1661.327] (-1680.834) (-1665.640) -- 0:01:08 29000 -- [-1667.878] (-1660.489) (-1658.157) (-1658.387) * [-1660.555] (-1659.560) (-1669.049) (-1663.226) -- 0:01:06 29500 -- [-1673.208] (-1661.227) (-1659.948) (-1658.650) * (-1659.628) (-1660.373) (-1666.321) [-1661.598] -- 0:01:05 30000 -- (-1667.607) [-1658.965] (-1658.514) (-1658.781) * (-1658.302) (-1659.674) [-1661.082] (-1660.017) -- 0:01:04 Average standard deviation of split frequencies: 0.032362 30500 -- [-1667.631] (-1659.498) (-1658.514) (-1659.013) * (-1658.481) (-1660.196) [-1658.216] (-1662.935) -- 0:01:03 31000 -- (-1671.965) (-1659.674) (-1660.948) [-1660.088] * (-1658.583) (-1657.712) (-1659.704) [-1661.261] -- 0:01:02 31500 -- (-1672.519) (-1660.205) [-1658.248] (-1661.102) * [-1660.041] (-1658.264) (-1660.205) (-1661.317) -- 0:01:01 32000 -- [-1670.089] (-1659.295) (-1658.402) (-1658.802) * [-1659.302] (-1658.339) (-1659.094) (-1661.966) -- 0:01:00 32500 -- (-1671.138) (-1658.461) (-1658.477) [-1659.263] * (-1666.548) [-1658.185] (-1659.854) (-1660.659) -- 0:00:59 33000 -- (-1670.535) (-1661.388) [-1659.952] (-1659.064) * (-1660.092) (-1659.422) [-1663.322] (-1661.504) -- 0:00:58 33500 -- [-1667.879] (-1660.119) (-1658.901) (-1659.922) * [-1659.725] (-1660.150) (-1662.962) (-1659.720) -- 0:00:57 34000 -- (-1664.047) [-1660.411] (-1658.048) (-1659.491) * (-1659.123) (-1660.465) [-1662.788] (-1662.404) -- 0:00:56 34500 -- (-1675.751) (-1659.011) [-1658.106] (-1659.032) * (-1659.657) (-1660.180) (-1661.424) [-1661.644] -- 0:00:55 35000 -- (-1674.933) [-1659.049] (-1658.592) (-1659.996) * (-1663.424) (-1664.973) (-1658.794) [-1657.832] -- 0:00:55 Average standard deviation of split frequencies: 0.033391 35500 -- (-1671.148) [-1662.020] (-1661.007) (-1660.556) * (-1660.920) (-1662.960) (-1660.547) [-1660.123] -- 0:00:54 36000 -- (-1673.550) [-1661.127] (-1660.069) (-1658.540) * (-1661.267) (-1664.096) [-1659.257] (-1664.303) -- 0:00:53 36500 -- (-1670.832) (-1660.677) (-1658.156) [-1658.540] * (-1662.464) (-1661.576) [-1659.985] (-1661.332) -- 0:00:52 37000 -- [-1672.664] (-1660.562) (-1658.285) (-1661.249) * (-1661.522) (-1658.949) (-1659.137) [-1662.736] -- 0:00:52 37500 -- (-1679.736) [-1660.808] (-1661.965) (-1658.182) * [-1660.356] (-1660.499) (-1659.028) (-1659.522) -- 0:00:51 38000 -- [-1666.268] (-1661.121) (-1659.665) (-1658.017) * (-1660.538) (-1662.183) [-1658.998] (-1658.340) -- 0:01:15 38500 -- (-1664.292) (-1659.201) [-1658.697] (-1659.526) * (-1660.206) (-1661.623) [-1658.899] (-1658.837) -- 0:01:14 39000 -- (-1669.692) (-1658.758) [-1658.772] (-1658.596) * [-1662.137] (-1660.298) (-1661.814) (-1658.480) -- 0:01:13 39500 -- (-1669.005) [-1658.711] (-1658.691) (-1657.912) * (-1658.325) (-1659.543) [-1659.428] (-1660.604) -- 0:01:12 40000 -- (-1672.653) [-1658.492] (-1660.015) (-1658.736) * [-1658.544] (-1659.419) (-1659.199) (-1660.668) -- 0:01:12 Average standard deviation of split frequencies: 0.037216 40500 -- (-1674.053) (-1659.586) (-1663.207) [-1657.683] * (-1663.351) [-1658.527] (-1663.514) (-1659.230) -- 0:01:11 41000 -- (-1665.436) (-1661.024) (-1664.156) [-1658.709] * (-1658.471) (-1658.637) (-1663.139) [-1661.530] -- 0:01:10 41500 -- (-1666.136) (-1661.092) (-1663.534) [-1661.032] * [-1662.013] (-1660.309) (-1661.704) (-1659.829) -- 0:01:09 42000 -- [-1669.543] (-1660.995) (-1664.894) (-1661.490) * [-1658.909] (-1657.973) (-1663.467) (-1659.676) -- 0:01:08 42500 -- [-1663.113] (-1664.059) (-1660.944) (-1661.799) * (-1661.754) (-1659.332) (-1663.402) [-1660.449] -- 0:01:07 43000 -- (-1672.099) (-1662.986) [-1661.736] (-1663.117) * (-1662.173) [-1659.540] (-1662.184) (-1659.100) -- 0:01:06 43500 -- (-1668.976) (-1662.640) [-1660.576] (-1667.342) * (-1660.826) (-1661.565) [-1663.571] (-1660.328) -- 0:01:05 44000 -- (-1663.130) (-1660.817) [-1661.597] (-1668.433) * (-1659.982) [-1658.134] (-1661.045) (-1664.604) -- 0:01:05 44500 -- (-1666.018) (-1659.067) (-1661.368) [-1666.422] * (-1666.476) (-1658.839) [-1660.862] (-1660.906) -- 0:01:04 45000 -- (-1670.829) [-1657.551] (-1666.666) (-1659.987) * [-1660.861] (-1661.822) (-1662.489) (-1659.703) -- 0:01:03 Average standard deviation of split frequencies: 0.030278 45500 -- [-1662.902] (-1657.741) (-1665.173) (-1659.597) * (-1662.870) (-1659.323) [-1657.800] (-1662.555) -- 0:01:02 46000 -- (-1671.550) [-1658.426] (-1661.280) (-1660.838) * (-1660.010) (-1661.804) [-1657.589] (-1665.941) -- 0:01:02 46500 -- (-1668.430) (-1658.015) [-1660.743] (-1662.066) * [-1659.258] (-1659.186) (-1660.678) (-1664.340) -- 0:01:01 47000 -- (-1669.022) (-1658.929) [-1660.399] (-1661.415) * [-1659.071] (-1659.983) (-1659.124) (-1662.122) -- 0:01:00 47500 -- [-1664.360] (-1659.024) (-1661.104) (-1666.258) * [-1659.961] (-1658.508) (-1658.660) (-1658.723) -- 0:01:00 48000 -- [-1667.007] (-1658.129) (-1661.810) (-1661.225) * (-1660.148) [-1659.147] (-1658.466) (-1659.792) -- 0:00:59 48500 -- (-1671.727) (-1660.056) (-1660.329) [-1658.645] * (-1661.805) (-1660.299) (-1658.488) [-1659.304] -- 0:00:58 49000 -- (-1671.696) (-1661.988) (-1658.893) [-1660.250] * (-1659.169) [-1659.259] (-1657.859) (-1659.965) -- 0:00:58 49500 -- (-1675.965) [-1663.634] (-1658.812) (-1661.819) * (-1659.004) (-1661.749) [-1661.905] (-1659.700) -- 0:00:57 50000 -- [-1667.777] (-1663.198) (-1662.277) (-1660.373) * (-1658.407) (-1665.056) (-1660.013) [-1659.838] -- 0:00:57 Average standard deviation of split frequencies: 0.033960 50500 -- (-1672.449) [-1662.065] (-1660.076) (-1659.490) * [-1658.097] (-1661.630) (-1659.964) (-1660.630) -- 0:00:56 51000 -- (-1670.801) (-1660.465) (-1660.114) [-1661.163] * (-1658.097) [-1660.859] (-1659.745) (-1658.207) -- 0:00:55 51500 -- (-1666.741) (-1660.605) (-1662.249) [-1658.191] * [-1657.782] (-1661.871) (-1660.420) (-1657.950) -- 0:00:55 52000 -- (-1666.846) [-1659.672] (-1664.913) (-1658.106) * (-1658.308) (-1662.127) (-1660.832) [-1659.552] -- 0:01:12 52500 -- (-1672.357) (-1658.779) (-1665.195) [-1658.105] * [-1659.145] (-1663.935) (-1659.529) (-1658.599) -- 0:01:12 53000 -- (-1677.008) [-1660.807] (-1658.793) (-1663.284) * (-1658.085) (-1662.219) [-1662.790] (-1662.373) -- 0:01:11 53500 -- [-1668.284] (-1659.691) (-1659.617) (-1658.667) * [-1658.074] (-1662.916) (-1660.367) (-1666.377) -- 0:01:10 54000 -- (-1669.465) [-1660.108] (-1661.774) (-1657.405) * [-1658.042] (-1661.652) (-1659.634) (-1663.754) -- 0:01:10 54500 -- (-1663.694) (-1660.989) [-1660.536] (-1661.264) * (-1658.088) [-1658.347] (-1658.233) (-1663.333) -- 0:01:09 55000 -- [-1667.003] (-1659.735) (-1659.750) (-1661.143) * (-1658.022) (-1661.875) [-1661.471] (-1660.672) -- 0:01:08 Average standard deviation of split frequencies: 0.029215 55500 -- [-1669.583] (-1659.522) (-1659.751) (-1659.954) * (-1659.066) [-1663.259] (-1660.487) (-1660.463) -- 0:01:08 56000 -- (-1670.371) (-1659.491) (-1660.996) [-1659.153] * (-1659.036) [-1661.854] (-1661.079) (-1658.742) -- 0:01:07 56500 -- (-1668.601) (-1660.676) (-1661.281) [-1659.072] * (-1658.773) (-1659.441) (-1658.949) [-1658.365] -- 0:01:06 57000 -- (-1675.870) (-1658.568) [-1659.892] (-1658.755) * (-1658.236) (-1659.483) (-1660.242) [-1657.894] -- 0:01:06 57500 -- [-1663.373] (-1661.812) (-1659.775) (-1660.262) * (-1658.454) (-1659.977) [-1658.625] (-1660.319) -- 0:01:05 58000 -- (-1666.261) (-1660.236) [-1660.789] (-1660.585) * [-1659.039] (-1658.294) (-1658.885) (-1660.382) -- 0:01:04 58500 -- (-1671.817) (-1662.757) (-1661.053) [-1660.499] * (-1660.180) (-1660.525) [-1659.166] (-1657.603) -- 0:01:04 59000 -- [-1671.276] (-1662.757) (-1661.517) (-1658.822) * (-1660.053) [-1661.743] (-1660.160) (-1658.447) -- 0:01:03 59500 -- [-1664.832] (-1664.211) (-1661.266) (-1659.644) * (-1659.913) [-1661.841] (-1659.828) (-1663.353) -- 0:01:03 60000 -- (-1665.132) (-1663.145) (-1661.478) [-1661.223] * (-1661.079) (-1660.674) [-1658.386] (-1661.287) -- 0:01:02 Average standard deviation of split frequencies: 0.031082 60500 -- [-1663.522] (-1661.050) (-1663.327) (-1660.874) * (-1660.686) (-1659.387) [-1660.601] (-1661.629) -- 0:01:02 61000 -- [-1668.516] (-1658.201) (-1663.425) (-1658.017) * (-1660.578) (-1659.778) (-1661.385) [-1658.662] -- 0:01:01 61500 -- (-1670.691) [-1659.513] (-1661.159) (-1659.372) * [-1658.159] (-1659.023) (-1660.139) (-1659.588) -- 0:01:01 62000 -- (-1666.484) (-1658.502) (-1661.158) [-1658.713] * (-1659.288) (-1660.492) [-1658.045] (-1662.292) -- 0:01:00 62500 -- (-1668.765) (-1658.454) [-1661.839] (-1659.520) * (-1660.537) [-1658.803] (-1660.822) (-1659.706) -- 0:01:00 63000 -- [-1667.585] (-1659.290) (-1661.279) (-1657.686) * (-1658.945) [-1659.050] (-1659.600) (-1660.323) -- 0:00:59 63500 -- (-1667.822) [-1658.011] (-1662.108) (-1658.712) * (-1659.577) (-1659.203) (-1661.495) [-1661.491] -- 0:00:58 64000 -- (-1670.529) [-1659.981] (-1661.344) (-1660.398) * [-1660.089] (-1660.171) (-1658.644) (-1662.469) -- 0:00:58 64500 -- (-1671.730) [-1658.769] (-1661.750) (-1658.829) * (-1660.706) (-1660.201) [-1660.580] (-1665.481) -- 0:00:58 65000 -- [-1666.164] (-1659.788) (-1659.200) (-1659.217) * [-1660.240] (-1661.371) (-1661.389) (-1664.461) -- 0:00:57 Average standard deviation of split frequencies: 0.030713 65500 -- (-1679.111) (-1658.986) (-1659.739) [-1663.763] * (-1660.606) (-1660.981) [-1659.969] (-1659.536) -- 0:00:57 66000 -- (-1667.360) [-1659.883] (-1659.419) (-1662.635) * [-1669.096] (-1659.905) (-1661.008) (-1658.010) -- 0:00:56 66500 -- [-1667.367] (-1659.843) (-1658.746) (-1661.865) * (-1658.311) (-1661.529) (-1661.145) [-1659.266] -- 0:01:10 67000 -- [-1660.519] (-1659.833) (-1658.179) (-1660.525) * (-1658.170) [-1659.885] (-1664.330) (-1659.956) -- 0:01:09 67500 -- (-1659.811) [-1659.877] (-1658.738) (-1664.674) * (-1659.657) [-1659.693] (-1660.552) (-1658.755) -- 0:01:09 68000 -- (-1660.056) [-1660.018] (-1658.729) (-1662.867) * (-1657.778) [-1659.705] (-1660.552) (-1660.392) -- 0:01:08 68500 -- [-1662.110] (-1658.831) (-1658.386) (-1663.519) * (-1658.061) [-1658.686] (-1660.856) (-1658.753) -- 0:01:07 69000 -- (-1663.163) [-1658.148] (-1660.760) (-1661.748) * [-1659.600] (-1659.128) (-1659.415) (-1658.081) -- 0:01:07 69500 -- (-1664.731) (-1658.326) [-1660.717] (-1661.476) * [-1658.425] (-1660.101) (-1661.137) (-1660.274) -- 0:01:06 70000 -- (-1665.014) (-1659.487) (-1662.191) [-1660.015] * (-1657.771) [-1659.222] (-1660.544) (-1661.443) -- 0:01:06 Average standard deviation of split frequencies: 0.033354 70500 -- (-1660.220) (-1660.842) [-1660.614] (-1659.538) * [-1658.460] (-1660.571) (-1658.443) (-1657.929) -- 0:01:05 71000 -- (-1661.519) [-1660.828] (-1658.871) (-1658.701) * [-1658.466] (-1659.863) (-1659.048) (-1659.915) -- 0:01:05 71500 -- (-1662.830) (-1659.568) [-1658.956] (-1659.026) * (-1659.501) (-1662.992) (-1660.874) [-1658.969] -- 0:01:04 72000 -- [-1663.072] (-1663.606) (-1662.387) (-1660.128) * [-1662.425] (-1660.555) (-1661.189) (-1658.365) -- 0:01:04 72500 -- (-1663.672) (-1662.879) [-1659.639] (-1659.622) * (-1658.925) (-1666.003) (-1659.023) [-1658.970] -- 0:01:03 73000 -- (-1663.358) [-1660.604] (-1659.565) (-1658.843) * (-1661.363) (-1665.905) [-1658.767] (-1660.379) -- 0:01:03 73500 -- (-1666.808) (-1661.068) (-1663.597) [-1660.167] * [-1661.237] (-1660.713) (-1659.821) (-1659.637) -- 0:01:03 74000 -- (-1662.758) (-1662.696) (-1663.298) [-1660.058] * (-1660.563) [-1662.310] (-1663.369) (-1657.960) -- 0:01:02 74500 -- (-1664.775) [-1660.596] (-1660.879) (-1659.940) * (-1661.580) [-1660.702] (-1659.261) (-1658.943) -- 0:01:02 75000 -- [-1658.834] (-1660.574) (-1663.326) (-1660.075) * [-1661.358] (-1658.010) (-1661.755) (-1660.825) -- 0:01:01 Average standard deviation of split frequencies: 0.031944 75500 -- (-1659.735) [-1660.994] (-1663.326) (-1659.426) * (-1661.842) [-1660.435] (-1659.852) (-1660.923) -- 0:01:01 76000 -- (-1660.271) (-1659.593) (-1664.987) [-1657.978] * [-1661.457] (-1660.796) (-1661.876) (-1660.095) -- 0:01:00 76500 -- (-1658.612) (-1658.621) [-1661.663] (-1658.399) * [-1664.257] (-1663.804) (-1660.844) (-1664.255) -- 0:01:00 77000 -- (-1660.708) [-1659.325] (-1661.250) (-1659.393) * (-1658.398) (-1663.596) (-1660.840) [-1662.668] -- 0:00:59 77500 -- (-1659.044) (-1659.399) [-1663.348] (-1661.735) * [-1660.124] (-1660.541) (-1666.898) (-1661.334) -- 0:00:59 78000 -- (-1661.488) (-1658.817) [-1663.868] (-1659.913) * (-1659.638) (-1660.541) (-1664.758) [-1663.163] -- 0:00:59 78500 -- (-1660.456) [-1658.460] (-1662.909) (-1659.386) * (-1658.180) (-1662.601) (-1663.810) [-1658.682] -- 0:00:58 79000 -- [-1660.227] (-1659.325) (-1659.870) (-1659.398) * (-1660.576) (-1658.792) (-1664.576) [-1658.973] -- 0:00:58 79500 -- (-1658.042) [-1661.954] (-1661.050) (-1659.893) * (-1661.250) [-1659.024] (-1663.185) (-1659.567) -- 0:00:57 80000 -- (-1658.254) [-1659.920] (-1660.259) (-1659.999) * (-1659.417) (-1658.686) [-1664.856] (-1661.063) -- 0:00:57 Average standard deviation of split frequencies: 0.031265 80500 -- (-1664.881) [-1658.320] (-1661.740) (-1663.272) * (-1657.637) [-1658.552] (-1664.760) (-1665.607) -- 0:00:57 81000 -- (-1658.050) (-1661.274) (-1660.105) [-1663.350] * [-1657.551] (-1658.875) (-1662.833) (-1662.260) -- 0:00:56 81500 -- [-1658.857] (-1660.069) (-1659.299) (-1659.482) * [-1657.577] (-1661.688) (-1665.152) (-1659.088) -- 0:01:07 82000 -- (-1658.858) [-1660.207] (-1658.732) (-1659.743) * (-1658.001) (-1659.591) (-1660.650) [-1659.037] -- 0:01:07 82500 -- (-1659.251) (-1661.234) [-1659.087] (-1658.994) * (-1660.556) (-1660.778) [-1658.689] (-1659.362) -- 0:01:06 83000 -- (-1660.019) (-1658.726) (-1660.649) [-1659.559] * [-1658.227] (-1662.316) (-1659.529) (-1659.362) -- 0:01:06 83500 -- (-1662.495) (-1660.782) (-1659.921) [-1660.245] * (-1658.278) (-1662.860) [-1659.047] (-1662.019) -- 0:01:05 84000 -- (-1660.425) (-1663.556) [-1659.964] (-1660.504) * [-1657.637] (-1658.536) (-1659.833) (-1662.294) -- 0:01:05 84500 -- (-1659.080) [-1659.635] (-1658.555) (-1661.236) * (-1660.083) [-1658.535] (-1659.046) (-1659.137) -- 0:01:05 85000 -- (-1658.490) (-1658.573) (-1662.088) [-1660.158] * (-1659.759) (-1659.712) [-1658.042] (-1661.004) -- 0:01:04 Average standard deviation of split frequencies: 0.031584 85500 -- (-1658.350) [-1659.177] (-1659.961) (-1660.272) * (-1660.777) (-1660.820) (-1658.453) [-1658.947] -- 0:01:04 86000 -- (-1660.277) (-1660.136) [-1658.848] (-1659.508) * (-1660.905) (-1659.948) (-1657.842) [-1658.473] -- 0:01:03 86500 -- (-1660.396) (-1660.171) [-1659.302] (-1658.472) * (-1659.694) [-1659.956] (-1658.801) (-1658.991) -- 0:01:03 87000 -- (-1662.000) (-1659.182) [-1659.951] (-1662.202) * (-1659.745) (-1658.381) (-1660.039) [-1658.839] -- 0:01:02 87500 -- [-1658.575] (-1659.229) (-1658.662) (-1662.202) * (-1659.072) [-1657.928] (-1659.202) (-1658.938) -- 0:01:02 88000 -- (-1658.844) [-1659.106] (-1658.986) (-1659.657) * (-1659.026) (-1657.928) [-1659.904] (-1662.287) -- 0:01:02 88500 -- [-1661.050] (-1659.504) (-1660.090) (-1659.555) * [-1659.917] (-1660.777) (-1659.143) (-1658.495) -- 0:01:01 89000 -- (-1659.455) (-1661.460) [-1658.930] (-1659.907) * (-1660.699) [-1660.165] (-1658.314) (-1660.991) -- 0:01:01 89500 -- (-1659.464) (-1662.299) (-1659.697) [-1659.693] * [-1659.250] (-1661.024) (-1659.587) (-1659.233) -- 0:01:01 90000 -- (-1663.435) (-1661.822) [-1662.520] (-1663.498) * (-1661.015) [-1657.876] (-1659.861) (-1660.355) -- 0:01:00 Average standard deviation of split frequencies: 0.033796 90500 -- (-1660.520) (-1660.929) (-1665.383) [-1662.200] * (-1661.020) (-1659.757) [-1662.751] (-1661.349) -- 0:01:00 91000 -- (-1660.198) (-1663.237) [-1658.769] (-1660.516) * [-1658.618] (-1659.424) (-1662.158) (-1660.164) -- 0:00:59 91500 -- [-1660.666] (-1659.564) (-1660.905) (-1659.895) * (-1659.302) [-1658.549] (-1660.469) (-1660.098) -- 0:00:59 92000 -- [-1658.337] (-1662.095) (-1659.306) (-1658.044) * (-1659.190) [-1661.449] (-1658.985) (-1659.356) -- 0:00:59 92500 -- (-1661.786) [-1659.614] (-1661.038) (-1658.783) * (-1658.824) (-1665.008) (-1658.367) [-1662.431] -- 0:00:58 93000 -- (-1659.575) (-1659.940) (-1661.237) [-1658.715] * (-1658.884) [-1663.668] (-1658.856) (-1660.582) -- 0:00:58 93500 -- (-1658.653) [-1659.907] (-1659.787) (-1660.328) * (-1658.239) [-1662.035] (-1658.832) (-1663.530) -- 0:00:58 94000 -- (-1659.675) (-1660.165) [-1660.112] (-1660.560) * (-1657.622) [-1660.808] (-1658.962) (-1663.143) -- 0:00:57 94500 -- [-1658.959] (-1658.442) (-1658.046) (-1660.959) * (-1661.336) (-1657.927) [-1658.881] (-1662.502) -- 0:00:57 95000 -- (-1665.761) [-1658.991] (-1659.423) (-1659.015) * (-1659.234) (-1659.928) [-1659.958] (-1662.140) -- 0:00:57 Average standard deviation of split frequencies: 0.030164 95500 -- [-1659.222] (-1659.996) (-1658.967) (-1660.723) * (-1661.305) (-1660.042) [-1658.047] (-1663.001) -- 0:00:56 96000 -- (-1659.332) (-1658.219) (-1659.388) [-1660.399] * [-1659.007] (-1659.914) (-1662.707) (-1661.470) -- 0:00:56 96500 -- (-1658.696) (-1658.945) (-1660.055) [-1661.490] * (-1662.942) [-1658.492] (-1661.746) (-1661.942) -- 0:00:56 97000 -- (-1658.759) [-1660.424] (-1660.014) (-1660.274) * (-1661.963) [-1659.154] (-1657.734) (-1666.063) -- 0:01:05 97500 -- [-1658.430] (-1661.643) (-1660.430) (-1666.859) * (-1661.102) [-1658.713] (-1657.716) (-1663.996) -- 0:01:04 98000 -- (-1659.189) [-1658.235] (-1660.229) (-1661.643) * [-1660.973] (-1658.692) (-1660.372) (-1660.399) -- 0:01:04 98500 -- (-1661.517) [-1658.235] (-1658.242) (-1659.571) * (-1659.170) (-1658.694) (-1662.564) [-1661.051] -- 0:01:04 99000 -- (-1660.353) (-1663.977) [-1658.237] (-1658.541) * [-1660.396] (-1660.259) (-1658.780) (-1663.006) -- 0:01:03 99500 -- (-1658.863) (-1659.251) (-1661.492) [-1660.144] * (-1659.786) (-1659.752) (-1658.476) [-1661.716] -- 0:01:03 100000 -- (-1662.603) (-1658.696) [-1661.103] (-1660.184) * [-1658.043] (-1659.834) (-1660.822) (-1659.117) -- 0:01:02 Average standard deviation of split frequencies: 0.028565 100500 -- (-1660.171) (-1660.421) [-1660.383] (-1659.077) * (-1657.972) (-1659.815) (-1662.750) [-1659.121] -- 0:01:02 101000 -- [-1659.295] (-1659.059) (-1659.472) (-1659.774) * (-1659.553) [-1658.926] (-1663.011) (-1659.457) -- 0:01:02 101500 -- (-1658.943) (-1658.917) [-1660.611] (-1659.808) * (-1658.555) (-1660.913) (-1664.326) [-1659.940] -- 0:01:01 102000 -- (-1664.429) (-1659.022) [-1659.895] (-1659.746) * [-1658.584] (-1658.199) (-1660.690) (-1657.941) -- 0:01:01 102500 -- (-1660.112) (-1658.720) (-1660.728) [-1659.720] * [-1659.678] (-1659.428) (-1660.890) (-1658.405) -- 0:01:01 103000 -- (-1660.295) [-1658.001] (-1659.832) (-1659.623) * (-1658.653) [-1659.560] (-1661.545) (-1659.536) -- 0:01:00 103500 -- (-1660.484) (-1658.630) [-1660.157] (-1661.315) * (-1660.488) [-1659.165] (-1658.878) (-1659.631) -- 0:01:00 104000 -- (-1661.955) [-1658.839] (-1659.060) (-1658.649) * (-1662.035) (-1658.910) (-1659.081) [-1659.250] -- 0:01:00 104500 -- (-1661.275) [-1660.512] (-1658.302) (-1659.097) * (-1659.873) (-1661.510) [-1658.915] (-1658.052) -- 0:00:59 105000 -- (-1661.649) (-1661.317) [-1658.079] (-1660.903) * (-1659.873) (-1661.830) (-1658.844) [-1658.611] -- 0:00:59 Average standard deviation of split frequencies: 0.027694 105500 -- (-1659.494) (-1658.785) [-1658.177] (-1660.855) * [-1659.668] (-1657.927) (-1664.616) (-1660.126) -- 0:00:59 106000 -- (-1660.011) (-1663.628) [-1658.273] (-1660.006) * (-1658.729) [-1657.848] (-1663.348) (-1662.245) -- 0:00:59 106500 -- (-1663.904) [-1658.526] (-1658.122) (-1659.855) * (-1660.239) (-1657.841) (-1663.299) [-1660.199] -- 0:00:58 107000 -- (-1660.457) (-1659.053) [-1658.220] (-1659.060) * (-1657.979) (-1658.854) (-1662.191) [-1661.147] -- 0:00:58 107500 -- (-1659.969) (-1659.638) [-1658.907] (-1661.783) * (-1661.586) [-1657.891] (-1664.054) (-1660.847) -- 0:00:58 108000 -- [-1663.183] (-1660.006) (-1658.605) (-1660.837) * (-1663.746) (-1659.467) [-1659.816] (-1660.850) -- 0:00:57 108500 -- (-1658.868) (-1658.489) [-1660.733] (-1658.752) * (-1660.340) (-1660.465) [-1658.834] (-1661.126) -- 0:00:57 109000 -- (-1659.591) (-1659.054) (-1664.369) [-1658.624] * (-1660.613) [-1659.459] (-1658.829) (-1659.793) -- 0:00:57 109500 -- [-1660.226] (-1665.097) (-1661.608) (-1660.294) * (-1660.640) (-1668.766) [-1660.856] (-1659.563) -- 0:00:56 110000 -- [-1660.861] (-1662.067) (-1660.713) (-1659.999) * (-1660.078) [-1665.081] (-1659.889) (-1659.656) -- 0:00:56 Average standard deviation of split frequencies: 0.025345 110500 -- [-1659.582] (-1660.848) (-1660.947) (-1662.059) * [-1658.415] (-1666.877) (-1659.898) (-1659.034) -- 0:00:56 111000 -- [-1659.037] (-1660.210) (-1659.780) (-1667.215) * [-1659.325] (-1660.401) (-1662.875) (-1661.851) -- 0:00:56 111500 -- (-1659.575) (-1661.395) [-1659.047] (-1659.040) * [-1658.259] (-1661.169) (-1663.219) (-1660.642) -- 0:00:55 112000 -- (-1658.841) (-1663.364) (-1659.102) [-1659.012] * (-1658.874) (-1660.598) [-1661.723] (-1659.417) -- 0:00:55 112500 -- (-1659.443) [-1660.823] (-1660.950) (-1666.072) * [-1660.626] (-1659.923) (-1666.518) (-1658.126) -- 0:01:03 113000 -- (-1658.782) (-1658.555) (-1662.710) [-1658.350] * (-1659.509) [-1657.751] (-1664.481) (-1663.085) -- 0:01:02 113500 -- (-1658.515) (-1661.371) (-1659.167) [-1659.194] * [-1659.503] (-1657.953) (-1666.679) (-1659.157) -- 0:01:02 114000 -- [-1659.058] (-1659.377) (-1660.089) (-1661.427) * (-1658.912) [-1657.813] (-1660.518) (-1661.243) -- 0:01:02 114500 -- (-1658.146) (-1660.210) [-1659.912] (-1659.218) * (-1662.369) [-1658.553] (-1660.289) (-1659.852) -- 0:01:01 115000 -- (-1658.252) [-1660.792] (-1661.847) (-1658.315) * (-1660.758) (-1660.459) [-1661.625] (-1659.276) -- 0:01:01 Average standard deviation of split frequencies: 0.026212 115500 -- [-1658.721] (-1658.800) (-1660.011) (-1658.029) * (-1658.664) [-1658.968] (-1661.890) (-1659.355) -- 0:01:01 116000 -- (-1658.034) [-1659.599] (-1660.149) (-1658.077) * [-1661.312] (-1659.569) (-1660.158) (-1663.176) -- 0:01:00 116500 -- [-1657.952] (-1659.359) (-1660.036) (-1662.798) * (-1659.805) (-1664.193) [-1659.554] (-1660.248) -- 0:01:00 117000 -- (-1658.745) (-1658.281) (-1658.977) [-1661.696] * [-1658.225] (-1666.917) (-1661.120) (-1661.435) -- 0:01:00 117500 -- (-1659.124) [-1659.522] (-1658.967) (-1659.766) * (-1659.071) [-1662.629] (-1658.289) (-1660.348) -- 0:01:00 118000 -- (-1661.398) (-1659.723) [-1658.894] (-1663.535) * (-1659.999) (-1660.557) [-1659.143] (-1658.844) -- 0:00:59 118500 -- (-1663.362) (-1670.657) [-1659.533] (-1666.137) * (-1662.454) (-1659.329) [-1659.120] (-1658.786) -- 0:00:59 119000 -- [-1664.147] (-1665.616) (-1659.801) (-1660.775) * (-1660.801) (-1660.055) [-1659.090] (-1659.080) -- 0:00:59 119500 -- (-1664.653) (-1664.221) (-1659.742) [-1659.909] * (-1658.777) (-1660.020) (-1661.304) [-1663.851] -- 0:00:58 120000 -- (-1664.186) (-1670.401) [-1659.475] (-1660.748) * (-1658.777) [-1660.223] (-1661.728) (-1661.612) -- 0:00:58 Average standard deviation of split frequencies: 0.022882 120500 -- (-1660.605) [-1663.468] (-1659.744) (-1659.682) * (-1658.346) (-1660.421) (-1658.177) [-1661.914] -- 0:00:58 121000 -- (-1659.755) (-1667.083) (-1659.386) [-1661.624] * [-1659.885] (-1660.669) (-1661.489) (-1661.572) -- 0:00:58 121500 -- (-1661.110) (-1665.131) (-1661.482) [-1663.216] * (-1660.109) (-1662.372) (-1662.980) [-1658.600] -- 0:00:57 122000 -- (-1660.769) (-1663.912) (-1661.248) [-1665.302] * (-1658.468) (-1662.023) (-1661.391) [-1658.718] -- 0:00:57 122500 -- (-1658.529) (-1663.798) [-1661.362] (-1660.324) * (-1658.573) (-1661.808) (-1660.259) [-1659.068] -- 0:00:57 123000 -- (-1663.907) (-1661.350) (-1660.238) [-1663.132] * (-1659.255) (-1660.496) (-1661.462) [-1662.874] -- 0:00:57 123500 -- (-1663.752) [-1661.050] (-1659.943) (-1658.140) * (-1660.586) (-1659.660) [-1660.324] (-1661.919) -- 0:00:56 124000 -- (-1660.430) (-1660.512) (-1657.952) [-1658.733] * [-1659.511] (-1664.057) (-1660.358) (-1660.944) -- 0:00:56 124500 -- (-1658.646) (-1662.846) (-1659.994) [-1658.935] * (-1659.193) (-1659.622) [-1660.022] (-1662.895) -- 0:00:56 125000 -- (-1658.605) (-1661.452) [-1660.902] (-1659.601) * (-1661.948) (-1661.783) [-1659.971] (-1660.599) -- 0:00:56 Average standard deviation of split frequencies: 0.023570 125500 -- (-1660.082) (-1665.039) (-1660.834) [-1659.439] * (-1660.412) (-1659.151) (-1661.826) [-1664.484] -- 0:00:55 126000 -- (-1658.925) (-1665.273) [-1661.898] (-1659.761) * [-1659.151] (-1657.872) (-1662.105) (-1659.705) -- 0:00:55 126500 -- [-1659.607] (-1676.800) (-1661.150) (-1660.619) * (-1659.094) (-1658.732) [-1658.548] (-1660.408) -- 0:00:55 127000 -- (-1659.602) (-1661.813) (-1662.461) [-1659.483] * (-1659.662) [-1657.607] (-1663.621) (-1659.635) -- 0:00:54 127500 -- (-1659.561) (-1658.710) (-1658.966) [-1659.745] * (-1661.977) [-1658.157] (-1659.740) (-1659.356) -- 0:01:01 128000 -- (-1659.588) [-1658.734] (-1659.353) (-1660.155) * (-1664.209) (-1661.501) [-1660.839] (-1661.745) -- 0:01:01 128500 -- (-1658.259) (-1658.651) [-1660.445] (-1658.341) * (-1658.850) [-1661.330] (-1662.729) (-1659.730) -- 0:01:01 129000 -- [-1659.282] (-1659.880) (-1660.435) (-1662.022) * [-1659.922] (-1658.041) (-1660.323) (-1659.737) -- 0:01:00 129500 -- (-1659.395) [-1658.564] (-1661.837) (-1658.724) * (-1665.791) (-1659.003) (-1659.114) [-1658.490] -- 0:01:00 130000 -- (-1662.852) (-1659.994) (-1661.622) [-1658.930] * [-1659.678] (-1661.293) (-1659.017) (-1658.978) -- 0:01:00 Average standard deviation of split frequencies: 0.020564 130500 -- (-1660.307) [-1659.595] (-1659.976) (-1658.847) * [-1658.731] (-1657.543) (-1660.494) (-1659.141) -- 0:00:59 131000 -- (-1662.122) (-1659.788) [-1667.071] (-1657.671) * [-1658.022] (-1658.572) (-1660.028) (-1659.730) -- 0:00:59 131500 -- (-1661.052) [-1659.592] (-1668.150) (-1658.832) * (-1659.464) (-1659.150) [-1659.688] (-1661.268) -- 0:00:59 132000 -- (-1659.877) (-1661.928) (-1664.745) [-1657.567] * [-1660.005] (-1663.256) (-1661.974) (-1661.685) -- 0:00:59 132500 -- (-1662.575) (-1660.717) (-1661.524) [-1659.636] * (-1660.960) (-1659.830) [-1660.210] (-1660.720) -- 0:00:58 133000 -- (-1665.301) [-1658.644] (-1663.914) (-1659.636) * [-1661.294] (-1657.653) (-1659.049) (-1663.193) -- 0:00:58 133500 -- (-1661.301) [-1658.242] (-1666.333) (-1662.677) * [-1666.378] (-1658.280) (-1658.450) (-1660.906) -- 0:00:58 134000 -- (-1659.087) [-1661.508] (-1665.367) (-1663.583) * (-1660.639) (-1662.079) (-1658.150) [-1657.542] -- 0:00:58 134500 -- (-1659.590) [-1661.612] (-1666.244) (-1663.124) * [-1659.017] (-1661.804) (-1658.420) (-1659.151) -- 0:00:57 135000 -- (-1660.709) (-1663.082) [-1665.194] (-1666.792) * (-1658.082) [-1663.041] (-1659.756) (-1659.474) -- 0:00:57 Average standard deviation of split frequencies: 0.022074 135500 -- (-1662.072) (-1659.166) [-1662.583] (-1660.260) * (-1659.434) [-1669.172] (-1661.069) (-1660.174) -- 0:00:57 136000 -- (-1662.081) [-1662.977] (-1660.868) (-1658.675) * (-1660.156) (-1658.885) [-1660.337] (-1661.720) -- 0:00:57 136500 -- (-1665.947) (-1660.973) (-1659.142) [-1659.176] * [-1657.862] (-1659.187) (-1659.408) (-1659.853) -- 0:00:56 137000 -- (-1663.534) [-1659.005] (-1659.319) (-1658.767) * (-1658.456) (-1660.272) (-1660.159) [-1658.059] -- 0:00:56 137500 -- [-1661.063] (-1658.931) (-1658.722) (-1659.192) * (-1658.616) (-1665.726) [-1659.412] (-1659.459) -- 0:00:56 138000 -- (-1660.429) [-1658.929] (-1659.867) (-1658.635) * (-1662.296) (-1659.260) (-1662.636) [-1662.164] -- 0:00:56 138500 -- (-1659.623) (-1658.381) (-1660.162) [-1658.417] * (-1660.174) [-1659.667] (-1659.498) (-1658.387) -- 0:00:55 139000 -- (-1659.641) [-1658.354] (-1659.256) (-1658.417) * (-1660.887) [-1659.234] (-1659.173) (-1658.970) -- 0:00:55 139500 -- (-1661.553) (-1659.607) [-1658.606] (-1658.250) * (-1659.067) (-1659.287) (-1658.688) [-1658.756] -- 0:00:55 140000 -- [-1659.443] (-1659.544) (-1658.670) (-1658.323) * (-1660.692) (-1659.099) [-1657.865] (-1660.205) -- 0:00:55 Average standard deviation of split frequencies: 0.022341 140500 -- (-1657.858) (-1660.017) (-1660.984) [-1659.231] * (-1659.673) (-1659.427) [-1658.935] (-1661.123) -- 0:00:55 141000 -- (-1658.217) (-1659.628) [-1659.747] (-1659.078) * (-1660.163) [-1659.195] (-1658.667) (-1660.857) -- 0:00:54 141500 -- (-1659.492) [-1661.270] (-1658.840) (-1660.627) * (-1661.681) (-1661.424) [-1658.231] (-1661.643) -- 0:00:54 142000 -- (-1660.340) (-1660.122) [-1658.572] (-1661.950) * (-1660.849) (-1663.317) (-1658.794) [-1660.888] -- 0:00:54 142500 -- [-1660.904] (-1659.208) (-1659.094) (-1659.902) * (-1660.795) (-1662.906) [-1657.668] (-1658.955) -- 0:00:54 143000 -- (-1661.951) [-1660.638] (-1658.615) (-1658.236) * [-1659.133] (-1659.793) (-1659.838) (-1660.952) -- 0:00:59 143500 -- (-1662.984) (-1664.848) [-1658.709] (-1660.170) * (-1660.982) (-1659.938) (-1658.822) [-1658.635] -- 0:00:59 144000 -- (-1663.208) (-1659.711) (-1658.845) [-1659.345] * (-1661.465) (-1662.517) (-1659.547) [-1658.814] -- 0:00:59 144500 -- (-1659.143) (-1659.112) [-1659.941] (-1659.153) * [-1661.242] (-1662.530) (-1658.390) (-1658.882) -- 0:00:59 145000 -- (-1660.296) (-1658.646) [-1658.625] (-1659.557) * (-1660.927) (-1659.320) [-1660.130] (-1661.026) -- 0:00:58 Average standard deviation of split frequencies: 0.021242 145500 -- (-1664.280) (-1660.096) (-1657.755) [-1660.482] * (-1660.151) (-1660.208) (-1663.601) [-1662.156] -- 0:00:58 146000 -- (-1661.212) (-1659.822) (-1663.549) [-1659.408] * (-1661.013) (-1662.239) [-1659.925] (-1659.895) -- 0:00:58 146500 -- (-1660.116) [-1661.976] (-1665.775) (-1658.956) * [-1662.596] (-1659.205) (-1659.268) (-1659.371) -- 0:00:58 147000 -- (-1658.871) (-1658.372) (-1658.976) [-1659.141] * (-1665.273) (-1662.159) [-1659.931] (-1659.261) -- 0:00:58 147500 -- (-1658.252) (-1661.686) (-1658.429) [-1658.711] * (-1659.373) [-1659.717] (-1659.234) (-1663.024) -- 0:00:57 148000 -- (-1660.874) [-1659.479] (-1662.128) (-1665.437) * [-1661.958] (-1660.520) (-1662.792) (-1659.926) -- 0:00:57 148500 -- (-1659.694) [-1659.471] (-1659.122) (-1661.606) * [-1658.744] (-1658.789) (-1658.590) (-1659.503) -- 0:00:57 149000 -- [-1660.785] (-1658.836) (-1659.594) (-1658.048) * (-1658.514) [-1658.695] (-1661.433) (-1658.602) -- 0:00:57 149500 -- (-1661.469) (-1661.041) [-1659.282] (-1659.213) * [-1659.722] (-1660.389) (-1663.830) (-1658.820) -- 0:00:56 150000 -- (-1664.031) [-1659.945] (-1662.066) (-1659.213) * (-1661.162) [-1658.324] (-1662.615) (-1659.905) -- 0:00:56 Average standard deviation of split frequencies: 0.020963 150500 -- (-1659.491) (-1664.607) (-1661.677) [-1660.403] * (-1661.181) (-1659.260) (-1664.385) [-1660.841] -- 0:00:56 151000 -- (-1658.254) (-1663.496) [-1657.821] (-1660.157) * (-1659.550) (-1661.181) (-1660.027) [-1658.185] -- 0:00:56 151500 -- [-1658.212] (-1661.708) (-1665.314) (-1663.375) * (-1661.390) [-1664.570] (-1662.203) (-1659.409) -- 0:00:56 152000 -- [-1658.639] (-1665.274) (-1662.832) (-1661.310) * (-1658.405) [-1658.550] (-1657.944) (-1659.102) -- 0:00:55 152500 -- (-1658.489) [-1663.294] (-1662.642) (-1662.143) * (-1660.754) (-1660.707) (-1658.015) [-1658.661] -- 0:00:55 153000 -- (-1659.009) (-1660.457) [-1662.983] (-1660.264) * (-1667.430) (-1662.021) [-1659.039] (-1660.771) -- 0:00:55 153500 -- (-1660.549) (-1661.610) [-1659.612] (-1659.250) * (-1661.926) (-1660.633) [-1658.888] (-1659.346) -- 0:00:55 154000 -- [-1662.020] (-1660.864) (-1662.073) (-1662.297) * (-1661.517) (-1659.143) [-1659.294] (-1660.252) -- 0:00:54 154500 -- (-1660.619) (-1658.974) [-1663.804] (-1662.297) * (-1659.780) (-1658.882) [-1659.002] (-1662.000) -- 0:00:54 155000 -- (-1659.791) [-1657.952] (-1665.514) (-1662.297) * (-1660.548) (-1661.499) [-1659.797] (-1665.371) -- 0:00:54 Average standard deviation of split frequencies: 0.018850 155500 -- (-1659.574) (-1658.721) (-1664.993) [-1658.984] * (-1661.699) (-1661.662) [-1661.050] (-1658.347) -- 0:00:54 156000 -- (-1659.703) (-1658.994) [-1660.095] (-1658.983) * (-1658.137) (-1663.713) [-1661.119] (-1663.687) -- 0:00:54 156500 -- [-1658.330] (-1658.993) (-1662.940) (-1658.342) * (-1659.602) [-1659.859] (-1658.155) (-1659.137) -- 0:00:53 157000 -- (-1659.012) (-1657.974) (-1662.024) [-1658.182] * (-1660.389) (-1659.592) (-1658.566) [-1660.106] -- 0:00:53 157500 -- (-1659.076) [-1658.436] (-1663.503) (-1659.624) * (-1659.689) [-1658.744] (-1660.475) (-1661.067) -- 0:00:58 158000 -- [-1659.114] (-1660.203) (-1658.016) (-1661.208) * (-1660.289) (-1659.584) (-1660.417) [-1661.335] -- 0:00:58 158500 -- (-1661.680) [-1660.070] (-1659.902) (-1658.778) * (-1663.105) [-1659.893] (-1659.434) (-1661.534) -- 0:00:58 159000 -- (-1658.280) (-1659.149) [-1659.505] (-1661.775) * [-1658.578] (-1659.103) (-1659.832) (-1660.035) -- 0:00:58 159500 -- (-1659.508) [-1658.661] (-1658.496) (-1659.741) * [-1659.165] (-1659.888) (-1660.041) (-1665.652) -- 0:00:57 160000 -- (-1659.179) [-1658.817] (-1667.017) (-1659.950) * (-1658.316) [-1662.531] (-1658.577) (-1666.186) -- 0:00:57 Average standard deviation of split frequencies: 0.019980 160500 -- [-1659.515] (-1658.401) (-1657.821) (-1660.008) * (-1658.734) (-1659.154) [-1660.094] (-1658.400) -- 0:00:57 161000 -- (-1658.290) [-1660.024] (-1657.920) (-1660.935) * (-1660.328) (-1658.463) (-1660.393) [-1659.377] -- 0:00:57 161500 -- (-1658.039) (-1661.227) (-1659.886) [-1661.439] * (-1660.413) (-1660.233) (-1662.111) [-1659.515] -- 0:00:57 162000 -- (-1657.780) [-1663.024] (-1659.391) (-1661.417) * [-1658.734] (-1661.928) (-1663.331) (-1660.186) -- 0:00:56 162500 -- (-1660.096) (-1662.569) [-1661.314] (-1660.698) * (-1658.099) [-1660.423] (-1663.284) (-1662.724) -- 0:00:56 163000 -- [-1657.668] (-1664.172) (-1661.498) (-1658.681) * (-1657.888) [-1659.717] (-1661.636) (-1660.827) -- 0:00:56 163500 -- (-1662.017) [-1660.965] (-1659.621) (-1662.262) * (-1659.324) (-1661.084) [-1660.766] (-1660.243) -- 0:00:56 164000 -- (-1660.374) (-1658.231) (-1658.320) [-1659.114] * (-1662.408) [-1658.253] (-1662.208) (-1658.989) -- 0:00:56 164500 -- (-1660.893) (-1659.893) (-1658.163) [-1659.494] * (-1660.869) (-1658.866) (-1659.490) [-1658.640] -- 0:00:55 165000 -- (-1662.696) (-1659.951) [-1658.596] (-1659.963) * (-1661.043) [-1657.650] (-1662.418) (-1660.709) -- 0:00:55 Average standard deviation of split frequencies: 0.020690 165500 -- (-1661.392) (-1661.694) [-1658.710] (-1658.710) * [-1659.533] (-1657.920) (-1664.631) (-1659.566) -- 0:00:55 166000 -- (-1657.599) [-1659.102] (-1660.060) (-1658.477) * (-1659.235) (-1658.023) (-1660.306) [-1660.343] -- 0:00:55 166500 -- [-1657.619] (-1659.102) (-1657.783) (-1662.589) * (-1663.730) (-1659.325) [-1661.746] (-1660.343) -- 0:00:55 167000 -- [-1659.594] (-1659.102) (-1658.015) (-1661.416) * (-1662.575) [-1658.128] (-1660.724) (-1660.537) -- 0:00:54 167500 -- [-1658.673] (-1660.312) (-1659.143) (-1660.943) * (-1663.979) [-1659.645] (-1660.112) (-1659.814) -- 0:00:54 168000 -- (-1658.227) (-1661.139) (-1659.921) [-1661.141] * (-1662.716) (-1658.567) (-1661.601) [-1659.818] -- 0:00:54 168500 -- [-1661.540] (-1661.577) (-1658.247) (-1662.799) * (-1663.513) (-1660.851) (-1660.252) [-1659.714] -- 0:00:54 169000 -- (-1659.721) [-1658.878] (-1658.474) (-1660.775) * (-1662.420) (-1663.042) (-1658.827) [-1659.046] -- 0:00:54 169500 -- [-1657.843] (-1662.461) (-1660.297) (-1663.072) * [-1661.861] (-1660.216) (-1659.982) (-1660.244) -- 0:00:53 170000 -- [-1657.848] (-1660.970) (-1663.588) (-1663.233) * (-1661.544) [-1659.793] (-1658.322) (-1659.578) -- 0:00:53 Average standard deviation of split frequencies: 0.020913 170500 -- (-1659.052) (-1663.095) [-1664.158] (-1663.232) * (-1660.496) (-1658.660) [-1659.143] (-1659.661) -- 0:00:53 171000 -- (-1662.175) (-1660.463) (-1659.264) [-1661.446] * (-1661.228) (-1658.443) [-1659.274] (-1660.604) -- 0:00:53 171500 -- [-1661.022] (-1659.827) (-1660.582) (-1661.522) * [-1659.897] (-1658.901) (-1659.682) (-1658.314) -- 0:00:53 172000 -- [-1660.214] (-1662.455) (-1659.049) (-1663.866) * (-1659.161) (-1658.904) [-1658.903] (-1658.116) -- 0:00:52 172500 -- [-1663.771] (-1661.516) (-1658.598) (-1660.732) * [-1659.097] (-1660.349) (-1658.707) (-1658.857) -- 0:00:57 173000 -- [-1662.884] (-1660.981) (-1658.865) (-1660.745) * (-1660.096) (-1658.651) (-1659.562) [-1660.039] -- 0:00:57 173500 -- (-1663.661) (-1659.986) (-1658.111) [-1659.812] * (-1659.168) [-1660.846] (-1658.862) (-1660.198) -- 0:00:57 174000 -- (-1661.442) (-1659.905) (-1661.987) [-1659.017] * (-1660.568) [-1660.182] (-1659.641) (-1666.282) -- 0:00:56 174500 -- (-1661.442) (-1658.140) [-1659.268] (-1659.017) * [-1662.232] (-1660.658) (-1659.370) (-1664.141) -- 0:00:56 175000 -- (-1662.288) (-1664.201) [-1658.638] (-1658.352) * [-1659.083] (-1658.928) (-1660.079) (-1661.052) -- 0:00:56 Average standard deviation of split frequencies: 0.021172 175500 -- [-1659.926] (-1662.531) (-1658.173) (-1658.724) * [-1659.918] (-1658.767) (-1661.315) (-1658.375) -- 0:00:56 176000 -- (-1660.009) (-1658.215) [-1658.993] (-1662.422) * (-1659.211) [-1660.114] (-1659.288) (-1663.030) -- 0:00:56 176500 -- [-1661.227] (-1659.492) (-1659.964) (-1660.394) * [-1658.125] (-1664.966) (-1659.317) (-1661.700) -- 0:00:55 177000 -- [-1658.844] (-1661.071) (-1660.410) (-1661.683) * [-1658.873] (-1660.626) (-1662.243) (-1662.740) -- 0:00:55 177500 -- (-1659.071) (-1659.378) (-1661.927) [-1660.845] * (-1662.849) [-1660.164] (-1662.980) (-1661.940) -- 0:00:55 178000 -- (-1661.489) (-1657.899) (-1658.954) [-1658.932] * [-1659.295] (-1660.968) (-1658.611) (-1658.785) -- 0:00:55 178500 -- (-1664.610) (-1659.823) (-1659.248) [-1660.685] * (-1660.996) (-1663.316) [-1658.611] (-1660.188) -- 0:00:55 179000 -- [-1658.877] (-1662.270) (-1659.745) (-1662.105) * (-1662.469) (-1660.132) [-1658.803] (-1658.347) -- 0:00:55 179500 -- (-1663.332) (-1659.937) (-1659.526) [-1657.831] * (-1663.052) (-1658.960) (-1658.465) [-1660.003] -- 0:00:54 180000 -- [-1658.570] (-1658.805) (-1659.341) (-1658.308) * (-1659.872) (-1658.236) [-1658.075] (-1659.094) -- 0:00:54 Average standard deviation of split frequencies: 0.021423 180500 -- (-1658.532) [-1660.125] (-1659.392) (-1659.393) * (-1659.890) [-1658.493] (-1658.156) (-1658.742) -- 0:00:54 181000 -- [-1658.965] (-1659.155) (-1660.624) (-1659.699) * (-1660.945) [-1659.933] (-1658.290) (-1659.726) -- 0:00:54 181500 -- (-1659.381) (-1660.268) (-1661.178) [-1659.143] * (-1661.778) (-1659.328) [-1659.097] (-1659.116) -- 0:00:54 182000 -- [-1658.904] (-1660.163) (-1659.618) (-1665.579) * (-1660.215) (-1659.576) [-1659.130] (-1659.116) -- 0:00:53 182500 -- (-1658.993) (-1661.445) [-1660.166] (-1659.333) * (-1658.096) [-1661.168] (-1660.171) (-1662.530) -- 0:00:53 183000 -- (-1659.731) (-1661.483) (-1658.563) [-1659.449] * (-1659.916) [-1659.024] (-1660.016) (-1661.883) -- 0:00:53 183500 -- [-1660.490] (-1663.308) (-1658.391) (-1658.985) * (-1659.724) (-1661.896) (-1658.797) [-1661.645] -- 0:00:53 184000 -- [-1660.085] (-1658.403) (-1658.434) (-1664.126) * (-1659.643) [-1660.109] (-1658.851) (-1659.085) -- 0:00:53 184500 -- (-1660.265) (-1660.161) (-1659.088) [-1663.091] * [-1659.142] (-1658.054) (-1660.704) (-1659.375) -- 0:00:53 185000 -- [-1660.884] (-1664.166) (-1659.069) (-1662.783) * (-1659.975) [-1658.108] (-1660.388) (-1659.899) -- 0:00:52 Average standard deviation of split frequencies: 0.018628 185500 -- (-1660.723) (-1662.701) [-1662.274] (-1662.548) * (-1659.308) (-1658.072) (-1660.699) [-1658.718] -- 0:00:52 186000 -- [-1660.891] (-1658.127) (-1664.178) (-1663.133) * [-1661.396] (-1659.553) (-1659.274) (-1662.439) -- 0:00:52 186500 -- [-1661.209] (-1658.408) (-1660.261) (-1658.544) * [-1659.912] (-1659.493) (-1662.171) (-1666.007) -- 0:00:52 187000 -- (-1661.378) (-1662.371) [-1661.221] (-1658.882) * (-1663.357) (-1658.484) [-1661.131] (-1661.845) -- 0:00:52 187500 -- (-1663.697) (-1664.834) (-1661.910) [-1659.171] * (-1662.839) (-1660.020) (-1660.567) [-1660.804] -- 0:00:52 188000 -- (-1663.752) (-1660.660) (-1658.520) [-1660.293] * (-1662.537) (-1662.491) (-1659.678) [-1660.476] -- 0:00:56 188500 -- (-1658.060) (-1659.177) [-1658.128] (-1657.588) * (-1660.208) (-1662.150) (-1660.093) [-1658.754] -- 0:00:55 189000 -- (-1657.785) (-1658.492) (-1663.286) [-1657.716] * (-1660.123) (-1663.955) (-1658.936) [-1658.762] -- 0:00:55 189500 -- (-1657.643) [-1658.483] (-1662.091) (-1658.435) * (-1661.728) (-1658.272) (-1658.419) [-1657.966] -- 0:00:55 190000 -- (-1658.624) [-1660.305] (-1662.309) (-1661.773) * (-1661.942) [-1658.632] (-1658.681) (-1657.529) -- 0:00:55 Average standard deviation of split frequencies: 0.019037 190500 -- (-1659.664) (-1661.455) (-1662.779) [-1660.625] * (-1661.924) (-1659.943) (-1658.094) [-1659.116] -- 0:00:55 191000 -- (-1658.953) [-1660.580] (-1662.616) (-1662.157) * (-1660.746) (-1658.530) (-1659.534) [-1658.754] -- 0:00:55 191500 -- (-1660.165) [-1662.768] (-1660.046) (-1659.685) * (-1659.116) (-1659.122) [-1658.660] (-1658.611) -- 0:00:54 192000 -- [-1659.992] (-1661.915) (-1660.336) (-1658.900) * (-1659.859) (-1659.271) [-1660.357] (-1659.019) -- 0:00:54 192500 -- (-1658.396) (-1661.432) [-1661.453] (-1658.986) * (-1658.683) (-1658.290) [-1659.338] (-1658.791) -- 0:00:54 193000 -- (-1659.603) (-1659.186) (-1658.278) [-1658.447] * (-1659.595) (-1658.256) [-1658.356] (-1659.870) -- 0:00:54 193500 -- [-1660.454] (-1658.947) (-1661.939) (-1658.688) * [-1658.655] (-1660.770) (-1658.757) (-1660.959) -- 0:00:54 194000 -- (-1658.618) [-1658.243] (-1662.234) (-1659.444) * (-1660.378) (-1659.895) (-1658.736) [-1658.240] -- 0:00:54 194500 -- (-1658.517) [-1666.629] (-1657.977) (-1657.939) * (-1661.249) (-1658.033) [-1657.871] (-1659.726) -- 0:00:53 195000 -- (-1660.834) (-1660.799) [-1659.795] (-1657.939) * [-1659.001] (-1659.060) (-1658.354) (-1660.296) -- 0:00:53 Average standard deviation of split frequencies: 0.018306 195500 -- (-1661.197) (-1661.128) [-1659.158] (-1659.091) * (-1660.743) [-1658.136] (-1659.975) (-1659.150) -- 0:00:53 196000 -- (-1660.481) [-1660.103] (-1658.311) (-1658.901) * (-1662.278) (-1660.654) [-1659.070] (-1658.782) -- 0:00:53 196500 -- [-1660.901] (-1660.192) (-1658.406) (-1658.440) * (-1667.083) [-1660.377] (-1658.352) (-1658.353) -- 0:00:53 197000 -- [-1660.667] (-1661.067) (-1660.829) (-1659.649) * (-1660.408) [-1659.782] (-1659.994) (-1658.976) -- 0:00:52 197500 -- (-1660.760) (-1661.723) (-1659.806) [-1659.025] * (-1661.034) (-1659.773) (-1660.240) [-1657.535] -- 0:00:52 198000 -- (-1659.922) [-1659.191] (-1659.465) (-1658.921) * (-1660.552) (-1659.718) (-1659.561) [-1660.219] -- 0:00:52 198500 -- (-1659.669) (-1659.826) (-1659.465) [-1658.951] * (-1661.260) (-1659.546) [-1659.986] (-1658.585) -- 0:00:52 199000 -- (-1661.373) [-1660.716] (-1658.562) (-1658.741) * (-1663.994) (-1660.244) (-1660.929) [-1661.848] -- 0:00:52 199500 -- (-1658.356) [-1658.874] (-1660.129) (-1659.425) * (-1660.628) [-1661.516] (-1660.487) (-1661.293) -- 0:00:52 200000 -- [-1659.273] (-1659.062) (-1658.248) (-1662.251) * (-1665.079) (-1659.454) (-1658.912) [-1663.847] -- 0:00:51 Average standard deviation of split frequencies: 0.015270 200500 -- (-1660.276) [-1660.136] (-1657.553) (-1663.743) * (-1660.147) [-1660.047] (-1658.912) (-1663.547) -- 0:00:51 201000 -- (-1659.605) [-1661.297] (-1658.184) (-1660.443) * [-1659.105] (-1659.824) (-1658.318) (-1660.050) -- 0:00:51 201500 -- (-1662.955) (-1662.440) [-1658.209] (-1661.386) * (-1659.240) (-1659.898) (-1662.567) [-1658.019] -- 0:00:51 202000 -- (-1662.070) (-1659.405) [-1658.249] (-1662.881) * [-1658.534] (-1659.785) (-1659.907) (-1657.809) -- 0:00:51 202500 -- (-1662.120) (-1659.293) [-1658.723] (-1660.192) * (-1659.058) (-1658.936) [-1662.234] (-1660.111) -- 0:00:51 203000 -- (-1663.213) [-1659.369] (-1659.513) (-1658.722) * (-1662.036) (-1658.437) [-1662.866] (-1658.484) -- 0:00:54 203500 -- [-1660.272] (-1660.591) (-1660.264) (-1658.257) * (-1660.567) [-1660.832] (-1660.970) (-1662.564) -- 0:00:54 204000 -- (-1658.563) (-1664.804) (-1660.647) [-1659.846] * (-1660.908) (-1660.698) [-1659.480] (-1664.126) -- 0:00:54 204500 -- (-1659.384) (-1658.989) [-1660.479] (-1659.664) * [-1658.822] (-1661.951) (-1663.559) (-1662.270) -- 0:00:54 205000 -- [-1661.193] (-1658.620) (-1659.032) (-1659.766) * (-1659.824) (-1659.511) (-1660.696) [-1659.224] -- 0:00:54 Average standard deviation of split frequencies: 0.014935 205500 -- (-1658.983) (-1660.667) [-1658.523] (-1660.711) * (-1660.222) (-1666.791) [-1660.231] (-1659.471) -- 0:00:54 206000 -- [-1660.997] (-1660.342) (-1659.477) (-1660.813) * [-1661.515] (-1658.140) (-1660.298) (-1668.516) -- 0:00:53 206500 -- [-1659.677] (-1659.952) (-1658.895) (-1667.372) * (-1662.126) [-1661.409] (-1658.614) (-1662.816) -- 0:00:53 207000 -- [-1659.969] (-1659.628) (-1659.640) (-1662.945) * (-1659.802) (-1661.672) [-1661.319] (-1661.897) -- 0:00:53 207500 -- (-1663.813) [-1659.497] (-1659.334) (-1661.929) * [-1661.079] (-1662.427) (-1660.076) (-1659.123) -- 0:00:53 208000 -- [-1660.479] (-1657.516) (-1658.177) (-1658.213) * (-1661.736) (-1660.556) [-1659.311] (-1659.950) -- 0:00:53 208500 -- (-1658.146) (-1657.797) [-1658.986] (-1658.089) * (-1660.057) (-1662.814) (-1658.001) [-1659.517] -- 0:00:53 209000 -- (-1661.236) (-1660.849) [-1661.666] (-1658.285) * [-1660.337] (-1663.598) (-1660.786) (-1658.195) -- 0:00:52 209500 -- [-1659.289] (-1659.472) (-1664.117) (-1657.781) * [-1665.428] (-1663.042) (-1659.881) (-1658.043) -- 0:00:52 210000 -- (-1657.924) (-1658.372) [-1658.579] (-1660.869) * (-1660.872) (-1665.872) [-1662.149] (-1662.485) -- 0:00:52 Average standard deviation of split frequencies: 0.013675 210500 -- (-1659.907) [-1658.373] (-1660.099) (-1660.732) * (-1659.392) (-1659.133) (-1659.404) [-1662.131] -- 0:00:52 211000 -- (-1665.090) [-1662.655] (-1659.716) (-1664.142) * [-1662.406] (-1660.560) (-1657.991) (-1669.871) -- 0:00:52 211500 -- (-1659.518) (-1661.535) (-1661.870) [-1659.637] * (-1659.386) (-1660.494) [-1659.083] (-1664.231) -- 0:00:52 212000 -- [-1659.445] (-1662.251) (-1662.038) (-1658.226) * (-1660.200) [-1659.740] (-1659.411) (-1664.332) -- 0:00:52 212500 -- (-1660.485) (-1663.688) [-1658.691] (-1663.145) * [-1659.893] (-1659.870) (-1660.117) (-1661.925) -- 0:00:51 213000 -- [-1657.988] (-1660.355) (-1658.975) (-1662.365) * (-1658.208) [-1661.197] (-1660.116) (-1665.273) -- 0:00:51 213500 -- (-1663.077) [-1659.725] (-1661.460) (-1657.914) * [-1658.697] (-1664.181) (-1658.744) (-1662.806) -- 0:00:51 214000 -- (-1659.077) (-1663.740) (-1659.030) [-1658.790] * (-1658.680) (-1658.558) (-1661.854) [-1659.204] -- 0:00:51 214500 -- (-1662.025) (-1660.226) [-1659.389] (-1660.354) * (-1659.125) (-1659.768) [-1661.052] (-1661.316) -- 0:00:51 215000 -- (-1659.129) [-1661.361] (-1659.376) (-1659.217) * [-1658.690] (-1663.644) (-1659.449) (-1658.375) -- 0:00:51 Average standard deviation of split frequencies: 0.013822 215500 -- [-1662.455] (-1660.692) (-1660.391) (-1658.128) * [-1657.843] (-1662.168) (-1665.081) (-1658.744) -- 0:00:50 216000 -- (-1659.110) [-1661.024] (-1660.391) (-1658.072) * (-1658.539) (-1661.070) [-1663.557] (-1658.801) -- 0:00:50 216500 -- (-1659.478) (-1660.778) [-1660.136] (-1659.827) * [-1658.203] (-1660.683) (-1659.829) (-1658.834) -- 0:00:50 217000 -- (-1659.768) (-1661.516) (-1660.663) [-1659.722] * (-1657.879) (-1661.682) (-1659.316) [-1659.539] -- 0:00:50 217500 -- (-1659.104) (-1662.081) (-1660.208) [-1659.200] * (-1659.495) (-1662.092) [-1659.169] (-1658.296) -- 0:00:50 218000 -- (-1662.070) [-1658.873] (-1659.911) (-1660.463) * (-1659.586) (-1661.474) (-1658.196) [-1658.210] -- 0:00:50 218500 -- (-1660.373) (-1657.938) [-1661.463] (-1661.232) * (-1661.113) (-1662.228) (-1657.856) [-1658.256] -- 0:00:53 219000 -- (-1660.405) (-1658.857) [-1658.950] (-1664.367) * (-1658.373) [-1657.699] (-1658.253) (-1659.579) -- 0:00:53 219500 -- [-1657.953] (-1657.860) (-1658.080) (-1659.339) * (-1658.134) (-1660.980) (-1659.411) [-1659.240] -- 0:00:53 220000 -- [-1658.058] (-1657.829) (-1660.178) (-1660.116) * (-1662.069) (-1659.269) [-1660.166] (-1662.752) -- 0:00:53 Average standard deviation of split frequencies: 0.012818 220500 -- (-1659.894) (-1659.189) (-1660.367) [-1658.675] * (-1661.713) (-1661.933) [-1659.696] (-1661.726) -- 0:00:53 221000 -- (-1659.138) (-1661.302) [-1659.097] (-1659.963) * (-1659.739) (-1659.946) (-1658.593) [-1659.373] -- 0:00:52 221500 -- [-1662.106] (-1661.524) (-1661.324) (-1658.087) * (-1662.189) (-1659.837) (-1657.891) [-1661.905] -- 0:00:52 222000 -- [-1662.390] (-1662.722) (-1662.038) (-1659.158) * (-1659.339) [-1659.802] (-1660.480) (-1661.005) -- 0:00:52 222500 -- (-1659.691) (-1662.721) [-1663.208] (-1659.335) * (-1659.339) (-1658.652) (-1660.229) [-1661.555] -- 0:00:52 223000 -- [-1658.071] (-1661.523) (-1661.272) (-1658.000) * (-1661.091) [-1658.740] (-1663.198) (-1658.938) -- 0:00:52 223500 -- [-1658.055] (-1660.693) (-1663.727) (-1658.094) * [-1660.893] (-1663.073) (-1663.077) (-1658.987) -- 0:00:52 224000 -- (-1661.622) (-1659.851) (-1664.956) [-1658.843] * (-1660.144) [-1663.265] (-1659.660) (-1659.109) -- 0:00:51 224500 -- (-1660.787) (-1660.746) [-1658.578] (-1659.093) * [-1659.488] (-1659.703) (-1660.419) (-1662.360) -- 0:00:51 225000 -- (-1659.785) (-1658.468) (-1662.309) [-1658.389] * (-1662.460) (-1659.626) [-1660.591] (-1659.499) -- 0:00:51 Average standard deviation of split frequencies: 0.011966 225500 -- [-1661.020] (-1658.384) (-1665.438) (-1658.382) * [-1661.508] (-1657.587) (-1662.981) (-1659.230) -- 0:00:51 226000 -- (-1658.984) [-1658.590] (-1660.446) (-1658.549) * (-1661.243) (-1658.077) [-1659.420] (-1658.818) -- 0:00:51 226500 -- (-1661.771) (-1658.690) (-1664.180) [-1658.071] * (-1661.869) (-1658.027) [-1661.133] (-1660.742) -- 0:00:51 227000 -- [-1664.228] (-1658.764) (-1664.384) (-1657.951) * (-1668.199) [-1658.673] (-1661.246) (-1664.738) -- 0:00:51 227500 -- (-1659.526) (-1658.731) (-1662.907) [-1658.290] * (-1661.479) [-1661.612] (-1661.126) (-1658.565) -- 0:00:50 228000 -- (-1661.962) [-1659.687] (-1664.698) (-1660.936) * (-1661.537) (-1662.535) (-1659.021) [-1658.904] -- 0:00:50 228500 -- [-1663.262] (-1660.259) (-1663.256) (-1658.957) * [-1659.643] (-1660.608) (-1662.401) (-1663.639) -- 0:00:50 229000 -- (-1660.634) (-1659.716) (-1659.314) [-1657.691] * (-1661.201) [-1660.721] (-1661.918) (-1659.530) -- 0:00:50 229500 -- (-1660.374) (-1659.162) (-1661.224) [-1657.608] * (-1662.803) [-1662.019] (-1659.672) (-1658.955) -- 0:00:50 230000 -- (-1661.147) (-1657.693) (-1659.388) [-1659.386] * (-1659.466) (-1661.285) (-1660.759) [-1658.697] -- 0:00:50 Average standard deviation of split frequencies: 0.012262 230500 -- (-1658.531) [-1658.688] (-1659.583) (-1659.299) * [-1659.464] (-1660.864) (-1659.186) (-1661.272) -- 0:00:50 231000 -- (-1659.267) [-1658.256] (-1660.174) (-1661.710) * [-1661.051] (-1659.511) (-1660.947) (-1661.870) -- 0:00:49 231500 -- (-1660.007) (-1657.898) (-1659.804) [-1658.545] * [-1660.480] (-1658.985) (-1658.713) (-1661.202) -- 0:00:49 232000 -- (-1659.158) (-1658.116) (-1658.726) [-1658.761] * (-1660.963) [-1660.836] (-1657.975) (-1660.621) -- 0:00:49 232500 -- (-1659.065) (-1658.116) [-1658.908] (-1658.687) * (-1662.729) (-1658.744) [-1660.044] (-1660.239) -- 0:00:49 233000 -- (-1659.896) (-1660.201) (-1658.903) [-1657.960] * (-1659.943) [-1659.707] (-1662.027) (-1664.258) -- 0:00:52 233500 -- (-1659.950) [-1658.942] (-1661.820) (-1662.387) * (-1659.433) (-1660.135) [-1660.276] (-1663.658) -- 0:00:52 234000 -- (-1663.691) [-1658.138] (-1659.465) (-1660.852) * (-1660.069) [-1660.611] (-1661.122) (-1658.930) -- 0:00:52 234500 -- (-1660.084) (-1658.475) (-1657.672) [-1658.460] * (-1660.829) (-1660.376) [-1660.601] (-1660.802) -- 0:00:52 235000 -- (-1658.999) (-1659.589) [-1657.905] (-1660.925) * (-1658.749) (-1661.639) [-1659.564] (-1660.837) -- 0:00:52 Average standard deviation of split frequencies: 0.011763 235500 -- (-1659.219) (-1662.985) (-1658.072) [-1659.404] * [-1658.066] (-1662.267) (-1658.787) (-1658.006) -- 0:00:51 236000 -- (-1661.497) (-1659.682) (-1659.682) [-1659.354] * (-1657.884) (-1659.092) (-1659.798) [-1662.561] -- 0:00:51 236500 -- (-1660.912) (-1658.262) [-1658.112] (-1659.680) * (-1659.686) [-1660.098] (-1659.727) (-1663.304) -- 0:00:51 237000 -- (-1660.898) (-1659.353) [-1658.048] (-1659.878) * (-1660.550) (-1658.927) (-1659.513) [-1666.075] -- 0:00:51 237500 -- (-1660.018) (-1659.817) (-1658.758) [-1660.064] * [-1658.013] (-1662.727) (-1658.101) (-1663.177) -- 0:00:51 238000 -- (-1659.667) (-1658.612) (-1661.518) [-1659.750] * (-1659.194) [-1659.434] (-1662.193) (-1659.393) -- 0:00:51 238500 -- (-1660.573) [-1662.553] (-1659.918) (-1659.093) * (-1666.183) (-1662.413) (-1658.712) [-1658.453] -- 0:00:51 239000 -- (-1661.078) (-1659.529) [-1658.610] (-1658.103) * (-1663.138) [-1661.903] (-1658.847) (-1658.460) -- 0:00:50 239500 -- (-1660.862) (-1659.229) [-1658.793] (-1658.645) * (-1663.086) [-1659.836] (-1660.339) (-1662.599) -- 0:00:50 240000 -- (-1657.935) [-1659.040] (-1661.340) (-1660.348) * (-1661.091) [-1659.746] (-1659.978) (-1662.580) -- 0:00:50 Average standard deviation of split frequencies: 0.012365 240500 -- (-1658.098) (-1661.150) [-1661.271] (-1658.541) * (-1658.626) (-1660.428) [-1659.686] (-1664.004) -- 0:00:50 241000 -- (-1657.844) [-1659.266] (-1662.779) (-1657.825) * [-1658.391] (-1660.572) (-1659.615) (-1658.635) -- 0:00:50 241500 -- [-1658.735] (-1658.709) (-1660.339) (-1662.261) * (-1658.780) [-1658.496] (-1662.136) (-1658.558) -- 0:00:50 242000 -- (-1660.787) (-1657.915) [-1660.179] (-1661.631) * (-1658.947) (-1659.716) (-1657.955) [-1658.276] -- 0:00:50 242500 -- (-1661.400) (-1657.928) (-1660.470) [-1661.529] * [-1658.444] (-1660.231) (-1657.702) (-1659.832) -- 0:00:49 243000 -- [-1658.408] (-1657.903) (-1660.436) (-1661.612) * (-1661.934) (-1659.287) [-1661.156] (-1659.687) -- 0:00:49 243500 -- (-1658.702) [-1657.692] (-1657.967) (-1661.957) * [-1660.021] (-1660.833) (-1657.887) (-1661.334) -- 0:00:49 244000 -- (-1661.037) (-1659.224) [-1658.536] (-1659.311) * (-1660.510) (-1662.656) (-1657.918) [-1663.670] -- 0:00:49 244500 -- (-1665.649) (-1657.844) (-1659.141) [-1659.564] * (-1659.324) [-1660.214] (-1657.918) (-1667.433) -- 0:00:49 245000 -- (-1667.864) [-1657.821] (-1660.503) (-1659.693) * (-1660.172) (-1658.964) [-1657.918] (-1659.328) -- 0:00:49 Average standard deviation of split frequencies: 0.011498 245500 -- (-1659.391) (-1659.234) (-1660.164) [-1660.278] * [-1662.022] (-1659.964) (-1658.288) (-1660.468) -- 0:00:49 246000 -- (-1660.810) (-1660.026) (-1660.774) [-1660.109] * (-1659.231) (-1660.319) [-1657.551] (-1658.209) -- 0:00:49 246500 -- (-1660.947) [-1658.796] (-1658.617) (-1660.165) * [-1659.052] (-1666.113) (-1658.151) (-1658.367) -- 0:00:48 247000 -- (-1658.645) (-1658.810) (-1658.192) [-1659.685] * [-1658.644] (-1660.719) (-1657.968) (-1658.895) -- 0:00:48 247500 -- [-1659.989] (-1658.796) (-1658.440) (-1659.471) * [-1659.913] (-1658.470) (-1658.700) (-1659.301) -- 0:00:51 248000 -- (-1659.702) (-1658.786) (-1658.440) [-1661.163] * (-1661.361) (-1663.343) [-1659.611] (-1657.972) -- 0:00:51 248500 -- (-1659.339) (-1659.484) [-1658.187] (-1667.414) * (-1660.312) (-1660.286) (-1662.648) [-1658.174] -- 0:00:51 249000 -- (-1659.248) [-1660.056] (-1658.256) (-1658.282) * [-1659.313] (-1660.030) (-1659.138) (-1659.121) -- 0:00:51 249500 -- (-1658.858) (-1662.722) (-1659.005) [-1657.791] * (-1659.479) [-1659.849] (-1659.071) (-1658.451) -- 0:00:51 250000 -- [-1659.916] (-1664.280) (-1658.190) (-1658.379) * [-1661.265] (-1658.517) (-1659.932) (-1658.839) -- 0:00:51 Average standard deviation of split frequencies: 0.011284 250500 -- [-1659.503] (-1661.706) (-1658.569) (-1661.571) * (-1659.436) [-1658.081] (-1658.727) (-1660.734) -- 0:00:50 251000 -- (-1661.861) [-1663.138] (-1660.316) (-1660.560) * (-1658.747) (-1658.711) (-1661.924) [-1658.182] -- 0:00:50 251500 -- (-1659.499) (-1662.989) (-1658.235) [-1658.050] * (-1659.370) (-1663.773) (-1658.264) [-1658.910] -- 0:00:50 252000 -- (-1658.485) (-1660.117) [-1659.105] (-1658.332) * (-1660.710) [-1661.108] (-1658.866) (-1659.413) -- 0:00:50 252500 -- (-1658.936) [-1662.436] (-1661.652) (-1657.653) * (-1662.015) (-1661.361) (-1658.968) [-1661.182] -- 0:00:50 253000 -- (-1661.728) (-1662.177) [-1660.306] (-1660.634) * (-1659.494) (-1661.058) [-1659.811] (-1661.387) -- 0:00:50 253500 -- (-1658.744) (-1663.230) (-1658.363) [-1658.030] * (-1659.345) (-1658.976) [-1660.858] (-1660.084) -- 0:00:50 254000 -- (-1659.740) (-1662.179) (-1658.509) [-1657.893] * (-1661.773) [-1659.644] (-1659.610) (-1661.690) -- 0:00:49 254500 -- (-1659.753) [-1658.149] (-1660.291) (-1659.401) * (-1662.524) (-1661.139) (-1666.555) [-1661.821] -- 0:00:49 255000 -- (-1663.906) (-1657.976) (-1658.334) [-1658.831] * (-1663.286) [-1660.919] (-1660.886) (-1661.481) -- 0:00:49 Average standard deviation of split frequencies: 0.011355 255500 -- (-1665.573) (-1659.515) (-1659.882) [-1659.997] * (-1661.951) [-1659.342] (-1660.755) (-1661.617) -- 0:00:49 256000 -- (-1661.345) (-1661.073) [-1658.682] (-1657.730) * (-1659.890) (-1660.594) [-1660.552] (-1660.113) -- 0:00:49 256500 -- (-1666.554) (-1658.799) (-1660.444) [-1658.110] * (-1663.025) (-1661.937) [-1660.117] (-1658.272) -- 0:00:49 257000 -- (-1659.145) (-1660.627) (-1661.090) [-1662.241] * (-1662.395) [-1659.683] (-1660.523) (-1661.769) -- 0:00:49 257500 -- (-1657.980) (-1657.926) [-1659.907] (-1661.413) * (-1660.272) [-1659.063] (-1660.321) (-1659.416) -- 0:00:49 258000 -- (-1658.340) (-1659.939) (-1663.018) [-1662.449] * (-1659.878) (-1660.456) [-1660.917] (-1661.183) -- 0:00:48 258500 -- [-1659.555] (-1659.333) (-1663.858) (-1658.934) * (-1661.619) (-1659.146) (-1662.097) [-1663.980] -- 0:00:48 259000 -- [-1659.183] (-1658.888) (-1660.081) (-1661.400) * (-1659.071) [-1659.897] (-1662.079) (-1659.950) -- 0:00:48 259500 -- (-1659.151) (-1658.926) (-1661.908) [-1658.662] * (-1658.023) (-1658.647) [-1660.016] (-1660.747) -- 0:00:48 260000 -- (-1658.640) (-1658.413) (-1661.526) [-1658.600] * (-1658.219) (-1659.745) (-1658.604) [-1660.133] -- 0:00:48 Average standard deviation of split frequencies: 0.010248 260500 -- (-1659.382) [-1658.197] (-1660.436) (-1667.903) * (-1658.504) (-1659.417) [-1658.480] (-1658.504) -- 0:00:48 261000 -- (-1658.203) (-1657.688) [-1660.367] (-1662.565) * [-1657.908] (-1660.009) (-1660.718) (-1658.886) -- 0:00:48 261500 -- (-1659.086) (-1658.449) (-1659.508) [-1662.033] * (-1658.251) (-1659.492) [-1662.089] (-1660.454) -- 0:00:48 262000 -- [-1659.350] (-1659.807) (-1658.393) (-1659.018) * (-1658.110) [-1659.298] (-1661.568) (-1659.830) -- 0:00:50 262500 -- (-1663.366) (-1658.306) (-1659.802) [-1659.767] * [-1657.942] (-1659.474) (-1661.090) (-1658.719) -- 0:00:50 263000 -- (-1659.708) (-1661.709) (-1660.397) [-1660.870] * (-1657.942) (-1658.382) [-1660.123] (-1662.545) -- 0:00:50 263500 -- (-1659.952) (-1661.285) (-1659.154) [-1659.640] * (-1658.050) (-1658.239) (-1664.461) [-1660.386] -- 0:00:50 264000 -- [-1658.052] (-1658.138) (-1667.201) (-1658.830) * (-1661.792) (-1660.613) (-1662.461) [-1658.218] -- 0:00:50 264500 -- [-1660.854] (-1661.365) (-1658.539) (-1658.795) * (-1659.403) [-1659.410] (-1662.048) (-1659.644) -- 0:00:50 265000 -- (-1660.101) (-1657.679) (-1667.931) [-1658.793] * (-1666.697) (-1660.308) (-1661.303) [-1657.990] -- 0:00:49 Average standard deviation of split frequencies: 0.009048 265500 -- (-1660.671) (-1658.754) [-1658.887] (-1660.023) * (-1661.568) [-1661.173] (-1660.731) (-1660.110) -- 0:00:49 266000 -- (-1660.559) (-1659.042) (-1660.173) [-1660.781] * (-1662.379) [-1661.546] (-1658.876) (-1662.611) -- 0:00:49 266500 -- (-1660.175) [-1659.257] (-1660.118) (-1660.349) * [-1659.719] (-1660.193) (-1659.318) (-1662.107) -- 0:00:49 267000 -- (-1659.058) (-1659.262) (-1659.257) [-1659.732] * (-1662.166) (-1659.412) [-1659.337] (-1659.066) -- 0:00:49 267500 -- (-1660.894) (-1660.060) [-1658.383] (-1660.564) * (-1669.412) [-1658.974] (-1659.803) (-1659.770) -- 0:00:49 268000 -- (-1658.949) [-1659.999] (-1662.825) (-1658.441) * (-1664.254) [-1658.426] (-1658.712) (-1660.012) -- 0:00:49 268500 -- (-1659.045) [-1658.393] (-1660.496) (-1658.372) * (-1659.472) (-1659.191) [-1661.239] (-1660.728) -- 0:00:49 269000 -- (-1662.371) (-1660.244) [-1662.858] (-1658.341) * (-1660.812) (-1660.361) [-1659.880] (-1658.246) -- 0:00:48 269500 -- (-1658.678) (-1659.093) [-1659.925] (-1662.333) * (-1659.332) [-1659.936] (-1659.831) (-1658.864) -- 0:00:48 270000 -- (-1660.825) (-1660.455) [-1659.596] (-1662.042) * (-1662.188) (-1661.489) (-1663.174) [-1658.225] -- 0:00:48 Average standard deviation of split frequencies: 0.008418 270500 -- [-1659.856] (-1658.560) (-1659.608) (-1660.068) * (-1658.574) (-1660.815) (-1666.760) [-1660.502] -- 0:00:48 271000 -- (-1660.571) [-1658.485] (-1661.709) (-1660.103) * (-1659.017) (-1666.037) (-1661.481) [-1660.359] -- 0:00:48 271500 -- (-1659.585) (-1659.127) [-1660.289] (-1659.185) * (-1662.359) (-1659.551) [-1659.903] (-1661.302) -- 0:00:48 272000 -- (-1661.760) [-1660.050] (-1664.376) (-1660.849) * [-1657.766] (-1662.825) (-1659.665) (-1662.622) -- 0:00:48 272500 -- (-1658.027) (-1660.677) [-1660.045] (-1660.285) * (-1662.008) (-1662.861) [-1661.379] (-1662.628) -- 0:00:48 273000 -- [-1660.336] (-1663.513) (-1663.604) (-1661.629) * (-1661.126) (-1658.835) [-1660.420] (-1661.463) -- 0:00:47 273500 -- (-1659.509) (-1661.807) [-1660.365] (-1659.661) * (-1659.534) (-1659.245) [-1659.525] (-1659.390) -- 0:00:47 274000 -- (-1658.203) (-1662.133) (-1664.816) [-1659.226] * (-1661.096) (-1658.232) (-1659.525) [-1658.671] -- 0:00:47 274500 -- (-1660.939) (-1658.943) (-1661.023) [-1658.728] * [-1662.408] (-1659.262) (-1660.382) (-1658.431) -- 0:00:47 275000 -- [-1660.968] (-1659.880) (-1662.055) (-1659.053) * (-1659.501) (-1659.262) [-1662.976] (-1660.215) -- 0:00:47 Average standard deviation of split frequencies: 0.008540 275500 -- (-1658.489) [-1659.676] (-1662.321) (-1659.977) * (-1659.496) (-1658.830) [-1658.148] (-1661.024) -- 0:00:47 276000 -- (-1658.665) [-1661.856] (-1660.251) (-1660.839) * [-1659.512] (-1659.377) (-1658.311) (-1659.157) -- 0:00:49 276500 -- [-1658.060] (-1661.446) (-1660.544) (-1665.392) * [-1662.455] (-1659.277) (-1659.206) (-1658.713) -- 0:00:49 277000 -- (-1659.238) [-1660.759] (-1661.315) (-1658.921) * (-1660.649) (-1660.544) (-1657.859) [-1658.785] -- 0:00:49 277500 -- [-1659.949] (-1657.625) (-1661.517) (-1659.822) * (-1661.250) (-1659.142) (-1664.614) [-1659.514] -- 0:00:49 278000 -- (-1658.418) (-1659.865) [-1659.151] (-1659.227) * (-1659.789) (-1660.761) [-1658.185] (-1659.701) -- 0:00:49 278500 -- [-1658.623] (-1661.082) (-1661.020) (-1658.157) * [-1660.117] (-1659.931) (-1660.105) (-1659.104) -- 0:00:49 279000 -- (-1660.087) (-1662.573) (-1659.599) [-1658.735] * (-1658.630) [-1658.575] (-1661.430) (-1661.070) -- 0:00:49 279500 -- (-1661.359) (-1662.202) (-1658.726) [-1659.505] * (-1658.690) (-1658.340) [-1661.633] (-1659.423) -- 0:00:48 280000 -- (-1664.337) [-1659.745] (-1659.036) (-1659.035) * (-1657.786) [-1658.124] (-1660.456) (-1657.893) -- 0:00:48 Average standard deviation of split frequencies: 0.009343 280500 -- (-1665.125) [-1659.727] (-1659.750) (-1664.376) * [-1658.876] (-1660.308) (-1661.347) (-1658.958) -- 0:00:48 281000 -- (-1660.029) [-1658.202] (-1661.680) (-1665.448) * (-1666.004) (-1661.786) [-1660.518] (-1659.332) -- 0:00:48 281500 -- [-1658.718] (-1659.466) (-1660.688) (-1659.572) * [-1658.671] (-1658.633) (-1659.272) (-1659.439) -- 0:00:48 282000 -- (-1659.484) (-1658.543) [-1660.563] (-1658.773) * (-1660.036) (-1659.880) (-1659.554) [-1658.686] -- 0:00:48 282500 -- (-1659.352) (-1658.706) (-1658.821) [-1659.452] * (-1659.835) (-1663.116) (-1659.919) [-1659.035] -- 0:00:48 283000 -- (-1658.084) (-1659.129) (-1663.418) [-1660.070] * (-1661.040) [-1664.992] (-1661.205) (-1661.508) -- 0:00:48 283500 -- (-1660.467) (-1659.035) (-1661.986) [-1662.446] * (-1662.114) (-1663.627) (-1661.965) [-1663.036] -- 0:00:48 284000 -- [-1658.946] (-1660.284) (-1661.598) (-1661.524) * (-1662.490) (-1659.702) (-1662.947) [-1663.403] -- 0:00:47 284500 -- (-1659.907) [-1660.091] (-1659.584) (-1661.704) * [-1660.959] (-1657.852) (-1661.824) (-1659.278) -- 0:00:47 285000 -- (-1658.132) (-1660.236) (-1659.330) [-1661.957] * (-1660.328) [-1659.987] (-1660.272) (-1661.523) -- 0:00:47 Average standard deviation of split frequencies: 0.009065 285500 -- [-1658.289] (-1660.606) (-1658.524) (-1661.803) * (-1658.870) [-1657.675] (-1661.710) (-1663.183) -- 0:00:47 286000 -- (-1659.636) (-1659.715) (-1661.050) [-1660.625] * [-1659.311] (-1658.649) (-1662.268) (-1663.513) -- 0:00:47 286500 -- (-1661.648) (-1659.942) [-1663.221] (-1660.642) * [-1658.606] (-1660.115) (-1663.498) (-1659.253) -- 0:00:47 287000 -- (-1660.776) [-1660.385] (-1660.141) (-1664.413) * (-1658.508) [-1660.281] (-1662.204) (-1665.802) -- 0:00:47 287500 -- (-1660.477) [-1661.266] (-1662.921) (-1658.894) * (-1659.898) (-1657.913) [-1660.885] (-1662.560) -- 0:00:47 288000 -- [-1658.997] (-1662.793) (-1659.464) (-1664.766) * [-1661.237] (-1658.311) (-1659.125) (-1659.030) -- 0:00:46 288500 -- (-1658.601) (-1667.032) [-1660.221] (-1660.399) * (-1662.172) (-1658.550) (-1659.035) [-1657.810] -- 0:00:49 289000 -- [-1659.690] (-1659.981) (-1660.517) (-1662.459) * (-1659.760) (-1661.321) [-1662.602] (-1657.984) -- 0:00:49 289500 -- [-1659.573] (-1660.837) (-1660.477) (-1661.337) * (-1659.770) [-1659.150] (-1659.582) (-1661.757) -- 0:00:49 290000 -- [-1660.834] (-1664.462) (-1658.665) (-1659.475) * [-1659.460] (-1659.102) (-1659.649) (-1661.757) -- 0:00:48 Average standard deviation of split frequencies: 0.008312 290500 -- (-1660.820) [-1661.864] (-1657.832) (-1660.018) * (-1662.357) [-1657.499] (-1661.919) (-1663.554) -- 0:00:48 291000 -- [-1660.863] (-1660.524) (-1658.402) (-1665.435) * (-1659.840) [-1658.359] (-1659.070) (-1660.582) -- 0:00:48 291500 -- (-1658.890) (-1659.051) [-1659.341] (-1659.904) * (-1658.806) (-1657.840) (-1659.048) [-1660.009] -- 0:00:48 292000 -- (-1663.476) (-1659.241) (-1659.011) [-1659.669] * (-1662.783) [-1660.521] (-1658.480) (-1658.403) -- 0:00:48 292500 -- (-1667.966) (-1659.989) [-1660.370] (-1660.591) * (-1661.564) [-1662.246] (-1661.429) (-1663.216) -- 0:00:48 293000 -- (-1660.739) [-1661.588] (-1660.349) (-1659.299) * (-1658.735) [-1661.136] (-1663.122) (-1660.087) -- 0:00:48 293500 -- (-1659.649) (-1662.381) [-1659.742] (-1660.146) * [-1661.987] (-1662.052) (-1660.772) (-1660.074) -- 0:00:48 294000 -- (-1659.550) (-1662.353) (-1658.537) [-1661.745] * (-1659.928) (-1659.130) (-1660.093) [-1660.493] -- 0:00:48 294500 -- (-1659.090) [-1661.885] (-1658.485) (-1662.819) * [-1658.917] (-1659.781) (-1660.796) (-1659.525) -- 0:00:47 295000 -- (-1658.773) (-1660.235) [-1660.730] (-1659.096) * (-1659.205) (-1659.085) [-1659.572] (-1661.252) -- 0:00:47 Average standard deviation of split frequencies: 0.008338 295500 -- (-1660.041) (-1661.378) [-1660.019] (-1660.970) * [-1661.477] (-1660.504) (-1659.878) (-1661.399) -- 0:00:47 296000 -- [-1658.291] (-1659.900) (-1658.046) (-1663.372) * (-1661.144) [-1660.061] (-1659.407) (-1659.811) -- 0:00:47 296500 -- [-1658.338] (-1659.998) (-1659.841) (-1660.344) * [-1660.800] (-1659.673) (-1659.882) (-1663.225) -- 0:00:47 297000 -- (-1661.168) (-1659.432) (-1658.155) [-1658.927] * (-1662.328) (-1658.681) [-1658.286] (-1662.990) -- 0:00:47 297500 -- (-1661.536) (-1660.400) (-1658.154) [-1657.859] * (-1661.101) (-1659.245) [-1660.493] (-1660.931) -- 0:00:47 298000 -- (-1659.978) [-1658.728] (-1657.946) (-1660.542) * (-1660.871) (-1662.017) [-1659.347] (-1658.619) -- 0:00:47 298500 -- (-1658.937) (-1658.433) [-1658.555] (-1659.386) * (-1662.741) (-1663.017) [-1659.630] (-1658.940) -- 0:00:47 299000 -- [-1661.897] (-1660.157) (-1658.876) (-1659.362) * [-1663.596] (-1660.686) (-1660.769) (-1659.688) -- 0:00:46 299500 -- [-1659.632] (-1659.049) (-1658.834) (-1661.814) * [-1657.964] (-1659.902) (-1658.502) (-1659.944) -- 0:00:46 300000 -- (-1661.793) (-1660.803) [-1660.376] (-1665.512) * (-1658.830) [-1661.200] (-1657.900) (-1661.191) -- 0:00:46 Average standard deviation of split frequencies: 0.008972 300500 -- [-1659.434] (-1658.565) (-1658.678) (-1662.222) * [-1658.970] (-1659.443) (-1657.900) (-1660.877) -- 0:00:46 301000 -- [-1659.152] (-1660.495) (-1658.692) (-1664.598) * (-1661.104) (-1660.627) (-1658.288) [-1659.886] -- 0:00:46 301500 -- (-1664.793) [-1659.873] (-1659.922) (-1659.759) * (-1661.866) (-1664.507) (-1659.990) [-1659.575] -- 0:00:46 302000 -- (-1660.825) (-1662.870) [-1661.785] (-1661.105) * (-1664.286) (-1660.081) (-1660.972) [-1659.750] -- 0:00:46 302500 -- (-1660.825) (-1660.126) (-1660.662) [-1660.825] * [-1661.162] (-1660.906) (-1660.138) (-1659.519) -- 0:00:46 303000 -- (-1661.073) [-1661.148] (-1658.802) (-1659.761) * [-1661.504] (-1658.123) (-1660.792) (-1661.339) -- 0:00:46 303500 -- [-1662.067] (-1660.510) (-1657.708) (-1660.765) * (-1663.006) [-1658.839] (-1658.704) (-1660.369) -- 0:00:48 304000 -- (-1661.060) [-1659.744] (-1658.156) (-1660.208) * [-1660.070] (-1658.697) (-1658.704) (-1659.668) -- 0:00:48 304500 -- (-1664.156) [-1659.429] (-1659.979) (-1661.243) * [-1662.636] (-1659.507) (-1658.669) (-1660.611) -- 0:00:47 305000 -- (-1663.377) [-1661.399] (-1657.619) (-1664.523) * (-1662.683) [-1660.640] (-1658.517) (-1662.120) -- 0:00:47 Average standard deviation of split frequencies: 0.008815 305500 -- (-1663.994) (-1658.307) [-1659.342] (-1660.927) * (-1662.978) (-1662.974) (-1659.072) [-1661.686] -- 0:00:47 306000 -- [-1660.998] (-1658.863) (-1659.849) (-1659.440) * [-1658.093] (-1660.257) (-1659.655) (-1662.364) -- 0:00:47 306500 -- (-1663.120) (-1659.802) (-1659.445) [-1659.945] * [-1660.280] (-1660.269) (-1660.155) (-1661.479) -- 0:00:47 307000 -- (-1663.149) (-1658.574) [-1658.535] (-1662.696) * (-1666.419) (-1660.874) (-1658.335) [-1662.986] -- 0:00:47 307500 -- (-1659.679) [-1658.569] (-1659.105) (-1658.286) * (-1661.826) (-1659.793) (-1657.641) [-1659.625] -- 0:00:47 308000 -- (-1661.259) (-1658.353) (-1660.776) [-1659.885] * [-1660.643] (-1659.322) (-1658.846) (-1659.740) -- 0:00:47 308500 -- (-1659.361) (-1658.449) (-1659.768) [-1659.649] * (-1660.622) (-1660.103) [-1659.641] (-1660.701) -- 0:00:47 309000 -- (-1659.726) (-1658.264) [-1660.597] (-1658.593) * (-1663.697) (-1659.314) [-1659.889] (-1660.285) -- 0:00:46 309500 -- (-1660.678) [-1658.264] (-1660.435) (-1658.291) * (-1659.177) [-1660.273] (-1662.029) (-1659.198) -- 0:00:46 310000 -- (-1658.763) [-1661.866] (-1659.326) (-1658.306) * (-1659.105) [-1658.933] (-1658.542) (-1658.265) -- 0:00:46 Average standard deviation of split frequencies: 0.009694 310500 -- (-1659.814) [-1662.071] (-1662.398) (-1660.665) * (-1659.822) (-1659.422) [-1659.227] (-1657.537) -- 0:00:46 311000 -- (-1660.032) [-1660.468] (-1663.975) (-1659.068) * (-1660.709) (-1659.244) (-1659.562) [-1658.595] -- 0:00:46 311500 -- (-1665.132) (-1661.423) [-1662.215] (-1659.983) * (-1663.503) (-1660.868) (-1659.090) [-1659.264] -- 0:00:46 312000 -- (-1658.949) (-1658.301) [-1661.976] (-1663.467) * (-1663.839) (-1659.184) (-1660.302) [-1658.096] -- 0:00:46 312500 -- (-1658.987) [-1658.301] (-1660.834) (-1658.827) * [-1662.219] (-1662.668) (-1660.595) (-1657.722) -- 0:00:46 313000 -- (-1660.843) (-1658.087) [-1662.273] (-1659.104) * (-1659.969) (-1661.417) (-1668.077) [-1659.830] -- 0:00:46 313500 -- (-1660.211) [-1657.540] (-1666.702) (-1660.387) * [-1658.774] (-1658.772) (-1659.952) (-1658.034) -- 0:00:45 314000 -- (-1661.084) [-1659.311] (-1661.933) (-1662.596) * (-1658.741) (-1658.331) [-1659.799] (-1658.725) -- 0:00:45 314500 -- (-1658.752) (-1658.570) (-1660.414) [-1660.079] * [-1660.035] (-1660.094) (-1659.091) (-1658.903) -- 0:00:45 315000 -- (-1663.233) (-1660.954) [-1660.350] (-1661.860) * (-1659.526) (-1659.403) (-1658.735) [-1661.674] -- 0:00:45 Average standard deviation of split frequencies: 0.009365 315500 -- (-1659.035) (-1660.178) [-1660.742] (-1658.572) * (-1659.863) [-1658.520] (-1659.026) (-1661.414) -- 0:00:45 316000 -- [-1659.386] (-1659.848) (-1662.159) (-1663.694) * [-1659.171] (-1659.072) (-1658.535) (-1659.979) -- 0:00:45 316500 -- [-1660.932] (-1659.826) (-1663.613) (-1658.646) * (-1664.557) [-1658.964] (-1658.530) (-1658.880) -- 0:00:45 317000 -- (-1659.140) (-1658.903) (-1662.924) [-1659.535] * (-1659.668) (-1658.245) (-1659.996) [-1661.769] -- 0:00:45 317500 -- (-1659.280) [-1660.311] (-1664.562) (-1659.305) * (-1658.518) (-1659.052) [-1659.838] (-1660.657) -- 0:00:45 318000 -- (-1659.398) (-1658.985) (-1665.187) [-1662.392] * [-1659.834] (-1660.982) (-1659.084) (-1659.522) -- 0:00:45 318500 -- (-1659.153) [-1659.711] (-1665.029) (-1659.014) * (-1659.203) (-1661.757) (-1661.330) [-1660.351] -- 0:00:47 319000 -- [-1660.067] (-1659.128) (-1662.171) (-1658.225) * [-1659.012] (-1662.618) (-1659.274) (-1659.045) -- 0:00:46 319500 -- [-1659.324] (-1658.055) (-1659.294) (-1660.946) * (-1662.624) (-1663.761) [-1660.602] (-1657.610) -- 0:00:46 320000 -- (-1659.951) (-1657.789) [-1658.216] (-1658.892) * (-1658.729) (-1661.258) [-1658.341] (-1658.764) -- 0:00:46 Average standard deviation of split frequencies: 0.009310 320500 -- (-1658.600) (-1658.937) [-1658.743] (-1661.005) * (-1663.512) [-1661.262] (-1657.990) (-1660.050) -- 0:00:46 321000 -- [-1658.487] (-1657.910) (-1658.550) (-1661.501) * (-1660.970) (-1659.834) [-1658.844] (-1658.791) -- 0:00:46 321500 -- (-1658.967) (-1661.776) [-1659.471] (-1662.148) * (-1660.515) (-1658.217) (-1658.403) [-1662.269] -- 0:00:46 322000 -- (-1659.963) (-1659.790) [-1658.765] (-1660.774) * [-1660.650] (-1661.575) (-1658.151) (-1660.631) -- 0:00:46 322500 -- (-1660.537) (-1657.997) (-1658.052) [-1658.942] * [-1660.544] (-1665.311) (-1663.105) (-1659.420) -- 0:00:46 323000 -- (-1661.114) (-1659.635) (-1663.224) [-1659.136] * (-1664.104) (-1662.374) (-1660.937) [-1663.171] -- 0:00:46 323500 -- (-1660.323) [-1657.954] (-1659.338) (-1662.855) * (-1665.485) [-1659.203] (-1660.111) (-1661.320) -- 0:00:46 324000 -- (-1660.291) [-1658.311] (-1658.183) (-1659.472) * [-1660.109] (-1658.306) (-1658.850) (-1658.653) -- 0:00:45 324500 -- (-1660.291) [-1658.862] (-1661.010) (-1659.991) * (-1659.003) [-1658.628] (-1663.629) (-1664.945) -- 0:00:45 325000 -- (-1661.510) (-1658.115) (-1658.047) [-1658.296] * [-1658.597] (-1659.614) (-1663.572) (-1664.470) -- 0:00:45 Average standard deviation of split frequencies: 0.008421 325500 -- [-1659.566] (-1659.756) (-1659.871) (-1658.180) * (-1662.437) [-1658.615] (-1662.338) (-1662.532) -- 0:00:45 326000 -- [-1657.620] (-1659.905) (-1660.342) (-1659.116) * (-1662.038) [-1658.590] (-1659.734) (-1658.552) -- 0:00:45 326500 -- (-1658.491) (-1659.418) (-1658.334) [-1659.418] * (-1661.594) [-1658.846] (-1658.961) (-1660.262) -- 0:00:45 327000 -- (-1659.587) (-1663.044) (-1658.990) [-1658.783] * (-1662.849) (-1659.220) (-1660.565) [-1660.434] -- 0:00:45 327500 -- (-1664.768) (-1660.190) (-1658.794) [-1665.609] * (-1666.544) (-1659.407) [-1660.637] (-1660.423) -- 0:00:45 328000 -- (-1666.505) [-1659.150] (-1659.161) (-1661.832) * (-1658.655) (-1659.408) (-1661.653) [-1658.709] -- 0:00:45 328500 -- [-1658.505] (-1659.346) (-1658.945) (-1660.092) * (-1658.357) (-1663.403) [-1659.843] (-1658.023) -- 0:00:44 329000 -- (-1659.246) (-1660.356) [-1659.520] (-1661.453) * (-1658.433) (-1661.923) (-1658.282) [-1659.879] -- 0:00:44 329500 -- (-1660.586) (-1660.428) [-1659.568] (-1661.150) * (-1663.255) (-1660.679) (-1662.653) [-1659.931] -- 0:00:44 330000 -- (-1658.426) (-1664.584) (-1658.943) [-1660.438] * (-1661.050) (-1661.973) (-1661.214) [-1658.857] -- 0:00:44 Average standard deviation of split frequencies: 0.008302 330500 -- (-1660.573) (-1658.955) (-1658.363) [-1662.090] * (-1657.903) (-1659.518) (-1662.096) [-1659.309] -- 0:00:44 331000 -- (-1659.160) [-1659.352] (-1659.870) (-1660.092) * (-1658.159) (-1661.832) [-1658.166] (-1660.375) -- 0:00:44 331500 -- (-1662.963) (-1659.106) (-1669.311) [-1659.263] * (-1658.335) (-1659.321) [-1659.510] (-1658.441) -- 0:00:44 332000 -- [-1662.368] (-1660.599) (-1659.597) (-1658.533) * (-1659.561) (-1659.745) [-1659.397] (-1661.654) -- 0:00:44 332500 -- [-1658.540] (-1657.692) (-1661.311) (-1659.225) * (-1659.759) (-1657.834) (-1663.788) [-1659.215] -- 0:00:44 333000 -- (-1661.108) (-1657.890) (-1662.805) [-1660.262] * [-1658.876] (-1661.426) (-1660.938) (-1667.236) -- 0:00:44 333500 -- (-1658.061) [-1658.514] (-1658.200) (-1660.269) * (-1659.534) [-1665.669] (-1657.672) (-1664.825) -- 0:00:45 334000 -- (-1659.980) [-1659.661] (-1658.375) (-1663.200) * (-1658.291) [-1660.261] (-1661.075) (-1660.932) -- 0:00:45 334500 -- (-1659.295) (-1659.214) (-1660.458) [-1659.049] * (-1659.250) (-1659.712) [-1658.847] (-1660.791) -- 0:00:45 335000 -- [-1660.493] (-1659.911) (-1662.011) (-1659.718) * [-1659.337] (-1657.871) (-1658.695) (-1664.899) -- 0:00:45 Average standard deviation of split frequencies: 0.008996 335500 -- [-1658.100] (-1659.727) (-1662.503) (-1660.502) * (-1659.004) (-1660.285) [-1659.355] (-1658.616) -- 0:00:45 336000 -- (-1657.789) (-1659.423) [-1662.809] (-1659.298) * (-1658.287) [-1659.775] (-1658.448) (-1666.135) -- 0:00:45 336500 -- (-1660.218) (-1658.952) (-1660.416) [-1660.610] * (-1658.526) (-1659.653) (-1658.665) [-1658.892] -- 0:00:45 337000 -- (-1660.098) [-1660.387] (-1662.161) (-1659.492) * [-1658.493] (-1658.495) (-1659.041) (-1660.997) -- 0:00:45 337500 -- [-1658.786] (-1660.837) (-1661.062) (-1661.486) * (-1661.925) (-1658.495) [-1660.535] (-1659.292) -- 0:00:45 338000 -- (-1658.736) [-1659.609] (-1658.962) (-1658.458) * [-1658.343] (-1657.800) (-1658.928) (-1658.254) -- 0:00:45 338500 -- (-1660.010) (-1659.693) (-1659.944) [-1658.682] * [-1658.280] (-1658.328) (-1659.688) (-1659.081) -- 0:00:44 339000 -- (-1662.490) [-1660.446] (-1661.847) (-1658.973) * (-1659.718) (-1659.827) [-1662.107] (-1661.791) -- 0:00:44 339500 -- [-1661.302] (-1660.759) (-1663.884) (-1659.374) * (-1664.327) (-1661.959) (-1662.692) [-1660.385] -- 0:00:44 340000 -- (-1661.689) [-1659.104] (-1661.873) (-1658.804) * (-1665.830) (-1660.333) [-1659.955] (-1659.154) -- 0:00:44 Average standard deviation of split frequencies: 0.009340 340500 -- (-1662.958) [-1658.040] (-1659.458) (-1660.423) * (-1663.333) (-1658.989) (-1660.738) [-1660.732] -- 0:00:44 341000 -- [-1659.157] (-1658.674) (-1661.816) (-1663.843) * (-1662.699) (-1659.204) (-1660.900) [-1659.966] -- 0:00:44 341500 -- (-1660.299) (-1658.979) [-1659.286] (-1660.944) * (-1662.387) [-1658.704] (-1663.318) (-1659.371) -- 0:00:44 342000 -- [-1659.460] (-1660.718) (-1659.853) (-1662.844) * (-1662.366) (-1662.994) [-1659.471] (-1659.737) -- 0:00:44 342500 -- (-1659.146) (-1660.365) [-1659.993] (-1662.957) * [-1660.536] (-1659.517) (-1659.210) (-1661.569) -- 0:00:44 343000 -- (-1658.611) (-1660.912) [-1659.092] (-1662.956) * [-1659.820] (-1658.536) (-1658.698) (-1661.552) -- 0:00:44 343500 -- (-1659.271) (-1665.902) [-1659.157] (-1660.898) * (-1659.759) (-1658.596) (-1660.129) [-1659.335] -- 0:00:43 344000 -- (-1659.622) (-1661.778) [-1659.711] (-1658.247) * [-1661.851] (-1657.999) (-1658.892) (-1662.277) -- 0:00:43 344500 -- [-1663.513] (-1663.944) (-1665.580) (-1662.389) * (-1660.956) [-1658.342] (-1662.395) (-1658.382) -- 0:00:43 345000 -- (-1663.900) (-1666.767) [-1660.970] (-1663.670) * [-1659.375] (-1663.635) (-1660.567) (-1658.272) -- 0:00:43 Average standard deviation of split frequencies: 0.009111 345500 -- (-1658.543) (-1665.729) [-1659.273] (-1662.836) * (-1658.740) (-1658.604) (-1659.956) [-1658.185] -- 0:00:43 346000 -- [-1661.088] (-1661.123) (-1657.707) (-1659.695) * (-1659.910) [-1663.020] (-1660.268) (-1657.695) -- 0:00:43 346500 -- (-1660.497) (-1661.624) (-1657.995) [-1659.159] * (-1661.069) (-1664.606) (-1658.893) [-1658.703] -- 0:00:43 347000 -- (-1661.627) (-1660.141) [-1661.902] (-1659.387) * (-1661.085) [-1660.845] (-1659.058) (-1658.613) -- 0:00:43 347500 -- [-1661.599] (-1662.460) (-1658.929) (-1659.472) * (-1658.356) (-1661.885) [-1659.608] (-1658.749) -- 0:00:43 348000 -- (-1664.264) (-1659.292) [-1658.391] (-1657.970) * (-1659.882) (-1658.061) (-1660.213) [-1659.181] -- 0:00:43 348500 -- (-1664.140) [-1659.531] (-1657.947) (-1660.194) * (-1664.985) (-1660.913) (-1660.124) [-1658.583] -- 0:00:42 349000 -- (-1664.897) (-1659.436) [-1658.327] (-1661.915) * (-1664.503) (-1661.860) [-1660.533] (-1659.160) -- 0:00:44 349500 -- [-1660.184] (-1660.394) (-1661.350) (-1657.682) * (-1661.401) (-1661.668) (-1662.610) [-1661.774] -- 0:00:44 350000 -- (-1658.907) (-1661.735) (-1659.350) [-1657.546] * [-1660.099] (-1661.112) (-1660.314) (-1663.508) -- 0:00:44 Average standard deviation of split frequencies: 0.007814 350500 -- (-1659.841) [-1661.404] (-1660.076) (-1657.680) * [-1658.550] (-1660.839) (-1660.747) (-1662.597) -- 0:00:44 351000 -- (-1660.751) (-1662.504) [-1659.793] (-1657.959) * (-1660.019) [-1662.087] (-1660.912) (-1662.697) -- 0:00:44 351500 -- (-1662.758) (-1660.155) [-1658.879] (-1657.973) * [-1659.389] (-1661.352) (-1662.724) (-1660.364) -- 0:00:44 352000 -- (-1660.709) (-1660.159) [-1659.088] (-1660.097) * (-1659.943) (-1659.731) (-1659.089) [-1659.867] -- 0:00:44 352500 -- (-1660.346) (-1662.800) (-1659.972) [-1658.938] * (-1662.336) [-1659.626] (-1658.682) (-1663.228) -- 0:00:44 353000 -- (-1658.794) (-1660.282) [-1660.514] (-1658.907) * [-1660.498] (-1659.153) (-1657.646) (-1663.073) -- 0:00:43 353500 -- [-1659.392] (-1659.250) (-1659.661) (-1661.626) * (-1660.639) [-1659.393] (-1661.211) (-1660.646) -- 0:00:43 354000 -- [-1658.028] (-1658.386) (-1661.330) (-1662.561) * (-1659.535) (-1662.518) (-1661.830) [-1660.627] -- 0:00:43 354500 -- (-1660.817) (-1660.754) (-1661.719) [-1661.470] * (-1659.701) (-1660.373) (-1659.875) [-1661.439] -- 0:00:43 355000 -- [-1660.040] (-1662.034) (-1661.315) (-1661.844) * (-1659.976) (-1662.989) [-1661.763] (-1658.878) -- 0:00:43 Average standard deviation of split frequencies: 0.008855 355500 -- (-1659.114) (-1662.188) (-1659.997) [-1660.696] * (-1661.198) (-1658.189) [-1662.561] (-1663.721) -- 0:00:43 356000 -- (-1658.957) [-1664.238] (-1658.074) (-1658.715) * (-1659.006) (-1658.246) (-1663.520) [-1662.319] -- 0:00:43 356500 -- (-1664.490) (-1661.245) (-1662.263) [-1658.715] * [-1659.020] (-1658.246) (-1659.537) (-1661.671) -- 0:00:43 357000 -- (-1660.230) (-1658.658) (-1663.791) [-1660.500] * (-1659.960) (-1659.767) (-1661.745) [-1660.309] -- 0:00:43 357500 -- (-1660.146) (-1660.686) (-1658.148) [-1660.401] * (-1658.630) (-1660.332) [-1658.250] (-1660.855) -- 0:00:43 358000 -- [-1659.812] (-1661.617) (-1659.831) (-1660.336) * [-1658.646] (-1660.333) (-1658.708) (-1662.195) -- 0:00:43 358500 -- (-1658.689) [-1659.530] (-1659.794) (-1659.672) * (-1663.889) [-1659.091] (-1658.885) (-1660.999) -- 0:00:42 359000 -- (-1659.113) (-1659.605) (-1660.356) [-1658.686] * (-1659.299) (-1658.225) (-1659.053) [-1659.744] -- 0:00:42 359500 -- [-1658.703] (-1661.881) (-1659.647) (-1658.479) * (-1660.230) (-1663.362) [-1659.796] (-1659.940) -- 0:00:42 360000 -- (-1657.815) (-1662.405) (-1659.839) [-1658.126] * [-1660.480] (-1659.892) (-1667.169) (-1661.487) -- 0:00:42 Average standard deviation of split frequencies: 0.008577 360500 -- [-1658.968] (-1659.682) (-1657.713) (-1658.812) * [-1657.637] (-1659.329) (-1661.701) (-1658.939) -- 0:00:42 361000 -- [-1660.441] (-1658.639) (-1660.735) (-1658.785) * (-1659.492) [-1659.644] (-1658.783) (-1659.027) -- 0:00:42 361500 -- (-1662.957) (-1658.531) [-1661.594] (-1658.359) * (-1658.327) (-1661.905) [-1659.303] (-1661.486) -- 0:00:42 362000 -- (-1658.316) [-1659.353] (-1659.042) (-1657.991) * [-1659.307] (-1658.994) (-1659.756) (-1658.756) -- 0:00:42 362500 -- [-1661.285] (-1659.706) (-1661.625) (-1658.265) * [-1659.194] (-1658.509) (-1660.057) (-1660.173) -- 0:00:42 363000 -- (-1661.349) (-1659.707) (-1662.270) [-1657.954] * (-1658.677) (-1659.677) [-1658.476] (-1663.698) -- 0:00:42 363500 -- (-1659.654) [-1659.042] (-1659.683) (-1660.318) * (-1658.347) (-1659.216) [-1659.694] (-1664.740) -- 0:00:42 364000 -- (-1660.392) (-1663.069) [-1659.912] (-1660.812) * (-1658.757) (-1659.219) (-1658.530) [-1662.367] -- 0:00:41 364500 -- (-1661.520) [-1661.190] (-1658.513) (-1660.474) * [-1658.556] (-1667.540) (-1660.972) (-1658.982) -- 0:00:43 365000 -- (-1658.114) (-1658.549) (-1665.860) [-1662.307] * [-1659.912] (-1663.739) (-1659.843) (-1659.277) -- 0:00:43 Average standard deviation of split frequencies: 0.008372 365500 -- (-1659.823) (-1658.193) (-1660.049) [-1658.600] * (-1658.606) (-1662.274) (-1661.236) [-1659.853] -- 0:00:43 366000 -- [-1659.664] (-1657.795) (-1657.973) (-1657.990) * (-1658.501) [-1659.104] (-1659.803) (-1662.866) -- 0:00:43 366500 -- (-1659.664) [-1659.973] (-1658.215) (-1657.960) * (-1659.729) [-1659.819] (-1660.678) (-1661.480) -- 0:00:43 367000 -- [-1658.331] (-1659.062) (-1658.586) (-1658.302) * (-1661.180) (-1659.255) (-1661.461) [-1661.678] -- 0:00:43 367500 -- [-1658.221] (-1660.613) (-1660.541) (-1658.823) * (-1664.388) (-1658.997) [-1658.795] (-1660.502) -- 0:00:43 368000 -- (-1659.324) (-1659.047) (-1658.194) [-1658.353] * (-1659.418) (-1661.280) (-1659.528) [-1660.630] -- 0:00:42 368500 -- (-1659.367) (-1660.263) [-1657.910] (-1658.933) * (-1660.172) [-1659.424] (-1660.268) (-1660.036) -- 0:00:42 369000 -- [-1658.555] (-1661.306) (-1658.749) (-1661.407) * (-1657.816) (-1659.808) [-1661.190] (-1660.101) -- 0:00:42 369500 -- (-1660.596) (-1667.498) (-1658.427) [-1659.378] * (-1660.494) (-1661.138) (-1662.800) [-1660.027] -- 0:00:42 370000 -- (-1660.089) [-1659.840] (-1659.835) (-1660.571) * (-1660.336) (-1660.349) (-1659.216) [-1659.813] -- 0:00:42 Average standard deviation of split frequencies: 0.009300 370500 -- (-1659.100) (-1659.153) (-1659.261) [-1660.330] * (-1659.469) (-1661.422) (-1658.990) [-1659.446] -- 0:00:42 371000 -- [-1658.947] (-1658.749) (-1659.937) (-1659.081) * (-1660.046) (-1659.176) [-1659.637] (-1660.623) -- 0:00:42 371500 -- (-1658.725) (-1657.983) (-1661.347) [-1658.515] * (-1659.648) (-1663.935) (-1660.857) [-1661.604] -- 0:00:42 372000 -- [-1659.440] (-1657.905) (-1662.447) (-1660.484) * (-1658.658) (-1661.369) [-1659.248] (-1658.158) -- 0:00:42 372500 -- [-1658.473] (-1662.344) (-1660.294) (-1660.481) * (-1658.498) (-1659.340) [-1659.352] (-1658.863) -- 0:00:42 373000 -- (-1659.098) (-1659.306) (-1659.132) [-1663.175] * (-1660.043) (-1659.380) [-1660.694] (-1660.640) -- 0:00:42 373500 -- (-1659.083) (-1660.484) [-1662.928] (-1658.510) * [-1662.000] (-1662.368) (-1661.248) (-1662.930) -- 0:00:41 374000 -- (-1658.983) (-1659.652) (-1658.671) [-1665.658] * (-1659.068) (-1658.398) [-1660.541] (-1658.481) -- 0:00:41 374500 -- [-1663.377] (-1659.094) (-1662.309) (-1658.037) * (-1660.174) (-1659.781) (-1658.518) [-1663.739] -- 0:00:41 375000 -- (-1660.028) (-1658.178) (-1660.652) [-1657.724] * (-1661.693) (-1658.380) [-1660.071] (-1660.900) -- 0:00:41 Average standard deviation of split frequencies: 0.009168 375500 -- [-1659.048] (-1659.168) (-1661.683) (-1659.643) * (-1658.748) (-1659.866) [-1659.791] (-1660.955) -- 0:00:41 376000 -- (-1661.356) (-1660.858) (-1661.767) [-1662.073] * (-1658.354) [-1660.698] (-1662.542) (-1658.474) -- 0:00:41 376500 -- (-1658.043) (-1660.709) [-1663.610] (-1659.640) * (-1659.498) [-1662.791] (-1659.410) (-1659.529) -- 0:00:41 377000 -- [-1657.618] (-1659.052) (-1665.198) (-1659.750) * (-1659.467) (-1659.411) [-1659.836] (-1664.190) -- 0:00:41 377500 -- (-1657.654) (-1659.138) [-1658.491] (-1660.508) * (-1659.344) (-1659.562) [-1659.772] (-1664.190) -- 0:00:41 378000 -- (-1658.056) (-1659.082) [-1658.945] (-1658.700) * [-1659.786] (-1662.987) (-1663.142) (-1660.407) -- 0:00:41 378500 -- (-1658.754) (-1659.471) [-1659.714] (-1661.138) * [-1658.662] (-1660.590) (-1659.845) (-1658.868) -- 0:00:41 379000 -- [-1658.471] (-1662.001) (-1661.247) (-1661.873) * (-1659.119) (-1658.555) [-1658.867] (-1661.081) -- 0:00:40 379500 -- (-1658.117) (-1659.456) [-1661.797] (-1660.899) * (-1660.417) (-1660.839) [-1658.773] (-1659.366) -- 0:00:42 380000 -- [-1657.785] (-1660.500) (-1663.982) (-1659.705) * (-1658.891) (-1659.847) (-1659.530) [-1660.619] -- 0:00:42 Average standard deviation of split frequencies: 0.008960 380500 -- (-1657.807) [-1658.137] (-1669.483) (-1664.187) * (-1658.876) (-1662.447) (-1661.205) [-1658.842] -- 0:00:42 381000 -- (-1657.806) (-1657.798) (-1665.124) [-1661.979] * [-1658.154] (-1660.571) (-1661.672) (-1658.066) -- 0:00:42 381500 -- (-1657.801) [-1661.249] (-1658.215) (-1662.662) * (-1659.155) (-1660.788) (-1660.947) [-1658.567] -- 0:00:42 382000 -- (-1658.286) (-1661.182) (-1659.682) [-1660.791] * (-1660.891) (-1661.246) (-1661.746) [-1659.961] -- 0:00:42 382500 -- (-1659.482) [-1660.647] (-1657.934) (-1658.385) * (-1662.087) (-1659.055) (-1658.743) [-1660.761] -- 0:00:41 383000 -- (-1660.060) (-1660.863) (-1662.163) [-1659.670] * (-1659.573) (-1659.501) (-1658.743) [-1660.763] -- 0:00:41 383500 -- (-1659.090) [-1659.516] (-1661.443) (-1658.368) * (-1661.836) (-1660.132) [-1659.939] (-1660.761) -- 0:00:41 384000 -- (-1658.693) [-1659.452] (-1664.358) (-1658.233) * (-1664.256) [-1659.341] (-1658.497) (-1664.225) -- 0:00:41 384500 -- [-1658.293] (-1661.536) (-1661.547) (-1658.350) * (-1667.198) [-1659.675] (-1658.693) (-1660.189) -- 0:00:41 385000 -- [-1658.780] (-1660.706) (-1665.402) (-1658.734) * [-1658.924] (-1661.205) (-1658.603) (-1659.302) -- 0:00:41 Average standard deviation of split frequencies: 0.009914 385500 -- (-1660.475) (-1659.822) (-1664.215) [-1658.433] * [-1657.811] (-1663.869) (-1661.276) (-1661.127) -- 0:00:41 386000 -- (-1662.761) (-1659.572) (-1662.956) [-1659.624] * (-1658.417) [-1658.497] (-1663.777) (-1663.876) -- 0:00:41 386500 -- (-1661.350) [-1659.746] (-1661.907) (-1660.875) * (-1659.206) (-1662.175) [-1662.338] (-1663.325) -- 0:00:41 387000 -- (-1661.525) [-1660.287] (-1663.661) (-1660.048) * (-1660.655) (-1658.991) (-1665.087) [-1659.422] -- 0:00:41 387500 -- (-1661.506) [-1659.066] (-1660.338) (-1661.289) * (-1662.954) (-1658.208) (-1657.447) [-1659.835] -- 0:00:41 388000 -- (-1662.334) (-1661.461) (-1658.298) [-1660.816] * (-1665.093) (-1659.602) (-1660.050) [-1659.630] -- 0:00:41 388500 -- (-1661.510) (-1663.099) [-1658.123] (-1659.029) * (-1661.395) (-1659.708) [-1658.701] (-1658.960) -- 0:00:40 389000 -- (-1662.396) (-1662.229) (-1657.665) [-1658.039] * (-1660.750) [-1661.352] (-1658.975) (-1661.001) -- 0:00:40 389500 -- (-1669.236) [-1659.092] (-1660.638) (-1663.278) * (-1661.991) (-1660.018) (-1659.906) [-1659.785] -- 0:00:40 390000 -- [-1660.981] (-1659.126) (-1660.086) (-1659.614) * (-1663.739) (-1658.208) (-1657.917) [-1664.926] -- 0:00:40 Average standard deviation of split frequencies: 0.010221 390500 -- (-1661.748) (-1659.077) [-1662.387] (-1661.213) * (-1660.265) (-1658.211) [-1659.091] (-1661.107) -- 0:00:40 391000 -- (-1661.181) (-1658.283) (-1660.857) [-1661.272] * (-1661.199) [-1659.111] (-1659.245) (-1660.865) -- 0:00:40 391500 -- (-1659.358) [-1658.647] (-1660.418) (-1659.892) * (-1658.321) (-1661.201) (-1659.462) [-1661.740] -- 0:00:40 392000 -- [-1659.178] (-1661.296) (-1661.651) (-1658.737) * (-1659.541) (-1660.982) (-1661.462) [-1660.979] -- 0:00:40 392500 -- [-1660.270] (-1661.041) (-1664.484) (-1659.001) * (-1667.057) (-1660.958) [-1661.764] (-1658.243) -- 0:00:40 393000 -- [-1659.862] (-1662.088) (-1659.411) (-1661.674) * (-1660.991) [-1663.548] (-1660.527) (-1660.485) -- 0:00:40 393500 -- (-1658.290) [-1661.346] (-1659.224) (-1659.289) * [-1659.987] (-1664.342) (-1659.309) (-1660.047) -- 0:00:40 394000 -- (-1660.496) [-1661.906] (-1663.149) (-1660.087) * [-1662.145] (-1659.877) (-1662.490) (-1662.805) -- 0:00:39 394500 -- [-1660.972] (-1661.549) (-1658.743) (-1659.682) * (-1660.868) (-1659.980) [-1658.587] (-1658.782) -- 0:00:39 395000 -- [-1658.855] (-1662.952) (-1658.726) (-1658.301) * [-1660.223] (-1660.292) (-1659.372) (-1658.196) -- 0:00:41 Average standard deviation of split frequencies: 0.009873 395500 -- (-1659.727) (-1664.246) [-1659.783] (-1658.842) * [-1658.733] (-1661.951) (-1663.257) (-1658.449) -- 0:00:41 396000 -- (-1659.617) [-1659.698] (-1658.987) (-1658.333) * (-1662.486) [-1660.125] (-1660.988) (-1665.471) -- 0:00:41 396500 -- [-1658.579] (-1660.363) (-1662.737) (-1658.478) * (-1660.162) (-1661.456) (-1659.501) [-1659.866] -- 0:00:41 397000 -- (-1658.842) [-1658.540] (-1658.790) (-1659.666) * (-1658.489) (-1661.284) (-1660.333) [-1662.479] -- 0:00:41 397500 -- [-1661.467] (-1666.400) (-1660.429) (-1658.520) * (-1658.306) (-1660.166) [-1658.999] (-1657.966) -- 0:00:40 398000 -- (-1660.814) (-1663.294) [-1659.068] (-1657.992) * (-1657.618) (-1659.189) (-1658.945) [-1657.462] -- 0:00:40 398500 -- [-1660.610] (-1664.605) (-1659.027) (-1658.307) * (-1658.438) (-1658.312) (-1658.309) [-1657.606] -- 0:00:40 399000 -- (-1662.937) (-1661.072) [-1661.825] (-1659.153) * (-1659.309) [-1657.967] (-1660.076) (-1661.081) -- 0:00:40 399500 -- (-1661.924) (-1663.293) (-1660.193) [-1658.481] * (-1658.667) (-1658.498) (-1659.515) [-1658.497] -- 0:00:40 400000 -- (-1662.543) [-1659.396] (-1658.178) (-1659.954) * (-1658.302) (-1664.541) [-1659.713] (-1659.468) -- 0:00:40 Average standard deviation of split frequencies: 0.010312 400500 -- (-1666.789) [-1658.144] (-1658.266) (-1662.275) * (-1658.014) (-1661.570) (-1658.848) [-1658.368] -- 0:00:40 401000 -- (-1661.760) (-1661.353) [-1659.098] (-1658.995) * (-1661.985) (-1661.285) (-1663.774) [-1661.417] -- 0:00:40 401500 -- (-1660.795) (-1661.568) (-1659.116) [-1660.414] * (-1665.727) (-1661.770) (-1661.204) [-1661.932] -- 0:00:40 402000 -- (-1662.926) [-1659.513] (-1659.515) (-1659.878) * (-1660.294) [-1658.500] (-1658.697) (-1661.811) -- 0:00:40 402500 -- (-1662.324) (-1661.189) [-1658.443] (-1657.840) * (-1661.408) (-1659.629) (-1659.328) [-1658.737] -- 0:00:40 403000 -- (-1665.209) (-1661.366) [-1659.460] (-1661.103) * (-1660.718) [-1662.815] (-1657.733) (-1659.412) -- 0:00:39 403500 -- (-1661.616) (-1660.937) (-1658.509) [-1660.536] * (-1661.127) (-1659.337) [-1658.029] (-1658.781) -- 0:00:39 404000 -- [-1662.535] (-1660.848) (-1658.276) (-1658.795) * (-1660.669) [-1658.346] (-1660.014) (-1662.100) -- 0:00:39 404500 -- (-1663.732) (-1660.348) (-1659.039) [-1660.246] * [-1658.996] (-1658.229) (-1660.461) (-1662.033) -- 0:00:39 405000 -- [-1659.434] (-1660.843) (-1662.517) (-1660.950) * [-1660.012] (-1662.882) (-1661.920) (-1663.512) -- 0:00:39 Average standard deviation of split frequencies: 0.009767 405500 -- (-1659.844) (-1657.986) (-1663.153) [-1660.904] * (-1661.107) (-1662.036) [-1658.515] (-1662.014) -- 0:00:39 406000 -- (-1658.218) [-1659.001] (-1660.340) (-1661.279) * (-1660.031) [-1657.835] (-1658.919) (-1662.396) -- 0:00:39 406500 -- (-1658.278) (-1662.022) [-1658.238] (-1660.605) * [-1661.108] (-1661.750) (-1659.505) (-1661.326) -- 0:00:39 407000 -- (-1659.256) (-1664.746) [-1658.376] (-1664.764) * [-1662.119] (-1659.886) (-1665.166) (-1659.991) -- 0:00:39 407500 -- (-1660.667) (-1659.695) [-1658.679] (-1663.427) * (-1663.378) (-1658.433) [-1658.458] (-1658.179) -- 0:00:39 408000 -- (-1660.254) (-1658.952) (-1659.891) [-1658.072] * (-1661.479) [-1660.024] (-1658.001) (-1658.363) -- 0:00:39 408500 -- (-1661.847) (-1661.241) (-1661.461) [-1658.192] * [-1662.028] (-1664.155) (-1660.193) (-1658.708) -- 0:00:39 409000 -- (-1658.622) [-1658.597] (-1660.256) (-1658.967) * [-1659.745] (-1660.760) (-1660.155) (-1662.617) -- 0:00:39 409500 -- [-1659.267] (-1658.514) (-1660.204) (-1659.491) * (-1663.969) [-1660.136] (-1659.455) (-1661.781) -- 0:00:38 410000 -- (-1658.061) [-1658.585] (-1660.093) (-1658.490) * (-1662.548) (-1660.766) [-1663.027] (-1660.505) -- 0:00:40 Average standard deviation of split frequencies: 0.010534 410500 -- (-1657.933) (-1659.507) [-1657.886] (-1666.132) * (-1660.875) (-1663.275) (-1659.354) [-1659.063] -- 0:00:40 411000 -- [-1658.060] (-1660.343) (-1663.015) (-1662.727) * (-1659.298) (-1659.236) (-1662.122) [-1659.063] -- 0:00:40 411500 -- (-1661.328) (-1658.895) (-1660.551) [-1663.655] * (-1659.001) [-1658.076] (-1658.892) (-1659.127) -- 0:00:40 412000 -- [-1660.634] (-1661.169) (-1660.855) (-1660.186) * (-1664.770) [-1658.037] (-1658.573) (-1663.103) -- 0:00:39 412500 -- (-1663.235) [-1659.120] (-1659.388) (-1661.123) * [-1662.607] (-1662.794) (-1658.385) (-1661.343) -- 0:00:39 413000 -- (-1661.200) (-1663.773) [-1659.858] (-1659.662) * (-1659.895) (-1664.581) (-1659.053) [-1659.761] -- 0:00:39 413500 -- [-1660.924] (-1660.621) (-1661.710) (-1662.322) * (-1660.259) (-1659.615) (-1662.634) [-1659.531] -- 0:00:39 414000 -- (-1658.752) (-1661.872) [-1659.569] (-1660.083) * (-1661.569) [-1659.393] (-1661.291) (-1660.577) -- 0:00:39 414500 -- (-1659.555) [-1659.385] (-1659.998) (-1661.944) * (-1659.325) [-1658.427] (-1660.302) (-1664.327) -- 0:00:39 415000 -- (-1659.326) [-1660.063] (-1661.237) (-1668.086) * (-1660.829) (-1658.097) [-1660.198] (-1663.528) -- 0:00:39 Average standard deviation of split frequencies: 0.010065 415500 -- (-1659.907) (-1660.559) [-1662.123] (-1664.587) * [-1663.454] (-1660.191) (-1661.399) (-1660.275) -- 0:00:39 416000 -- [-1658.932] (-1660.369) (-1657.864) (-1660.195) * (-1661.884) (-1658.468) [-1658.339] (-1658.799) -- 0:00:39 416500 -- [-1664.085] (-1663.406) (-1659.662) (-1659.435) * (-1666.618) (-1659.480) [-1658.116] (-1658.960) -- 0:00:39 417000 -- [-1661.689] (-1661.483) (-1660.265) (-1658.322) * (-1660.398) (-1659.749) [-1660.698] (-1658.764) -- 0:00:39 417500 -- (-1658.959) (-1661.265) (-1661.088) [-1659.049] * [-1660.878] (-1660.785) (-1662.378) (-1659.450) -- 0:00:39 418000 -- [-1658.807] (-1658.290) (-1665.952) (-1659.739) * (-1658.857) (-1661.034) (-1659.886) [-1659.692] -- 0:00:38 418500 -- [-1658.801] (-1658.275) (-1665.080) (-1659.794) * (-1658.858) (-1660.530) [-1661.801] (-1659.727) -- 0:00:38 419000 -- (-1658.753) [-1658.362] (-1658.813) (-1659.333) * (-1658.946) (-1663.225) (-1658.589) [-1658.459] -- 0:00:38 419500 -- (-1659.422) [-1659.132] (-1658.615) (-1660.043) * (-1660.640) (-1663.606) (-1663.446) [-1660.808] -- 0:00:38 420000 -- (-1660.448) (-1662.997) [-1658.804] (-1659.925) * (-1660.640) (-1658.623) [-1658.964] (-1660.770) -- 0:00:38 Average standard deviation of split frequencies: 0.009954 420500 -- (-1659.771) (-1664.894) [-1659.293] (-1663.237) * (-1658.500) [-1659.437] (-1658.093) (-1659.798) -- 0:00:38 421000 -- (-1658.663) (-1660.574) [-1659.626] (-1661.197) * (-1657.628) (-1659.447) [-1658.744] (-1663.514) -- 0:00:38 421500 -- (-1660.415) (-1659.299) (-1659.626) [-1662.696] * (-1658.147) (-1658.293) [-1658.738] (-1659.301) -- 0:00:38 422000 -- [-1661.451] (-1659.519) (-1659.952) (-1660.276) * [-1658.454] (-1659.090) (-1660.908) (-1660.402) -- 0:00:38 422500 -- (-1658.705) (-1658.192) (-1661.042) [-1661.352] * (-1661.018) (-1659.378) [-1659.625] (-1662.986) -- 0:00:38 423000 -- [-1658.419] (-1658.522) (-1658.522) (-1660.764) * (-1658.544) [-1660.250] (-1658.330) (-1659.715) -- 0:00:38 423500 -- [-1658.736] (-1658.525) (-1660.714) (-1659.909) * (-1659.740) (-1660.247) [-1658.771] (-1660.119) -- 0:00:38 424000 -- [-1659.747] (-1663.577) (-1658.635) (-1657.615) * [-1660.930] (-1658.528) (-1660.186) (-1660.270) -- 0:00:38 424500 -- (-1659.251) [-1660.075] (-1661.565) (-1660.245) * (-1661.339) (-1658.350) (-1662.619) [-1664.640] -- 0:00:37 425000 -- (-1660.616) (-1660.855) (-1665.472) [-1661.048] * (-1659.374) (-1658.432) (-1662.556) [-1658.474] -- 0:00:37 Average standard deviation of split frequencies: 0.009699 425500 -- (-1660.183) (-1662.285) (-1659.033) [-1659.813] * [-1660.729] (-1659.768) (-1663.908) (-1657.974) -- 0:00:39 426000 -- (-1659.442) [-1660.757] (-1659.105) (-1659.726) * (-1660.713) [-1659.060] (-1661.225) (-1660.441) -- 0:00:39 426500 -- (-1662.994) [-1660.881] (-1658.915) (-1658.456) * (-1658.714) [-1658.656] (-1659.348) (-1663.901) -- 0:00:38 427000 -- (-1660.743) [-1662.134] (-1660.426) (-1658.641) * (-1657.993) (-1662.202) (-1658.334) [-1658.729] -- 0:00:38 427500 -- [-1659.060] (-1661.269) (-1658.562) (-1658.743) * (-1658.070) [-1662.247] (-1658.113) (-1657.994) -- 0:00:38 428000 -- [-1661.441] (-1660.239) (-1660.648) (-1661.837) * [-1661.817] (-1661.452) (-1659.499) (-1658.082) -- 0:00:38 428500 -- (-1659.188) [-1660.268] (-1659.004) (-1659.915) * (-1660.221) (-1662.098) [-1657.990] (-1661.254) -- 0:00:38 429000 -- (-1657.907) (-1661.505) (-1659.861) [-1661.117] * [-1659.233] (-1662.186) (-1659.818) (-1659.377) -- 0:00:38 429500 -- (-1657.754) (-1660.839) [-1658.864] (-1661.401) * (-1660.872) (-1660.283) [-1659.561] (-1659.782) -- 0:00:38 430000 -- (-1662.009) (-1661.164) (-1658.142) [-1657.955] * (-1660.282) [-1660.030] (-1659.730) (-1659.250) -- 0:00:38 Average standard deviation of split frequencies: 0.009401 430500 -- (-1662.500) (-1662.999) (-1660.475) [-1658.592] * [-1657.749] (-1659.826) (-1669.166) (-1659.889) -- 0:00:38 431000 -- (-1661.453) (-1662.465) [-1659.969] (-1658.574) * (-1658.295) [-1659.468] (-1657.649) (-1664.803) -- 0:00:38 431500 -- [-1660.638] (-1658.526) (-1659.288) (-1658.889) * (-1658.572) [-1659.168] (-1658.287) (-1660.043) -- 0:00:38 432000 -- (-1659.997) [-1658.290] (-1661.824) (-1657.865) * [-1658.662] (-1660.815) (-1662.148) (-1662.935) -- 0:00:38 432500 -- (-1659.675) [-1661.100] (-1664.828) (-1660.453) * [-1658.864] (-1658.545) (-1659.855) (-1664.636) -- 0:00:38 433000 -- [-1660.487] (-1658.172) (-1658.002) (-1668.155) * (-1661.282) (-1658.723) [-1659.211] (-1663.231) -- 0:00:37 433500 -- (-1660.841) (-1657.928) [-1658.494] (-1665.104) * (-1660.814) (-1661.427) (-1659.048) [-1666.329] -- 0:00:37 434000 -- (-1660.796) [-1658.443] (-1658.812) (-1661.356) * (-1663.601) (-1664.000) [-1658.445] (-1660.680) -- 0:00:37 434500 -- [-1659.085] (-1659.260) (-1658.818) (-1659.181) * (-1662.877) (-1663.117) (-1659.279) [-1657.855] -- 0:00:37 435000 -- (-1659.100) (-1659.305) (-1660.322) [-1659.510] * (-1662.751) [-1660.199] (-1660.550) (-1658.366) -- 0:00:37 Average standard deviation of split frequencies: 0.009985 435500 -- (-1658.806) (-1662.261) (-1660.913) [-1659.710] * (-1660.286) (-1659.046) [-1663.324] (-1659.468) -- 0:00:37 436000 -- [-1660.120] (-1662.282) (-1660.986) (-1658.062) * [-1657.718] (-1666.478) (-1662.900) (-1658.474) -- 0:00:37 436500 -- (-1659.084) (-1659.000) (-1661.118) [-1658.157] * (-1663.344) [-1661.194] (-1659.677) (-1658.427) -- 0:00:37 437000 -- (-1658.949) (-1659.816) (-1661.271) [-1661.877] * [-1661.857] (-1664.174) (-1662.220) (-1659.935) -- 0:00:37 437500 -- [-1659.410] (-1658.416) (-1659.860) (-1661.320) * (-1660.680) (-1663.341) (-1661.239) [-1660.675] -- 0:00:37 438000 -- (-1660.136) (-1658.723) [-1661.023] (-1660.413) * (-1661.285) (-1658.407) [-1659.797] (-1660.696) -- 0:00:37 438500 -- (-1660.758) (-1659.890) (-1660.283) [-1658.774] * (-1660.743) (-1657.984) [-1659.714] (-1660.835) -- 0:00:37 439000 -- (-1659.084) (-1659.751) (-1659.452) [-1658.951] * (-1659.320) (-1658.980) (-1659.801) [-1659.821] -- 0:00:37 439500 -- [-1659.923] (-1660.394) (-1666.184) (-1662.432) * (-1659.385) [-1661.823] (-1658.541) (-1658.670) -- 0:00:36 440000 -- (-1658.843) (-1660.411) [-1661.691] (-1664.235) * (-1659.124) (-1661.686) (-1658.261) [-1661.097] -- 0:00:36 Average standard deviation of split frequencies: 0.009502 440500 -- (-1660.721) (-1659.531) [-1659.293] (-1664.463) * (-1660.922) (-1659.202) [-1659.451] (-1661.547) -- 0:00:38 441000 -- [-1660.172] (-1660.102) (-1659.451) (-1664.889) * (-1661.797) (-1659.586) (-1658.478) [-1659.749] -- 0:00:38 441500 -- (-1661.080) (-1659.854) (-1658.618) [-1659.323] * (-1661.833) [-1658.956] (-1658.705) (-1658.385) -- 0:00:37 442000 -- (-1662.647) (-1658.323) (-1658.958) [-1660.009] * (-1662.853) (-1660.675) [-1659.853] (-1659.533) -- 0:00:37 442500 -- (-1666.231) (-1658.047) [-1658.998] (-1659.521) * (-1660.850) (-1661.847) [-1658.302] (-1659.783) -- 0:00:37 443000 -- (-1660.481) (-1660.000) (-1661.387) [-1659.594] * (-1661.835) [-1659.057] (-1662.206) (-1661.401) -- 0:00:37 443500 -- (-1659.545) (-1662.568) [-166