--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 09:58:13 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/7res/ML1936/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1458.76         -1461.85
2      -1458.80         -1462.71
--------------------------------------
TOTAL    -1458.78         -1462.37
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899200    0.088652    0.349758    1.463785    0.867860   1501.00   1501.00    1.000
r(A<->C){all}   0.154663    0.017955    0.000012    0.429049    0.119812    242.96    260.52    1.001
r(A<->G){all}   0.174012    0.020358    0.000134    0.455205    0.138236    174.56    205.08    1.001
r(A<->T){all}   0.173360    0.020186    0.000048    0.445773    0.138721    227.14    289.53    1.000
r(C<->G){all}   0.158808    0.018466    0.000110    0.434912    0.120368    183.84    189.59    1.002
r(C<->T){all}   0.172126    0.020054    0.000018    0.442510    0.135483    219.16    298.38    1.000
r(G<->T){all}   0.167031    0.018749    0.000114    0.435405    0.134138    311.04    323.48    1.000
pi(A){all}      0.203713    0.000145    0.180570    0.226574    0.203730   1041.27   1169.98    1.000
pi(C){all}      0.277031    0.000193    0.250582    0.304470    0.276999   1254.23   1289.13    1.000
pi(G){all}      0.322489    0.000202    0.294743    0.349081    0.322174   1394.62   1402.63    1.000
pi(T){all}      0.196767    0.000145    0.173146    0.219969    0.196195   1477.80   1489.40    1.000
alpha{1,2}      0.431043    0.223861    0.000127    1.392663    0.269029   1327.32   1327.33    1.001
alpha{3}        0.447884    0.224209    0.000176    1.378298    0.296906   1175.57   1187.10    1.001
pinvar{all}     0.998632    0.000003    0.995381    1.000000    0.999152    879.04   1005.90    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1389.20185
Model 2: PositiveSelection	-1389.20185
Model 0: one-ratio	-1389.202384
Model 7: beta	-1389.20185
Model 8: beta&w>1	-1389.202211


Model 0 vs 1	0.0010680000000320433

Model 2 vs 1	0.0

Model 8 vs 7	7.220000002234883E-4
>C1
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C2
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C3
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C4
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C5
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C6
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=356 

C1              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C2              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C3              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C4              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C5              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C6              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
                **************************************************

C1              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C2              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C3              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C4              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C5              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C6              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
                **************************************************

C1              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C2              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C3              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C4              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C5              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C6              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
                **************************************************

C1              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C2              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C3              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C4              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C5              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C6              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
                **************************************************

C1              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C2              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C3              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C4              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C5              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C6              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
                **************************************************

C1              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C2              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C3              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C4              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C5              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C6              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
                **************************************************

C1              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C2              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C3              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C4              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C5              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C6              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
                **************************************************

C1              VEFRHG
C2              VEFRHG
C3              VEFRHG
C4              VEFRHG
C5              VEFRHG
C6              VEFRHG
                ******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  356 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  356 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [10680]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [10680]--->[10680]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.522 Mb, Max= 30.928 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C2              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C3              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C4              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C5              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
C6              VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
                **************************************************

C1              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C2              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C3              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C4              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C5              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
C6              LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
                **************************************************

C1              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C2              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C3              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C4              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C5              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
C6              CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
                **************************************************

C1              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C2              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C3              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C4              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C5              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
C6              ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
                **************************************************

C1              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C2              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C3              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C4              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C5              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
C6              VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
                **************************************************

C1              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C2              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C3              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C4              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C5              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
C6              ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
                **************************************************

C1              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C2              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C3              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C4              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C5              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
C6              VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
                **************************************************

C1              VEFRHG
C2              VEFRHG
C3              VEFRHG
C4              VEFRHG
C5              VEFRHG
C6              VEFRHG
                ******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
C2              GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
C3              GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
C4              GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
C5              GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
C6              GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
                **************************************************

C1              ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
C2              ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
C3              ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
C4              ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
C5              ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
C6              ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
                **************************************************

C1              TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
C2              TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
C3              TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
C4              TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
C5              TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
C6              TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
                **************************************************

C1              CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
C2              CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
C3              CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
C4              CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
C5              CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
C6              CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
                **************************************************

C1              GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
C2              GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
C3              GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
C4              GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
C5              GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
C6              GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
                **************************************************

C1              CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
C2              CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
C3              CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
C4              CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
C5              CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
C6              CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
                **************************************************

C1              TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
C2              TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
C3              TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
C4              TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
C5              TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
C6              TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
                **************************************************

C1              ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
C2              ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
C3              ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
C4              ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
C5              ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
C6              ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
                **************************************************

C1              TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
C2              TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
C3              TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
C4              TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
C5              TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
C6              TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
                **************************************************

C1              GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
C2              GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
C3              GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
C4              GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
C5              GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
C6              GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
                **************************************************

C1              ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
C2              ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
C3              ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
C4              ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
C5              ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
C6              ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
                **************************************************

C1              GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
C2              GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
C3              GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
C4              GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
C5              GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
C6              GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
                **************************************************

C1              GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
C2              GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
C3              GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
C4              GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
C5              GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
C6              GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
                **************************************************

C1              GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
C2              GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
C3              GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
C4              GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
C5              GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
C6              GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
                **************************************************

C1              TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
C2              TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
C3              TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
C4              TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
C5              TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
C6              TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
                **************************************************

C1              GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
C2              GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
C3              GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
C4              GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
C5              GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
C6              GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
                **************************************************

C1              TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
C2              TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
C3              TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
C4              TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
C5              TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
C6              TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
                **************************************************

C1              TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
C2              TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
C3              TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
C4              TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
C5              TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
C6              TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
                **************************************************

C1              GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
C2              GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
C3              GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
C4              GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
C5              GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
C6              GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
                **************************************************

C1              GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
C2              GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
C3              GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
C4              GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
C5              GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
C6              GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
                **************************************************

C1              GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
C2              GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
C3              GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
C4              GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
C5              GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
C6              GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
                **************************************************

C1              GTGGAGTTCCGGCACGGA
C2              GTGGAGTTCCGGCACGGA
C3              GTGGAGTTCCGGCACGGA
C4              GTGGAGTTCCGGCACGGA
C5              GTGGAGTTCCGGCACGGA
C6              GTGGAGTTCCGGCACGGA
                ******************



>C1
GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
GTGGAGTTCCGGCACGGA
>C2
GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
GTGGAGTTCCGGCACGGA
>C3
GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
GTGGAGTTCCGGCACGGA
>C4
GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
GTGGAGTTCCGGCACGGA
>C5
GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
GTGGAGTTCCGGCACGGA
>C6
GTGAGCCTGAGTTTGGGAATCGTGGGTCTACCCAACGTCGGCAAGTCGAC
ATTGTTCAACGCGTTGACCAGGAGCAATGTGGTGGTTGCCAACTATCCGT
TTGCAACGATCGAACCGAATGAGGGCGTCGTCTCCCTGCCTGATCCGCGG
CTGGCCAAACTAGCCGAGTTGTTCGGATCGGAGCGTATCCTGCCGGCCCA
GGTGACCTTCGTTGACATTGCCGGCCTGGTAAAGGGTGCGTCCGAGGGGG
CCGGGCTTGGTAACAAGTTTCTGGCCCATATCCGCGAATGCGACGCAATC
TGCCAAGTGGTTCGGGTGTTCTCCGGCGACGACATCACACATGTCACAGG
ACGCGTGGATCCCCAGTCTGATATCGGGATTATCGATACTGAATTGATCC
TGGCTGACCTGGACACCCTTGAGCGGGCTCTGCCGCGGCTGGAGAAAGAA
GCTCGCAACCACAAGGAACGCAAACCCATCTACGCCGCGGCAATCAACGC
ACAACAGGTGTTAAACGTCGGGACGACGTTATTCGCCGCCGGTGTAGACG
GATCTGCGCTGCGGGAGCTGAATCTGCTGACCAACAAACCGTTCCTCTAC
GTTTTCAATGCTGACGAGGCAGTGCTGACCGCTGCCGCATGGGTAGCTGA
GCTGCGCCAGCTCGTCGCGCCCGCGGATGCGGTGTTCTTGGACGCCGCCA
TCGAGGCCGAGCTGGCTGAATTGGATGACGAGTCGGCCGCTGAGCTACTC
GAGTCAATCGGGCAGACCGAGCGGGGGCTCGATGCCCTGGCTCGCGCCGG
TTTCCGCACGCTGGCGCTGCAGACTTTTCTGACGGTGGGACCAAAGGAGG
TGCGGGCATGGACCATCCATCAGGGCGATACCGCGTCGAAGGCAGCCGGG
GTGATTCACACCGACTTCGAGAAGCGTTTCATTAAAGCCGAGATCGTGTC
GTATGACGACCTGATCGCTACCGGGTCAATGTCGGCAGCAAAGGCGGCAG
GTAAGGTCCGAACGGAAGGCAAGGACTACGTGATGGCCGACGGCGATGTG
GTGGAGTTCCGGCACGGA
>C1
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C2
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C3
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C4
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C5
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG
>C6
VSLSLGIVGLPNVGKSTLFNALTRSNVVVANYPFATIEPNEGVVSLPDPR
LAKLAELFGSERILPAQVTFVDIAGLVKGASEGAGLGNKFLAHIRECDAI
CQVVRVFSGDDITHVTGRVDPQSDIGIIDTELILADLDTLERALPRLEKE
ARNHKERKPIYAAAINAQQVLNVGTTLFAAGVDGSALRELNLLTNKPFLY
VFNADEAVLTAAAWVAELRQLVAPADAVFLDAAIEAELAELDDESAAELL
ESIGQTERGLDALARAGFRTLALQTFLTVGPKEVRAWTIHQGDTASKAAG
VIHTDFEKRFIKAEIVSYDDLIATGSMSAAKAAGKVRTEGKDYVMADGDV
VEFRHG


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1068 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579859806
      Setting output file names to "/data/7res/ML1936/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 120296202
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5474362892
      Seed = 934433035
      Swapseed = 1579859806
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2390.235199 -- -24.965149
         Chain 2 -- -2390.235199 -- -24.965149
         Chain 3 -- -2390.235199 -- -24.965149
         Chain 4 -- -2390.235061 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2390.234835 -- -24.965149
         Chain 2 -- -2390.235199 -- -24.965149
         Chain 3 -- -2390.235199 -- -24.965149
         Chain 4 -- -2390.234835 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2390.235] (-2390.235) (-2390.235) (-2390.235) * [-2390.235] (-2390.235) (-2390.235) (-2390.235) 
        500 -- (-1466.894) (-1466.365) [-1470.242] (-1485.955) * (-1484.847) (-1465.517) [-1474.637] (-1481.393) -- 0:00:00
       1000 -- (-1473.959) [-1467.596] (-1471.096) (-1464.363) * (-1473.732) (-1465.202) [-1463.423] (-1486.469) -- 0:00:00
       1500 -- (-1467.715) (-1469.492) (-1467.522) [-1468.632] * (-1466.457) (-1463.285) [-1463.141] (-1477.600) -- 0:00:00
       2000 -- (-1471.910) [-1471.126] (-1466.239) (-1461.976) * (-1474.926) (-1467.677) (-1467.253) [-1465.132] -- 0:00:00
       2500 -- (-1474.461) (-1476.993) [-1468.179] (-1469.881) * [-1470.864] (-1464.746) (-1477.115) (-1464.836) -- 0:00:00
       3000 -- (-1473.145) (-1469.322) (-1465.720) [-1462.621] * [-1466.106] (-1468.167) (-1465.036) (-1471.408) -- 0:00:00
       3500 -- (-1467.674) (-1464.989) (-1468.346) [-1468.762] * (-1466.423) (-1468.956) [-1471.069] (-1467.868) -- 0:00:00
       4000 -- (-1477.859) (-1466.804) (-1472.606) [-1462.811] * (-1465.198) (-1469.072) (-1465.322) [-1466.604] -- 0:00:00
       4500 -- (-1466.311) (-1467.701) [-1469.707] (-1467.437) * [-1467.527] (-1468.863) (-1468.573) (-1473.120) -- 0:00:00
       5000 -- (-1469.055) (-1473.152) [-1464.644] (-1475.138) * (-1469.385) (-1470.993) [-1472.511] (-1465.825) -- 0:00:00

      Average standard deviation of split frequencies: 0.102479

       5500 -- [-1464.696] (-1465.177) (-1468.735) (-1479.744) * (-1472.322) (-1463.429) (-1471.281) [-1468.059] -- 0:00:00
       6000 -- (-1480.503) (-1467.751) (-1471.966) [-1466.436] * (-1472.012) [-1463.333] (-1464.046) (-1472.725) -- 0:00:00
       6500 -- (-1475.721) [-1464.546] (-1467.123) (-1465.465) * (-1478.810) [-1469.468] (-1464.311) (-1472.952) -- 0:00:00
       7000 -- (-1469.128) [-1465.280] (-1477.242) (-1465.658) * (-1463.705) (-1477.565) [-1467.110] (-1463.294) -- 0:00:00
       7500 -- [-1474.618] (-1471.638) (-1469.108) (-1466.383) * [-1472.133] (-1474.681) (-1470.579) (-1471.746) -- 0:00:00
       8000 -- [-1467.454] (-1477.585) (-1469.614) (-1469.385) * (-1460.978) (-1469.233) (-1476.594) [-1463.961] -- 0:00:00
       8500 -- (-1464.538) (-1468.391) [-1474.306] (-1464.786) * (-1460.766) (-1468.298) (-1470.313) [-1465.561] -- 0:01:56
       9000 -- (-1462.834) [-1465.292] (-1476.217) (-1469.668) * (-1461.909) [-1473.826] (-1472.165) (-1472.496) -- 0:01:50
       9500 -- (-1470.679) [-1467.722] (-1470.723) (-1473.967) * (-1459.522) (-1468.941) [-1460.012] (-1470.502) -- 0:01:44
      10000 -- (-1468.895) (-1476.597) (-1467.838) [-1470.631] * (-1459.543) (-1473.147) (-1459.302) [-1469.021] -- 0:01:39

      Average standard deviation of split frequencies: 0.071095

      10500 -- (-1463.518) [-1467.964] (-1475.097) (-1464.291) * (-1458.658) [-1466.667] (-1458.259) (-1471.052) -- 0:01:34
      11000 -- (-1470.741) (-1480.450) (-1467.351) [-1463.606] * (-1458.037) (-1470.373) [-1459.690] (-1466.817) -- 0:01:29
      11500 -- [-1466.097] (-1465.901) (-1476.478) (-1468.731) * [-1457.840] (-1467.652) (-1459.209) (-1471.503) -- 0:01:25
      12000 -- (-1467.355) (-1470.164) [-1466.995] (-1465.673) * (-1459.541) [-1465.808] (-1459.063) (-1475.442) -- 0:01:22
      12500 -- (-1466.890) [-1465.623] (-1471.352) (-1479.754) * (-1460.000) [-1466.194] (-1459.800) (-1463.718) -- 0:01:19
      13000 -- [-1471.869] (-1470.278) (-1467.670) (-1465.859) * (-1460.555) (-1475.219) (-1459.591) [-1463.776] -- 0:01:15
      13500 -- (-1468.734) (-1464.077) (-1466.127) [-1472.762] * (-1461.477) (-1469.813) [-1461.333] (-1474.514) -- 0:01:13
      14000 -- (-1467.302) (-1473.782) [-1470.661] (-1470.164) * (-1462.029) [-1476.156] (-1463.914) (-1461.293) -- 0:01:10
      14500 -- (-1464.964) [-1465.455] (-1470.211) (-1463.674) * [-1459.454] (-1460.938) (-1462.609) (-1464.442) -- 0:01:07
      15000 -- (-1476.728) (-1472.443) [-1466.980] (-1469.981) * (-1459.359) (-1463.758) (-1459.227) [-1477.201] -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-1466.122) (-1473.838) (-1468.920) [-1470.504] * (-1459.428) (-1470.394) [-1457.955] (-1467.901) -- 0:01:03
      16000 -- (-1469.259) [-1469.131] (-1464.092) (-1468.477) * (-1464.670) (-1466.737) (-1458.751) [-1470.885] -- 0:01:01
      16500 -- (-1473.565) (-1472.567) [-1469.384] (-1468.083) * (-1463.196) [-1461.125] (-1459.208) (-1467.727) -- 0:00:59
      17000 -- [-1467.002] (-1471.711) (-1472.884) (-1470.646) * (-1458.539) (-1461.262) (-1459.805) [-1466.832] -- 0:00:57
      17500 -- (-1465.182) (-1463.383) [-1470.112] (-1470.899) * [-1460.650] (-1462.711) (-1462.525) (-1465.951) -- 0:00:56
      18000 -- [-1468.798] (-1468.229) (-1471.769) (-1468.542) * (-1464.452) [-1461.317] (-1458.459) (-1474.959) -- 0:00:54
      18500 -- [-1468.290] (-1471.471) (-1477.932) (-1465.199) * (-1461.560) (-1461.963) [-1458.186] (-1467.759) -- 0:00:53
      19000 -- (-1472.196) (-1467.852) [-1465.780] (-1474.878) * (-1457.736) (-1458.494) [-1457.675] (-1468.682) -- 0:00:51
      19500 -- (-1467.720) (-1465.034) [-1468.235] (-1462.054) * (-1461.019) [-1458.238] (-1459.339) (-1465.514) -- 0:00:50
      20000 -- (-1476.673) [-1463.102] (-1476.323) (-1462.154) * (-1459.141) (-1459.070) [-1460.237] (-1464.943) -- 0:00:49

      Average standard deviation of split frequencies: 0.050987

      20500 -- (-1467.747) (-1470.564) [-1472.148] (-1461.433) * (-1458.525) (-1458.399) [-1460.103] (-1473.584) -- 0:00:47
      21000 -- [-1466.660] (-1467.864) (-1465.897) (-1460.643) * (-1463.028) (-1459.203) [-1460.126] (-1469.096) -- 0:00:46
      21500 -- [-1466.518] (-1464.773) (-1470.605) (-1459.781) * (-1462.082) (-1458.092) (-1459.053) [-1465.799] -- 0:00:45
      22000 -- (-1466.465) (-1473.785) [-1472.495] (-1459.089) * (-1459.756) (-1459.630) [-1459.013] (-1470.576) -- 0:00:44
      22500 -- [-1469.920] (-1468.820) (-1473.873) (-1458.788) * (-1459.173) (-1459.823) [-1458.738] (-1469.200) -- 0:00:43
      23000 -- (-1475.706) (-1466.409) [-1462.918] (-1459.152) * (-1460.600) (-1462.136) [-1460.557] (-1470.713) -- 0:01:24
      23500 -- (-1471.501) (-1466.535) (-1461.509) [-1459.213] * (-1460.916) [-1462.288] (-1460.964) (-1467.589) -- 0:01:23
      24000 -- (-1467.539) [-1467.981] (-1464.107) (-1458.010) * [-1460.230] (-1461.706) (-1461.616) (-1473.637) -- 0:01:21
      24500 -- [-1467.948] (-1460.622) (-1462.982) (-1461.048) * (-1459.312) (-1458.335) [-1459.981] (-1466.673) -- 0:01:19
      25000 -- [-1462.096] (-1461.473) (-1460.723) (-1458.411) * (-1459.796) (-1458.347) (-1459.458) [-1470.675] -- 0:01:18

      Average standard deviation of split frequencies: 0.040795

      25500 -- (-1462.792) [-1457.897] (-1461.710) (-1458.422) * [-1461.713] (-1459.108) (-1460.916) (-1472.314) -- 0:01:16
      26000 -- (-1476.315) [-1459.015] (-1461.134) (-1459.795) * (-1460.901) [-1461.794] (-1457.934) (-1471.226) -- 0:01:14
      26500 -- (-1476.268) [-1459.139] (-1459.932) (-1460.558) * (-1458.523) (-1461.488) [-1457.833] (-1471.264) -- 0:01:13
      27000 -- (-1465.183) (-1460.185) [-1460.554] (-1459.915) * (-1458.415) [-1458.699] (-1457.308) (-1472.911) -- 0:01:12
      27500 -- (-1473.461) (-1460.648) (-1459.533) [-1460.053] * (-1458.216) (-1461.945) [-1458.675] (-1469.394) -- 0:01:10
      28000 -- (-1468.229) (-1457.363) [-1463.322] (-1459.723) * (-1458.191) (-1457.865) [-1458.393] (-1466.017) -- 0:01:09
      28500 -- (-1466.132) (-1459.105) (-1461.483) [-1459.960] * (-1459.721) [-1460.254] (-1460.260) (-1462.772) -- 0:01:08
      29000 -- (-1468.609) [-1460.040] (-1461.005) (-1459.007) * [-1463.310] (-1461.252) (-1460.729) (-1462.999) -- 0:01:06
      29500 -- (-1469.464) [-1459.103] (-1460.773) (-1458.769) * (-1461.317) [-1458.926] (-1461.348) (-1468.569) -- 0:01:05
      30000 -- (-1467.889) [-1457.853] (-1458.373) (-1459.079) * (-1458.104) (-1458.282) (-1461.475) [-1466.967] -- 0:01:04

      Average standard deviation of split frequencies: 0.044578

      30500 -- (-1469.971) [-1457.977] (-1457.994) (-1459.446) * (-1460.371) (-1459.099) (-1459.913) [-1472.571] -- 0:01:03
      31000 -- (-1469.521) (-1457.697) [-1458.750] (-1459.557) * [-1460.436] (-1460.311) (-1458.571) (-1472.540) -- 0:01:02
      31500 -- [-1465.749] (-1457.547) (-1463.399) (-1463.724) * (-1459.302) (-1460.835) [-1460.431] (-1466.571) -- 0:01:01
      32000 -- (-1470.837) (-1457.588) [-1458.864] (-1462.441) * (-1461.974) (-1460.058) (-1458.819) [-1467.534] -- 0:01:00
      32500 -- [-1466.017] (-1458.045) (-1460.771) (-1458.422) * [-1458.516] (-1459.076) (-1458.755) (-1472.057) -- 0:00:59
      33000 -- (-1470.141) (-1459.112) (-1461.653) [-1458.415] * (-1458.530) [-1462.450] (-1457.500) (-1472.690) -- 0:00:58
      33500 -- (-1466.563) (-1458.387) [-1458.104] (-1459.361) * (-1461.303) (-1458.721) [-1457.895] (-1471.960) -- 0:00:57
      34000 -- (-1470.196) (-1461.628) [-1459.619] (-1461.123) * (-1459.132) (-1461.242) [-1460.138] (-1469.998) -- 0:00:56
      34500 -- [-1475.310] (-1462.804) (-1458.958) (-1459.834) * (-1458.821) (-1461.125) (-1459.484) [-1465.287] -- 0:00:55
      35000 -- (-1471.520) [-1459.649] (-1460.270) (-1460.390) * (-1459.193) [-1458.157] (-1461.095) (-1466.503) -- 0:00:55

      Average standard deviation of split frequencies: 0.039284

      35500 -- [-1470.176] (-1461.646) (-1461.746) (-1460.059) * (-1459.993) (-1458.751) [-1459.176] (-1466.741) -- 0:00:54
      36000 -- (-1466.582) (-1458.777) (-1458.303) [-1458.365] * (-1457.731) (-1457.990) [-1457.880] (-1475.889) -- 0:00:53
      36500 -- (-1468.091) [-1460.121] (-1458.445) (-1460.362) * [-1458.194] (-1459.564) (-1457.764) (-1468.277) -- 0:00:52
      37000 -- [-1463.732] (-1460.767) (-1457.388) (-1460.319) * (-1459.702) (-1459.901) (-1458.736) [-1467.026] -- 0:00:52
      37500 -- (-1470.216) (-1459.376) [-1457.640] (-1459.540) * (-1457.759) (-1462.204) (-1458.076) [-1464.198] -- 0:00:51
      38000 -- (-1468.869) (-1459.451) [-1459.483] (-1462.254) * (-1458.387) (-1459.268) (-1458.080) [-1471.151] -- 0:00:50
      38500 -- (-1468.688) (-1458.780) [-1459.278] (-1462.968) * (-1458.343) (-1461.275) (-1457.748) [-1466.510] -- 0:00:49
      39000 -- [-1469.218] (-1457.485) (-1458.894) (-1461.071) * (-1460.588) [-1457.493] (-1460.287) (-1469.446) -- 0:01:13
      39500 -- [-1463.849] (-1459.884) (-1459.167) (-1460.380) * (-1457.776) (-1458.355) [-1457.763] (-1465.861) -- 0:01:12
      40000 -- (-1477.857) [-1458.719] (-1457.987) (-1462.472) * (-1457.606) (-1457.724) [-1458.384] (-1470.532) -- 0:01:12

      Average standard deviation of split frequencies: 0.037674

      40500 -- (-1472.684) (-1465.423) (-1459.115) [-1459.064] * (-1457.258) [-1462.009] (-1457.622) (-1467.981) -- 0:01:11
      41000 -- (-1467.991) (-1459.175) (-1458.416) [-1463.538] * (-1459.335) [-1458.025] (-1457.592) (-1468.580) -- 0:01:10
      41500 -- (-1467.100) (-1458.322) (-1458.484) [-1458.521] * (-1458.282) [-1459.042] (-1457.886) (-1463.558) -- 0:01:09
      42000 -- (-1461.447) (-1458.261) (-1458.124) [-1459.295] * (-1459.052) (-1462.892) (-1465.693) [-1474.207] -- 0:01:08
      42500 -- (-1460.057) [-1458.874] (-1458.237) (-1459.357) * (-1466.155) (-1460.704) [-1459.045] (-1467.351) -- 0:01:07
      43000 -- [-1458.805] (-1458.201) (-1459.168) (-1459.296) * (-1462.207) (-1459.509) [-1460.618] (-1464.523) -- 0:01:06
      43500 -- (-1458.124) [-1459.246] (-1460.850) (-1458.066) * [-1461.886] (-1458.816) (-1460.452) (-1466.860) -- 0:01:05
      44000 -- (-1457.725) (-1463.035) [-1460.424] (-1457.620) * (-1460.639) (-1461.210) (-1460.536) [-1475.907] -- 0:01:05
      44500 -- (-1457.725) (-1462.873) [-1460.781] (-1459.095) * (-1461.235) (-1460.649) (-1458.838) [-1477.462] -- 0:01:04
      45000 -- (-1462.074) (-1464.408) (-1462.878) [-1460.724] * (-1460.423) (-1460.660) (-1459.050) [-1470.650] -- 0:01:03

      Average standard deviation of split frequencies: 0.037405

      45500 -- (-1460.928) (-1462.893) [-1458.776] (-1458.242) * (-1464.315) (-1461.784) [-1460.647] (-1468.706) -- 0:01:02
      46000 -- [-1458.719] (-1463.755) (-1459.013) (-1458.201) * (-1464.775) (-1459.158) (-1460.793) [-1477.493] -- 0:01:02
      46500 -- [-1462.910] (-1459.062) (-1461.354) (-1461.182) * (-1463.391) (-1459.110) [-1458.077] (-1467.336) -- 0:01:01
      47000 -- [-1463.522] (-1459.808) (-1459.405) (-1460.636) * (-1460.881) (-1458.950) (-1458.890) [-1464.843] -- 0:01:00
      47500 -- (-1458.078) (-1460.041) (-1460.598) [-1460.902] * (-1460.653) (-1462.061) [-1463.431] (-1467.482) -- 0:01:00
      48000 -- (-1459.403) [-1461.786] (-1459.078) (-1458.106) * [-1462.971] (-1459.317) (-1461.823) (-1463.365) -- 0:00:59
      48500 -- (-1458.880) (-1461.167) [-1458.955] (-1457.895) * [-1459.949] (-1462.032) (-1465.627) (-1468.550) -- 0:00:58
      49000 -- (-1457.343) [-1458.812] (-1460.794) (-1458.243) * [-1459.201] (-1459.861) (-1457.756) (-1466.687) -- 0:00:58
      49500 -- [-1457.572] (-1459.004) (-1459.489) (-1458.550) * (-1459.376) (-1462.605) [-1458.579] (-1470.342) -- 0:00:57
      50000 -- [-1458.159] (-1460.425) (-1461.426) (-1459.800) * (-1458.564) (-1463.790) [-1459.270] (-1467.739) -- 0:00:57

      Average standard deviation of split frequencies: 0.038685

      50500 -- (-1458.427) (-1459.396) [-1460.793] (-1459.980) * (-1458.848) (-1460.475) (-1462.136) [-1466.622] -- 0:00:56
      51000 -- [-1458.284] (-1458.143) (-1460.034) (-1458.132) * (-1458.531) (-1461.103) [-1460.621] (-1469.165) -- 0:00:55
      51500 -- (-1457.811) (-1458.129) (-1465.719) [-1458.655] * [-1460.065] (-1460.779) (-1461.924) (-1468.330) -- 0:00:55
      52000 -- (-1459.390) [-1459.737] (-1464.395) (-1462.185) * [-1459.311] (-1461.117) (-1457.262) (-1464.718) -- 0:00:54
      52500 -- (-1461.722) (-1458.503) (-1462.723) [-1458.052] * (-1459.963) [-1459.776] (-1457.252) (-1464.303) -- 0:00:54
      53000 -- (-1460.753) (-1459.633) (-1460.650) [-1458.627] * [-1459.082] (-1458.704) (-1457.254) (-1465.914) -- 0:00:53
      53500 -- (-1458.824) [-1457.682] (-1458.632) (-1458.746) * (-1458.099) (-1458.728) (-1463.322) [-1469.488] -- 0:00:53
      54000 -- (-1457.713) (-1460.781) [-1460.265] (-1460.263) * (-1459.831) [-1457.532] (-1460.443) (-1467.771) -- 0:00:52
      54500 -- (-1458.510) (-1457.709) [-1462.377] (-1458.510) * (-1461.071) (-1457.532) [-1461.257] (-1470.582) -- 0:01:09
      55000 -- (-1458.517) (-1462.493) (-1459.836) [-1458.505] * (-1460.151) (-1458.874) (-1460.778) [-1467.847] -- 0:01:08

      Average standard deviation of split frequencies: 0.031567

      55500 -- (-1458.853) (-1459.636) [-1460.159] (-1457.997) * (-1457.788) (-1458.863) (-1463.519) [-1469.332] -- 0:01:08
      56000 -- (-1459.283) (-1458.627) [-1460.089] (-1460.103) * [-1457.494] (-1458.244) (-1464.524) (-1465.108) -- 0:01:07
      56500 -- (-1461.764) (-1459.719) [-1459.343] (-1458.566) * (-1461.958) (-1458.360) (-1463.074) [-1468.997] -- 0:01:06
      57000 -- (-1465.929) [-1459.061] (-1459.254) (-1458.751) * (-1458.243) [-1458.303] (-1459.383) (-1465.836) -- 0:01:06
      57500 -- [-1459.163] (-1459.659) (-1460.030) (-1458.461) * (-1458.786) [-1459.514] (-1459.703) (-1463.550) -- 0:01:05
      58000 -- (-1458.106) (-1459.813) [-1458.901] (-1457.917) * [-1458.423] (-1461.624) (-1457.485) (-1469.758) -- 0:01:04
      58500 -- (-1458.481) (-1459.074) (-1459.599) [-1460.504] * (-1457.443) (-1461.630) [-1457.775] (-1474.854) -- 0:01:04
      59000 -- (-1460.329) (-1460.506) [-1461.852] (-1460.523) * [-1457.824] (-1458.392) (-1458.446) (-1474.093) -- 0:01:03
      59500 -- (-1461.769) (-1458.400) [-1458.699] (-1460.853) * [-1459.315] (-1460.602) (-1458.149) (-1470.827) -- 0:01:03
      60000 -- (-1460.883) (-1457.981) [-1457.458] (-1458.992) * [-1459.314] (-1459.869) (-1457.944) (-1471.692) -- 0:01:02

      Average standard deviation of split frequencies: 0.025254

      60500 -- (-1460.688) (-1463.900) (-1463.341) [-1462.828] * [-1458.889] (-1460.363) (-1457.944) (-1464.480) -- 0:01:02
      61000 -- (-1459.466) [-1459.830] (-1461.001) (-1461.809) * (-1462.994) (-1464.481) [-1462.453] (-1472.628) -- 0:01:01
      61500 -- (-1462.211) (-1463.630) (-1460.486) [-1461.346] * (-1460.695) (-1459.685) [-1458.581] (-1468.536) -- 0:01:01
      62000 -- (-1466.377) (-1457.528) (-1462.541) [-1462.292] * (-1462.202) (-1458.719) (-1457.643) [-1466.380] -- 0:01:00
      62500 -- [-1462.595] (-1457.273) (-1460.516) (-1458.468) * (-1459.116) (-1458.223) [-1459.751] (-1466.972) -- 0:01:00
      63000 -- (-1462.286) (-1460.679) (-1457.867) [-1460.106] * [-1460.315] (-1459.767) (-1461.742) (-1465.697) -- 0:00:59
      63500 -- [-1459.070] (-1458.483) (-1460.842) (-1458.975) * (-1459.270) [-1459.174] (-1461.332) (-1470.376) -- 0:00:58
      64000 -- [-1460.309] (-1458.648) (-1460.669) (-1458.588) * (-1461.272) [-1457.921] (-1458.667) (-1476.268) -- 0:00:58
      64500 -- (-1458.596) [-1457.914] (-1460.808) (-1459.989) * (-1460.590) [-1458.140] (-1458.730) (-1470.158) -- 0:00:58
      65000 -- (-1458.026) [-1458.111] (-1459.730) (-1458.574) * [-1459.333] (-1459.406) (-1458.747) (-1464.199) -- 0:00:57

      Average standard deviation of split frequencies: 0.026622

      65500 -- (-1458.905) (-1459.406) (-1457.837) [-1457.459] * (-1457.750) (-1458.990) (-1459.064) [-1471.350] -- 0:00:57
      66000 -- (-1460.251) (-1464.463) [-1458.251] (-1457.902) * (-1457.661) (-1459.525) (-1459.449) [-1462.917] -- 0:00:56
      66500 -- (-1459.737) (-1459.418) (-1458.849) [-1458.055] * [-1458.405] (-1463.209) (-1459.018) (-1476.019) -- 0:00:56
      67000 -- (-1460.592) (-1459.104) [-1459.391] (-1459.083) * [-1458.315] (-1459.177) (-1459.452) (-1466.664) -- 0:00:55
      67500 -- [-1459.575] (-1458.665) (-1457.916) (-1462.381) * (-1458.410) (-1457.474) [-1459.757] (-1468.084) -- 0:00:55
      68000 -- [-1458.565] (-1459.702) (-1458.867) (-1460.198) * [-1457.226] (-1457.830) (-1461.302) (-1468.972) -- 0:00:54
      68500 -- [-1459.055] (-1461.914) (-1460.906) (-1459.661) * (-1462.830) (-1461.595) [-1460.610] (-1471.191) -- 0:00:54
      69000 -- (-1460.055) (-1459.361) (-1458.566) [-1459.727] * (-1464.241) (-1461.564) [-1460.327] (-1474.444) -- 0:00:53
      69500 -- (-1461.229) (-1460.050) [-1459.871] (-1458.351) * [-1459.155] (-1459.496) (-1459.917) (-1466.029) -- 0:00:53
      70000 -- (-1461.429) (-1461.405) [-1460.645] (-1459.763) * (-1460.071) (-1458.637) (-1459.500) [-1469.818] -- 0:00:53

      Average standard deviation of split frequencies: 0.021832

      70500 -- (-1459.071) (-1461.190) [-1459.319] (-1462.046) * (-1461.656) (-1459.412) (-1458.292) [-1470.037] -- 0:01:05
      71000 -- (-1462.726) (-1459.447) (-1457.877) [-1459.358] * (-1460.436) (-1458.154) (-1458.965) [-1471.057] -- 0:01:05
      71500 -- (-1462.019) (-1457.957) [-1457.780] (-1458.219) * [-1458.343] (-1458.825) (-1457.849) (-1477.122) -- 0:01:04
      72000 -- (-1464.305) (-1459.570) [-1458.067] (-1459.424) * (-1460.379) (-1458.548) (-1457.849) [-1469.113] -- 0:01:04
      72500 -- (-1467.742) [-1458.949] (-1457.778) (-1466.724) * (-1458.648) (-1458.733) [-1457.849] (-1470.558) -- 0:01:03
      73000 -- [-1464.670] (-1459.198) (-1457.716) (-1461.262) * (-1464.749) (-1461.160) [-1464.182] (-1471.491) -- 0:01:03
      73500 -- (-1459.708) (-1460.437) (-1457.780) [-1457.847] * [-1459.251] (-1459.799) (-1466.096) (-1465.238) -- 0:01:03
      74000 -- (-1467.024) (-1461.027) (-1458.033) [-1461.940] * (-1467.244) (-1464.478) [-1466.136] (-1474.581) -- 0:01:02
      74500 -- (-1463.323) (-1460.119) [-1459.927] (-1461.094) * [-1463.985] (-1461.220) (-1467.494) (-1474.944) -- 0:01:02
      75000 -- [-1462.174] (-1461.342) (-1460.903) (-1458.659) * [-1458.490] (-1460.328) (-1460.365) (-1466.792) -- 0:01:01

      Average standard deviation of split frequencies: 0.022852

      75500 -- (-1460.080) (-1460.175) [-1458.643] (-1461.318) * (-1458.024) (-1459.590) [-1464.578] (-1481.572) -- 0:01:01
      76000 -- (-1461.190) (-1461.374) (-1458.424) [-1460.683] * (-1460.462) (-1461.065) [-1458.627] (-1464.172) -- 0:01:00
      76500 -- (-1459.736) (-1462.566) [-1457.615] (-1463.885) * (-1459.964) [-1458.383] (-1459.448) (-1471.677) -- 0:01:00
      77000 -- (-1460.726) [-1459.074] (-1457.338) (-1467.103) * [-1462.125] (-1458.201) (-1458.502) (-1477.528) -- 0:00:59
      77500 -- [-1460.841] (-1459.715) (-1460.713) (-1469.362) * (-1459.310) (-1464.221) [-1458.936] (-1469.799) -- 0:00:59
      78000 -- (-1460.007) [-1459.743] (-1458.259) (-1461.309) * (-1458.565) (-1460.231) (-1458.389) [-1469.615] -- 0:00:59
      78500 -- [-1460.507] (-1458.758) (-1458.554) (-1461.068) * [-1459.927] (-1457.592) (-1457.952) (-1466.426) -- 0:00:58
      79000 -- (-1458.876) [-1459.398] (-1459.652) (-1461.327) * [-1459.532] (-1457.984) (-1457.639) (-1474.878) -- 0:00:58
      79500 -- (-1460.680) (-1460.639) [-1458.042] (-1459.137) * (-1459.690) [-1458.461] (-1459.529) (-1474.063) -- 0:00:57
      80000 -- (-1462.436) [-1459.139] (-1458.221) (-1458.683) * (-1458.954) [-1458.741] (-1458.327) (-1471.950) -- 0:00:57

      Average standard deviation of split frequencies: 0.026144

      80500 -- (-1459.215) (-1460.344) [-1459.085] (-1458.058) * (-1460.465) (-1459.237) [-1458.335] (-1469.433) -- 0:00:57
      81000 -- (-1459.952) (-1459.890) (-1459.585) [-1458.222] * (-1461.696) (-1458.160) [-1458.072] (-1470.723) -- 0:00:56
      81500 -- (-1459.924) [-1460.881] (-1458.422) (-1462.932) * (-1461.254) (-1458.534) (-1459.019) [-1462.741] -- 0:00:56
      82000 -- (-1459.151) (-1461.344) [-1458.864] (-1462.956) * [-1459.388] (-1459.002) (-1461.472) (-1467.370) -- 0:00:55
      82500 -- (-1462.552) (-1465.127) (-1457.831) [-1463.585] * [-1458.599] (-1458.158) (-1462.436) (-1467.764) -- 0:00:55
      83000 -- [-1461.738] (-1461.170) (-1457.845) (-1459.169) * (-1458.014) [-1458.976] (-1457.820) (-1468.297) -- 0:00:55
      83500 -- (-1464.829) (-1459.887) (-1457.844) [-1461.156] * (-1458.621) (-1458.585) (-1459.436) [-1467.013] -- 0:00:54
      84000 -- (-1463.491) [-1457.903] (-1457.723) (-1459.101) * (-1460.656) (-1462.311) [-1459.060] (-1462.954) -- 0:00:54
      84500 -- (-1458.912) [-1458.776] (-1457.732) (-1460.605) * (-1458.887) [-1460.379] (-1457.856) (-1458.798) -- 0:00:54
      85000 -- (-1462.915) (-1458.133) [-1457.722] (-1461.067) * (-1458.963) (-1460.250) [-1461.718] (-1460.007) -- 0:00:53

      Average standard deviation of split frequencies: 0.025165

      85500 -- (-1460.448) (-1457.783) [-1458.290] (-1465.974) * (-1458.960) [-1460.309] (-1460.968) (-1460.007) -- 0:00:53
      86000 -- (-1458.427) (-1457.878) [-1459.163] (-1462.004) * [-1459.712] (-1459.469) (-1461.830) (-1458.535) -- 0:01:03
      86500 -- (-1459.772) [-1459.448] (-1467.859) (-1458.705) * (-1458.209) [-1459.363] (-1458.894) (-1458.012) -- 0:01:03
      87000 -- (-1458.435) (-1459.488) (-1458.641) [-1459.942] * (-1457.750) [-1460.154] (-1459.112) (-1459.853) -- 0:01:02
      87500 -- [-1458.156] (-1459.118) (-1460.033) (-1460.385) * (-1464.309) (-1460.759) (-1458.890) [-1458.189] -- 0:01:02
      88000 -- (-1457.484) (-1457.284) [-1459.785] (-1459.203) * (-1461.625) [-1461.015] (-1461.925) (-1459.764) -- 0:01:02
      88500 -- (-1457.632) [-1457.934] (-1457.366) (-1459.894) * (-1458.953) [-1457.968] (-1463.157) (-1460.452) -- 0:01:01
      89000 -- [-1459.144] (-1459.404) (-1459.180) (-1465.888) * (-1459.588) (-1461.261) (-1462.186) [-1460.476] -- 0:01:01
      89500 -- (-1458.274) (-1461.789) [-1457.712] (-1463.551) * (-1458.913) (-1459.432) [-1458.472] (-1458.862) -- 0:01:01
      90000 -- [-1461.823] (-1461.208) (-1457.984) (-1470.547) * [-1458.584] (-1458.337) (-1460.464) (-1459.828) -- 0:01:00

      Average standard deviation of split frequencies: 0.023521

      90500 -- (-1463.350) (-1457.195) [-1459.681] (-1464.532) * (-1458.555) (-1458.901) (-1458.713) [-1459.023] -- 0:01:00
      91000 -- (-1461.038) (-1457.563) (-1457.853) [-1460.232] * (-1457.924) (-1462.681) (-1458.094) [-1465.479] -- 0:00:59
      91500 -- (-1462.344) (-1458.288) (-1458.193) [-1458.134] * [-1463.172] (-1459.620) (-1458.027) (-1459.289) -- 0:00:59
      92000 -- (-1461.543) (-1458.073) (-1457.588) [-1457.272] * (-1460.851) [-1459.601] (-1458.029) (-1460.614) -- 0:00:59
      92500 -- (-1458.216) (-1457.689) (-1457.575) [-1459.138] * (-1461.493) (-1459.669) [-1459.354] (-1459.786) -- 0:00:58
      93000 -- [-1457.403] (-1457.927) (-1459.587) (-1458.021) * (-1459.700) (-1459.539) (-1458.854) [-1458.337] -- 0:00:58
      93500 -- (-1459.039) [-1458.813] (-1463.100) (-1458.793) * (-1458.723) (-1461.852) [-1459.817] (-1458.367) -- 0:00:58
      94000 -- [-1460.416] (-1461.085) (-1459.133) (-1458.793) * (-1459.643) (-1462.012) [-1459.266] (-1457.662) -- 0:00:57
      94500 -- (-1459.891) [-1460.834] (-1459.545) (-1459.713) * (-1459.363) (-1459.932) [-1457.755] (-1459.027) -- 0:00:57
      95000 -- [-1457.710] (-1459.339) (-1458.099) (-1464.289) * [-1459.360] (-1459.642) (-1457.486) (-1459.350) -- 0:00:57

      Average standard deviation of split frequencies: 0.024318

      95500 -- (-1458.190) (-1458.571) [-1457.406] (-1460.882) * (-1458.446) (-1459.565) (-1459.371) [-1457.872] -- 0:00:56
      96000 -- (-1458.858) (-1458.572) [-1459.560] (-1464.013) * (-1458.535) [-1460.053] (-1460.829) (-1463.189) -- 0:00:56
      96500 -- [-1459.555] (-1458.145) (-1461.930) (-1462.250) * (-1460.375) [-1460.792] (-1462.390) (-1458.897) -- 0:00:56
      97000 -- (-1464.246) (-1461.443) [-1459.800] (-1459.305) * (-1458.878) (-1458.006) (-1460.134) [-1459.097] -- 0:00:55
      97500 -- [-1459.545] (-1462.023) (-1459.542) (-1459.857) * [-1460.410] (-1459.644) (-1460.634) (-1461.561) -- 0:00:55
      98000 -- (-1459.171) (-1461.349) (-1459.088) [-1458.753] * (-1460.510) (-1460.645) [-1462.150] (-1461.263) -- 0:00:55
      98500 -- [-1459.004] (-1459.911) (-1459.895) (-1459.839) * (-1461.498) [-1458.243] (-1463.789) (-1461.492) -- 0:00:54
      99000 -- [-1460.688] (-1460.962) (-1460.591) (-1459.804) * [-1460.522] (-1461.862) (-1458.026) (-1459.036) -- 0:00:54
      99500 -- (-1461.942) (-1462.820) (-1461.689) [-1459.243] * (-1458.539) (-1461.689) (-1458.027) [-1461.825] -- 0:00:54
      100000 -- (-1461.849) (-1462.492) (-1461.488) [-1458.962] * [-1457.226] (-1459.402) (-1458.394) (-1460.884) -- 0:00:54

      Average standard deviation of split frequencies: 0.025198

      100500 -- (-1459.660) (-1461.354) [-1457.970] (-1459.847) * (-1459.880) (-1458.733) (-1459.187) [-1459.446] -- 0:00:53
      101000 -- (-1458.957) [-1460.993] (-1459.012) (-1460.070) * (-1461.360) (-1458.285) [-1458.168] (-1458.907) -- 0:00:53
      101500 -- (-1462.781) [-1460.673] (-1459.970) (-1459.616) * [-1458.240] (-1457.851) (-1462.113) (-1461.077) -- 0:00:53
      102000 -- (-1462.790) (-1460.371) (-1460.950) [-1461.902] * (-1457.687) (-1458.310) (-1459.453) [-1457.506] -- 0:01:01
      102500 -- (-1460.109) [-1460.133] (-1461.244) (-1460.685) * (-1458.025) (-1459.164) [-1457.590] (-1457.165) -- 0:01:01
      103000 -- (-1459.203) [-1458.333] (-1462.423) (-1458.084) * (-1460.087) (-1458.661) [-1457.875] (-1460.156) -- 0:01:00
      103500 -- (-1459.203) [-1458.721] (-1458.717) (-1458.109) * [-1457.213] (-1458.997) (-1457.432) (-1459.739) -- 0:01:00
      104000 -- [-1458.367] (-1462.410) (-1457.471) (-1457.498) * (-1457.353) (-1458.341) (-1457.698) [-1460.984] -- 0:01:00
      104500 -- (-1458.241) (-1458.340) (-1458.224) [-1457.589] * [-1457.364] (-1457.823) (-1458.671) (-1457.877) -- 0:00:59
      105000 -- (-1458.711) [-1458.320] (-1458.446) (-1459.165) * (-1457.620) (-1457.952) (-1459.956) [-1460.397] -- 0:00:59

      Average standard deviation of split frequencies: 0.024943

      105500 -- (-1459.755) (-1459.977) [-1459.118] (-1459.520) * (-1457.743) [-1457.765] (-1460.014) (-1460.397) -- 0:00:59
      106000 -- (-1459.206) [-1458.970] (-1459.701) (-1460.120) * (-1460.102) [-1458.100] (-1458.280) (-1458.685) -- 0:00:59
      106500 -- (-1458.906) (-1459.424) [-1458.403] (-1459.702) * (-1460.271) (-1460.187) (-1459.253) [-1458.353] -- 0:00:58
      107000 -- (-1459.962) [-1461.270] (-1459.226) (-1458.747) * (-1460.028) [-1460.325] (-1463.823) (-1458.637) -- 0:00:58
      107500 -- (-1461.951) (-1460.681) [-1458.781] (-1458.982) * (-1461.627) (-1458.192) [-1458.608] (-1459.463) -- 0:00:58
      108000 -- [-1462.579] (-1465.905) (-1458.252) (-1460.088) * [-1459.446] (-1458.364) (-1460.823) (-1457.414) -- 0:00:57
      108500 -- [-1460.558] (-1460.931) (-1458.147) (-1461.113) * (-1461.620) (-1459.413) (-1459.867) [-1457.425] -- 0:00:57
      109000 -- [-1458.487] (-1461.049) (-1458.404) (-1460.853) * (-1461.333) [-1459.684] (-1460.449) (-1459.724) -- 0:00:57
      109500 -- (-1458.226) [-1458.710] (-1459.503) (-1460.826) * (-1462.397) [-1457.972] (-1458.597) (-1458.806) -- 0:00:56
      110000 -- (-1458.275) [-1458.512] (-1459.935) (-1460.635) * (-1460.586) [-1457.808] (-1460.214) (-1461.890) -- 0:00:56

      Average standard deviation of split frequencies: 0.023815

      110500 -- (-1462.117) [-1458.608] (-1458.114) (-1461.283) * (-1458.096) [-1458.486] (-1459.510) (-1464.252) -- 0:00:56
      111000 -- (-1462.760) (-1458.172) [-1459.600] (-1464.408) * (-1458.464) [-1458.064] (-1459.570) (-1458.730) -- 0:00:56
      111500 -- (-1458.698) (-1459.758) [-1458.397] (-1459.302) * [-1458.428] (-1458.535) (-1458.439) (-1460.416) -- 0:00:55
      112000 -- [-1459.567] (-1461.442) (-1460.033) (-1460.089) * [-1457.855] (-1459.206) (-1459.723) (-1459.766) -- 0:00:55
      112500 -- (-1461.192) [-1459.864] (-1458.872) (-1459.356) * [-1458.837] (-1458.465) (-1458.203) (-1462.897) -- 0:00:55
      113000 -- (-1460.724) (-1461.218) [-1460.711] (-1459.077) * (-1459.627) (-1460.820) [-1458.283] (-1465.362) -- 0:00:54
      113500 -- [-1460.406] (-1462.335) (-1458.320) (-1458.801) * [-1458.532] (-1458.722) (-1458.697) (-1459.856) -- 0:00:54
      114000 -- (-1459.536) [-1458.748] (-1458.090) (-1459.326) * [-1458.063] (-1459.224) (-1457.680) (-1459.756) -- 0:00:54
      114500 -- (-1460.529) (-1459.721) (-1461.656) [-1458.052] * (-1458.018) (-1458.138) [-1457.680] (-1458.561) -- 0:00:54
      115000 -- (-1457.492) (-1458.846) (-1459.883) [-1459.913] * [-1458.022] (-1457.559) (-1457.874) (-1465.480) -- 0:00:53

      Average standard deviation of split frequencies: 0.023275

      115500 -- (-1458.151) [-1458.585] (-1461.182) (-1459.227) * (-1459.310) (-1460.727) [-1458.434] (-1465.797) -- 0:00:53
      116000 -- (-1460.708) (-1457.965) [-1460.101] (-1461.354) * (-1459.443) (-1463.565) [-1457.601] (-1464.568) -- 0:00:53
      116500 -- (-1459.174) [-1460.870] (-1458.934) (-1458.843) * (-1462.296) (-1461.462) (-1458.098) [-1461.491] -- 0:00:53
      117000 -- (-1459.070) (-1459.538) [-1459.490] (-1461.703) * (-1461.413) (-1462.293) (-1458.683) [-1460.023] -- 0:00:52
      117500 -- (-1459.392) (-1460.126) (-1457.689) [-1462.727] * (-1459.032) (-1461.116) [-1457.680] (-1461.642) -- 0:00:52
      118000 -- [-1459.862] (-1461.884) (-1459.487) (-1462.426) * (-1459.765) (-1459.996) [-1458.885] (-1458.561) -- 0:00:59
      118500 -- (-1459.738) [-1458.746] (-1461.974) (-1460.778) * (-1458.930) [-1459.677] (-1458.367) (-1458.520) -- 0:00:59
      119000 -- (-1461.086) (-1462.511) (-1459.622) [-1458.920] * (-1457.885) [-1461.482] (-1459.587) (-1457.790) -- 0:00:59
      119500 -- (-1458.227) (-1461.175) (-1459.937) [-1460.221] * (-1464.685) (-1458.234) (-1461.241) [-1457.831] -- 0:00:58
      120000 -- (-1458.558) [-1461.147] (-1458.973) (-1460.177) * [-1461.255] (-1460.554) (-1459.129) (-1459.167) -- 0:00:58

      Average standard deviation of split frequencies: 0.023626

      120500 -- [-1461.877] (-1460.585) (-1460.744) (-1460.369) * (-1460.844) (-1458.365) [-1458.568] (-1460.236) -- 0:00:58
      121000 -- (-1462.055) (-1458.332) [-1458.976] (-1459.343) * [-1461.253] (-1459.761) (-1460.561) (-1460.971) -- 0:00:58
      121500 -- (-1459.061) (-1458.356) [-1459.666] (-1463.735) * (-1463.121) (-1462.171) (-1460.044) [-1461.603] -- 0:00:57
      122000 -- (-1458.362) [-1458.334] (-1464.272) (-1460.188) * [-1461.356] (-1458.613) (-1460.417) (-1460.735) -- 0:00:57
      122500 -- (-1458.112) (-1458.508) [-1462.540] (-1465.052) * (-1458.959) (-1459.475) [-1461.210] (-1462.142) -- 0:00:57
      123000 -- (-1458.354) [-1458.256] (-1463.921) (-1458.384) * (-1459.038) (-1460.396) (-1460.658) [-1459.469] -- 0:00:57
      123500 -- (-1458.152) [-1458.320] (-1458.817) (-1457.717) * (-1459.400) (-1463.213) (-1461.122) [-1460.536] -- 0:00:56
      124000 -- (-1459.847) (-1459.939) (-1458.966) [-1458.480] * [-1458.829] (-1458.804) (-1463.235) (-1463.160) -- 0:00:56
      124500 -- (-1459.952) [-1460.619] (-1462.666) (-1458.779) * (-1467.107) (-1460.576) [-1460.317] (-1463.293) -- 0:00:56
      125000 -- (-1461.098) (-1460.934) (-1463.439) [-1457.640] * (-1461.208) (-1460.851) (-1460.476) [-1461.826] -- 0:00:56

      Average standard deviation of split frequencies: 0.023298

      125500 -- (-1458.801) (-1460.360) [-1460.349] (-1457.640) * (-1462.565) (-1459.035) [-1463.976] (-1463.815) -- 0:00:55
      126000 -- [-1460.428] (-1461.872) (-1464.469) (-1458.634) * (-1458.642) (-1464.347) [-1457.688] (-1463.286) -- 0:00:55
      126500 -- (-1460.449) [-1460.076] (-1461.613) (-1458.380) * (-1458.642) [-1461.639] (-1458.390) (-1461.232) -- 0:00:55
      127000 -- (-1459.230) [-1459.246] (-1460.467) (-1457.820) * (-1460.728) (-1461.850) (-1457.750) [-1459.319] -- 0:00:54
      127500 -- (-1468.223) (-1462.590) [-1460.403] (-1458.214) * (-1463.312) (-1463.254) (-1459.677) [-1459.772] -- 0:00:54
      128000 -- (-1462.162) (-1458.714) [-1458.552] (-1461.414) * [-1462.310] (-1458.594) (-1458.227) (-1459.570) -- 0:00:54
      128500 -- (-1457.968) [-1459.254] (-1458.514) (-1460.788) * (-1462.712) (-1460.311) [-1458.298] (-1458.421) -- 0:00:54
      129000 -- (-1458.983) (-1459.764) (-1461.221) [-1459.958] * (-1461.217) (-1458.982) [-1459.771] (-1458.512) -- 0:00:54
      129500 -- [-1459.114] (-1458.045) (-1464.708) (-1458.406) * (-1460.604) (-1458.760) [-1458.395] (-1460.351) -- 0:00:53
      130000 -- (-1458.524) (-1462.242) (-1459.561) [-1458.319] * [-1458.305] (-1458.823) (-1458.213) (-1457.759) -- 0:00:53

      Average standard deviation of split frequencies: 0.024713

      130500 -- [-1459.612] (-1461.379) (-1458.453) (-1459.958) * [-1459.340] (-1458.813) (-1458.961) (-1459.413) -- 0:00:53
      131000 -- (-1458.631) (-1459.317) (-1460.447) [-1459.269] * (-1460.549) [-1458.064] (-1461.376) (-1459.071) -- 0:00:53
      131500 -- (-1459.891) [-1461.303] (-1458.186) (-1460.110) * [-1458.412] (-1458.499) (-1458.739) (-1460.380) -- 0:00:52
      132000 -- (-1459.692) [-1462.116] (-1461.905) (-1461.089) * [-1458.596] (-1458.071) (-1458.440) (-1460.300) -- 0:00:52
      132500 -- (-1459.894) (-1459.158) (-1458.358) [-1458.034] * [-1459.189] (-1460.106) (-1458.440) (-1458.021) -- 0:00:52
      133000 -- (-1457.964) [-1457.507] (-1458.808) (-1459.578) * (-1461.345) [-1457.816] (-1458.094) (-1461.295) -- 0:00:52
      133500 -- (-1457.670) (-1458.367) [-1458.163] (-1458.467) * (-1461.000) (-1458.622) [-1459.245] (-1460.440) -- 0:00:51
      134000 -- [-1457.670] (-1457.365) (-1459.466) (-1459.681) * (-1459.096) [-1458.161] (-1458.924) (-1463.526) -- 0:00:58
      134500 -- (-1458.560) (-1459.037) [-1458.559] (-1460.967) * (-1459.413) (-1458.063) (-1459.276) [-1461.325] -- 0:00:57
      135000 -- [-1459.676] (-1458.638) (-1458.004) (-1464.701) * (-1458.097) (-1458.668) [-1459.449] (-1460.427) -- 0:00:57

      Average standard deviation of split frequencies: 0.025130

      135500 -- [-1459.076] (-1459.648) (-1460.572) (-1460.537) * (-1463.734) (-1457.955) [-1460.474] (-1458.583) -- 0:00:57
      136000 -- (-1463.292) (-1459.737) [-1459.333] (-1460.002) * (-1463.775) (-1459.522) [-1458.945] (-1457.643) -- 0:00:57
      136500 -- (-1463.766) (-1458.934) [-1460.675] (-1461.218) * (-1458.102) [-1460.609] (-1461.138) (-1458.153) -- 0:00:56
      137000 -- (-1459.236) [-1462.132] (-1457.774) (-1462.237) * (-1458.590) (-1458.336) (-1458.968) [-1457.784] -- 0:00:56
      137500 -- (-1459.402) [-1458.730] (-1458.407) (-1459.156) * [-1462.416] (-1458.454) (-1461.552) (-1457.617) -- 0:00:56
      138000 -- [-1460.816] (-1466.757) (-1459.264) (-1460.234) * (-1459.118) (-1458.993) (-1463.380) [-1458.326] -- 0:00:56
      138500 -- (-1462.703) (-1470.217) [-1457.884] (-1458.160) * (-1460.575) (-1459.175) (-1457.401) [-1457.880] -- 0:00:55
      139000 -- (-1467.862) (-1459.830) (-1458.013) [-1459.965] * (-1458.683) (-1459.511) (-1459.196) [-1457.885] -- 0:00:55
      139500 -- (-1460.964) (-1458.069) (-1458.014) [-1459.567] * (-1461.330) (-1459.917) [-1458.757] (-1459.586) -- 0:00:55
      140000 -- (-1459.082) (-1458.522) [-1458.001] (-1459.328) * [-1459.157] (-1459.057) (-1459.347) (-1459.409) -- 0:00:55

      Average standard deviation of split frequencies: 0.027868

      140500 -- (-1459.850) (-1458.921) [-1457.994] (-1459.181) * (-1460.998) (-1468.850) [-1458.149] (-1458.525) -- 0:00:55
      141000 -- (-1459.512) (-1459.084) (-1457.905) [-1458.456] * (-1462.067) [-1460.284] (-1458.676) (-1462.515) -- 0:00:54
      141500 -- (-1461.210) (-1458.835) (-1459.044) [-1459.417] * (-1461.048) (-1460.090) [-1458.985] (-1458.195) -- 0:00:54
      142000 -- (-1458.621) (-1459.433) (-1459.883) [-1459.353] * (-1463.621) (-1463.212) [-1459.014] (-1458.166) -- 0:00:54
      142500 -- (-1459.736) (-1459.474) (-1460.345) [-1458.797] * (-1460.952) (-1466.066) [-1458.471] (-1459.684) -- 0:00:54
      143000 -- [-1457.455] (-1460.350) (-1458.747) (-1458.136) * (-1460.686) [-1458.304] (-1458.278) (-1458.160) -- 0:00:53
      143500 -- (-1457.548) [-1459.207] (-1458.586) (-1459.222) * (-1462.028) [-1458.110] (-1458.789) (-1460.021) -- 0:00:53
      144000 -- (-1457.921) (-1458.334) [-1458.945] (-1460.109) * (-1461.050) [-1459.708] (-1460.258) (-1459.663) -- 0:00:53
      144500 -- (-1458.309) (-1459.558) [-1459.794] (-1457.794) * (-1458.570) [-1460.944] (-1459.987) (-1462.082) -- 0:00:53
      145000 -- (-1459.189) (-1460.585) (-1461.442) [-1459.838] * (-1459.495) [-1459.779] (-1460.218) (-1464.751) -- 0:00:53

      Average standard deviation of split frequencies: 0.028040

      145500 -- (-1458.640) (-1461.907) [-1458.695] (-1461.218) * (-1459.109) (-1467.523) [-1460.190] (-1460.898) -- 0:00:52
      146000 -- (-1460.225) [-1459.514] (-1458.940) (-1459.988) * (-1458.133) (-1462.373) (-1459.530) [-1460.629] -- 0:00:52
      146500 -- (-1458.827) (-1461.572) [-1459.562] (-1460.195) * (-1458.131) [-1458.829] (-1459.798) (-1464.741) -- 0:00:52
      147000 -- (-1459.974) (-1459.572) [-1459.911] (-1460.174) * (-1457.422) (-1459.028) [-1459.881] (-1458.814) -- 0:00:52
      147500 -- [-1460.587] (-1461.118) (-1463.377) (-1459.669) * (-1458.971) (-1458.934) (-1461.865) [-1458.277] -- 0:00:52
      148000 -- (-1460.432) [-1459.889] (-1463.342) (-1459.323) * (-1458.416) (-1458.711) [-1459.877] (-1459.197) -- 0:00:51
      148500 -- (-1460.629) (-1459.479) (-1460.924) [-1458.621] * [-1460.298] (-1458.114) (-1458.914) (-1461.117) -- 0:00:51
      149000 -- [-1463.542] (-1460.143) (-1459.819) (-1458.864) * [-1462.436] (-1458.549) (-1457.907) (-1460.424) -- 0:00:51
      149500 -- (-1459.466) (-1459.335) (-1458.546) [-1459.607] * (-1459.745) (-1461.599) [-1457.564] (-1461.460) -- 0:00:51
      150000 -- (-1457.944) (-1463.253) (-1460.092) [-1458.990] * [-1459.862] (-1458.732) (-1457.828) (-1462.329) -- 0:00:56

      Average standard deviation of split frequencies: 0.028982

      150500 -- (-1458.033) [-1459.043] (-1461.098) (-1461.871) * (-1459.904) (-1458.748) (-1458.724) [-1458.537] -- 0:00:56
      151000 -- [-1458.152] (-1460.092) (-1459.571) (-1461.031) * [-1458.281] (-1458.389) (-1458.216) (-1458.985) -- 0:00:56
      151500 -- (-1458.449) (-1460.244) (-1458.806) [-1460.845] * (-1461.673) (-1460.637) [-1458.942] (-1459.555) -- 0:00:56
      152000 -- (-1459.364) [-1459.603] (-1458.932) (-1461.809) * (-1463.621) [-1462.679] (-1457.804) (-1459.629) -- 0:00:55
      152500 -- (-1460.608) (-1457.283) [-1458.585] (-1460.229) * (-1457.562) [-1458.552] (-1457.857) (-1459.428) -- 0:00:55
      153000 -- (-1459.519) (-1458.858) (-1458.826) [-1458.249] * (-1458.796) [-1458.561] (-1461.287) (-1459.431) -- 0:00:55
      153500 -- (-1461.427) (-1459.560) (-1460.804) [-1459.478] * (-1458.999) [-1459.300] (-1458.897) (-1458.997) -- 0:00:55
      154000 -- [-1458.069] (-1464.820) (-1460.661) (-1460.147) * [-1458.130] (-1459.844) (-1458.530) (-1458.818) -- 0:00:54
      154500 -- (-1461.190) [-1461.026] (-1459.598) (-1459.429) * (-1461.654) (-1458.516) (-1458.519) [-1457.498] -- 0:00:54
      155000 -- (-1463.073) [-1461.340] (-1460.570) (-1459.336) * (-1460.992) [-1460.481] (-1459.010) (-1459.352) -- 0:00:54

      Average standard deviation of split frequencies: 0.027515

      155500 -- (-1463.447) (-1458.567) [-1457.941] (-1458.480) * (-1461.263) (-1461.135) [-1462.645] (-1459.890) -- 0:00:54
      156000 -- (-1462.332) (-1459.011) [-1458.919] (-1458.460) * (-1459.735) (-1459.546) (-1464.197) [-1457.923] -- 0:00:54
      156500 -- (-1458.724) [-1459.549] (-1458.062) (-1457.817) * [-1458.697] (-1458.369) (-1462.430) (-1461.489) -- 0:00:53
      157000 -- (-1464.806) [-1459.910] (-1460.077) (-1458.634) * (-1458.462) (-1461.783) (-1459.373) [-1460.526] -- 0:00:53
      157500 -- (-1459.545) [-1459.756] (-1457.901) (-1457.912) * [-1459.723] (-1459.393) (-1461.095) (-1459.286) -- 0:00:53
      158000 -- (-1460.153) (-1459.223) (-1458.488) [-1458.563] * (-1460.222) [-1459.259] (-1461.033) (-1459.955) -- 0:00:53
      158500 -- (-1457.877) [-1458.948] (-1462.057) (-1459.067) * (-1458.716) [-1458.381] (-1462.275) (-1460.361) -- 0:00:53
      159000 -- [-1457.803] (-1458.994) (-1461.355) (-1457.867) * (-1459.508) (-1460.299) [-1461.487] (-1461.143) -- 0:00:52
      159500 -- (-1458.470) (-1461.034) (-1462.667) [-1458.504] * [-1459.664] (-1460.090) (-1459.086) (-1461.722) -- 0:00:52
      160000 -- (-1458.490) [-1459.151] (-1458.163) (-1460.603) * (-1458.131) [-1459.573] (-1457.727) (-1464.338) -- 0:00:52

      Average standard deviation of split frequencies: 0.026569

      160500 -- (-1458.552) (-1459.219) (-1460.683) [-1458.562] * (-1457.925) (-1457.778) (-1457.310) [-1463.291] -- 0:00:52
      161000 -- (-1458.955) [-1459.493] (-1461.944) (-1458.420) * (-1457.509) [-1457.851] (-1457.805) (-1459.831) -- 0:00:52
      161500 -- (-1458.546) (-1459.600) [-1458.936] (-1459.124) * (-1459.934) [-1459.137] (-1460.310) (-1459.439) -- 0:00:51
      162000 -- [-1458.904] (-1458.919) (-1463.255) (-1458.231) * [-1457.504] (-1458.870) (-1460.210) (-1458.124) -- 0:00:51
      162500 -- (-1457.654) (-1461.060) (-1461.573) [-1462.890] * (-1457.515) [-1459.855] (-1458.802) (-1457.914) -- 0:00:51
      163000 -- (-1461.223) [-1460.157] (-1460.358) (-1461.471) * (-1458.513) (-1458.757) [-1459.144] (-1457.868) -- 0:00:51
      163500 -- (-1459.996) (-1461.810) [-1458.283] (-1459.690) * [-1457.717] (-1459.564) (-1464.277) (-1459.079) -- 0:00:51
      164000 -- (-1458.061) (-1463.272) (-1462.396) [-1457.676] * (-1459.168) (-1464.804) [-1461.918] (-1457.820) -- 0:00:50
      164500 -- (-1459.945) (-1459.961) (-1459.799) [-1460.082] * [-1459.870] (-1460.344) (-1462.224) (-1457.853) -- 0:00:50
      165000 -- (-1457.618) (-1462.419) [-1457.567] (-1458.647) * (-1458.529) (-1463.459) (-1460.667) [-1458.293] -- 0:00:50

      Average standard deviation of split frequencies: 0.024362

      165500 -- (-1458.183) [-1460.731] (-1457.198) (-1461.594) * (-1458.241) (-1463.552) (-1459.873) [-1461.103] -- 0:00:50
      166000 -- (-1460.050) [-1457.492] (-1458.369) (-1461.805) * [-1459.540] (-1461.011) (-1460.128) (-1462.884) -- 0:00:55
      166500 -- (-1463.139) (-1461.833) [-1460.033] (-1463.324) * [-1461.489] (-1459.500) (-1457.852) (-1462.784) -- 0:00:55
      167000 -- (-1459.943) [-1457.626] (-1458.976) (-1464.327) * [-1461.015] (-1459.827) (-1460.597) (-1461.491) -- 0:00:54
      167500 -- (-1460.287) [-1458.969] (-1459.018) (-1467.409) * [-1459.599] (-1460.227) (-1459.610) (-1458.860) -- 0:00:54
      168000 -- (-1461.057) [-1457.924] (-1459.608) (-1466.213) * (-1460.828) [-1458.213] (-1458.742) (-1460.052) -- 0:00:54
      168500 -- (-1459.819) (-1458.051) (-1460.493) [-1460.713] * (-1458.259) [-1458.299] (-1458.523) (-1460.095) -- 0:00:54
      169000 -- [-1459.120] (-1457.187) (-1459.722) (-1462.182) * (-1458.418) (-1460.848) [-1460.436] (-1458.114) -- 0:00:54
      169500 -- (-1460.793) (-1458.195) [-1457.660] (-1460.245) * (-1457.977) (-1463.390) [-1462.989] (-1458.514) -- 0:00:53
      170000 -- (-1457.645) (-1457.756) (-1459.593) [-1457.937] * (-1457.854) (-1459.370) [-1459.405] (-1458.526) -- 0:00:53

      Average standard deviation of split frequencies: 0.025780

      170500 -- (-1460.573) (-1458.081) (-1460.231) [-1457.867] * (-1457.700) [-1460.402] (-1460.393) (-1458.652) -- 0:00:53
      171000 -- (-1460.741) (-1459.132) (-1458.041) [-1460.740] * (-1457.783) (-1462.006) (-1460.417) [-1459.184] -- 0:00:53
      171500 -- (-1458.309) (-1460.881) [-1459.194] (-1465.357) * [-1457.569] (-1457.979) (-1460.280) (-1459.314) -- 0:00:53
      172000 -- [-1461.401] (-1460.646) (-1458.314) (-1459.655) * (-1457.366) (-1457.984) (-1461.467) [-1463.184] -- 0:00:52
      172500 -- (-1460.827) [-1460.876] (-1458.332) (-1461.173) * [-1458.031] (-1458.065) (-1460.016) (-1463.836) -- 0:00:52
      173000 -- (-1459.267) (-1461.960) [-1459.108] (-1466.169) * [-1459.238] (-1458.192) (-1461.039) (-1460.084) -- 0:00:52
      173500 -- (-1459.921) (-1461.527) (-1458.912) [-1460.529] * (-1458.401) (-1465.179) [-1459.296] (-1457.773) -- 0:00:52
      174000 -- (-1457.541) (-1458.760) [-1457.726] (-1459.554) * (-1458.452) (-1459.480) (-1460.301) [-1458.033] -- 0:00:52
      174500 -- (-1460.097) [-1458.639] (-1458.138) (-1457.955) * (-1458.283) (-1459.618) (-1464.075) [-1460.596] -- 0:00:52
      175000 -- (-1459.396) (-1459.180) (-1459.354) [-1460.970] * [-1458.588] (-1458.508) (-1461.231) (-1461.330) -- 0:00:51

      Average standard deviation of split frequencies: 0.026487

      175500 -- (-1461.543) (-1459.857) [-1460.617] (-1459.838) * [-1461.092] (-1459.089) (-1461.239) (-1462.184) -- 0:00:51
      176000 -- [-1458.519] (-1457.367) (-1459.886) (-1459.452) * (-1461.063) (-1458.530) [-1459.803] (-1464.603) -- 0:00:51
      176500 -- (-1458.695) [-1457.468] (-1458.556) (-1460.171) * (-1459.913) (-1458.917) [-1457.328] (-1461.368) -- 0:00:51
      177000 -- (-1458.680) [-1458.479] (-1459.607) (-1460.223) * (-1460.770) (-1459.566) (-1457.501) [-1459.559] -- 0:00:51
      177500 -- (-1459.561) (-1458.839) [-1460.702] (-1460.299) * [-1459.028] (-1459.383) (-1457.423) (-1461.628) -- 0:00:50
      178000 -- (-1459.009) (-1459.405) (-1461.468) [-1460.681] * (-1458.524) [-1458.056] (-1459.061) (-1457.715) -- 0:00:50
      178500 -- [-1460.935] (-1458.457) (-1459.059) (-1459.259) * (-1457.742) (-1460.426) [-1460.023] (-1462.411) -- 0:00:50
      179000 -- (-1461.253) [-1462.854] (-1458.523) (-1458.635) * (-1458.100) [-1460.077] (-1457.600) (-1466.406) -- 0:00:50
      179500 -- (-1461.714) [-1462.111] (-1458.158) (-1459.225) * (-1458.498) [-1459.402] (-1457.341) (-1462.610) -- 0:00:50
      180000 -- (-1462.160) [-1460.951] (-1458.735) (-1465.102) * [-1457.660] (-1458.473) (-1457.868) (-1460.432) -- 0:00:50

      Average standard deviation of split frequencies: 0.026672

      180500 -- [-1459.367] (-1463.877) (-1458.721) (-1457.980) * [-1458.653] (-1457.815) (-1457.932) (-1461.567) -- 0:00:49
      181000 -- (-1460.198) [-1459.870] (-1458.187) (-1457.944) * (-1460.676) (-1457.995) (-1458.294) [-1461.364] -- 0:00:49
      181500 -- (-1461.689) (-1459.477) (-1460.726) [-1459.128] * (-1458.095) [-1458.026] (-1464.151) (-1460.459) -- 0:00:54
      182000 -- (-1460.312) (-1460.007) [-1458.712] (-1458.620) * (-1460.319) (-1458.006) [-1460.534] (-1460.518) -- 0:00:53
      182500 -- [-1459.714] (-1459.264) (-1458.017) (-1458.599) * (-1458.342) [-1458.013] (-1460.792) (-1457.886) -- 0:00:53
      183000 -- (-1459.233) (-1458.155) (-1458.823) [-1461.581] * (-1460.107) (-1458.307) [-1458.187] (-1458.465) -- 0:00:53
      183500 -- (-1459.185) [-1459.341] (-1459.903) (-1464.409) * (-1459.605) (-1459.518) (-1461.810) [-1458.632] -- 0:00:53
      184000 -- (-1460.997) [-1458.281] (-1459.207) (-1465.841) * [-1462.262] (-1459.539) (-1461.874) (-1466.440) -- 0:00:53
      184500 -- (-1459.088) (-1458.200) [-1459.591] (-1464.326) * (-1465.431) [-1460.477] (-1460.122) (-1459.180) -- 0:00:53
      185000 -- (-1458.544) [-1458.562] (-1467.026) (-1462.205) * (-1462.863) (-1460.909) [-1459.321] (-1457.865) -- 0:00:52

      Average standard deviation of split frequencies: 0.024500

      185500 -- (-1458.255) (-1457.327) (-1459.138) [-1459.367] * (-1458.923) (-1462.313) (-1460.278) [-1460.693] -- 0:00:52
      186000 -- [-1458.558] (-1458.266) (-1460.431) (-1458.400) * [-1462.782] (-1459.512) (-1461.890) (-1461.324) -- 0:00:52
      186500 -- (-1459.382) (-1459.798) (-1460.472) [-1459.126] * (-1460.985) (-1459.089) [-1459.769] (-1462.819) -- 0:00:52
      187000 -- (-1459.757) (-1458.717) [-1460.889] (-1458.621) * (-1458.387) [-1458.798] (-1460.469) (-1459.228) -- 0:00:52
      187500 -- (-1458.224) (-1459.531) [-1458.105] (-1457.243) * (-1458.471) (-1459.652) [-1460.215] (-1460.870) -- 0:00:52
      188000 -- (-1458.904) [-1458.320] (-1457.564) (-1457.243) * (-1458.873) (-1458.932) (-1460.069) [-1458.532] -- 0:00:51
      188500 -- (-1458.963) (-1459.472) [-1460.910] (-1458.527) * (-1459.691) (-1460.963) (-1459.044) [-1458.688] -- 0:00:51
      189000 -- [-1460.683] (-1460.339) (-1460.163) (-1460.545) * (-1459.172) (-1459.756) (-1458.012) [-1459.756] -- 0:00:51
      189500 -- [-1463.720] (-1459.610) (-1458.258) (-1458.677) * (-1459.197) (-1458.007) (-1462.228) [-1458.342] -- 0:00:51
      190000 -- (-1457.802) (-1459.070) [-1459.491] (-1458.701) * (-1461.225) (-1458.116) (-1462.059) [-1459.186] -- 0:00:51

      Average standard deviation of split frequencies: 0.024724

      190500 -- (-1459.048) (-1459.709) [-1459.450] (-1458.598) * (-1459.130) [-1458.661] (-1460.256) (-1463.077) -- 0:00:50
      191000 -- (-1461.025) (-1459.084) (-1461.199) [-1458.354] * (-1457.523) [-1460.431] (-1460.080) (-1463.039) -- 0:00:50
      191500 -- [-1458.518] (-1460.260) (-1463.386) (-1458.719) * (-1457.825) [-1460.810] (-1461.637) (-1460.043) -- 0:00:50
      192000 -- [-1457.761] (-1461.070) (-1458.309) (-1459.618) * [-1457.641] (-1467.148) (-1459.911) (-1461.244) -- 0:00:50
      192500 -- (-1459.479) [-1459.961] (-1458.174) (-1458.548) * [-1459.286] (-1461.033) (-1461.213) (-1463.043) -- 0:00:50
      193000 -- [-1459.852] (-1457.446) (-1457.816) (-1462.176) * (-1461.285) (-1458.959) [-1459.831] (-1463.584) -- 0:00:50
      193500 -- (-1459.320) (-1458.288) [-1458.622] (-1459.123) * (-1460.300) [-1458.057] (-1460.609) (-1463.259) -- 0:00:50
      194000 -- (-1460.176) (-1460.270) (-1469.953) [-1460.330] * (-1459.867) (-1458.483) [-1458.551] (-1459.288) -- 0:00:49
      194500 -- (-1460.247) [-1458.717] (-1468.996) (-1459.251) * (-1458.379) (-1461.346) [-1458.630] (-1459.972) -- 0:00:49
      195000 -- (-1458.479) [-1457.514] (-1461.196) (-1459.281) * (-1458.206) [-1459.710] (-1458.435) (-1461.735) -- 0:00:49

      Average standard deviation of split frequencies: 0.024318

      195500 -- [-1458.742] (-1458.725) (-1459.998) (-1461.358) * (-1459.749) (-1459.578) [-1458.358] (-1465.708) -- 0:00:49
      196000 -- (-1458.530) [-1458.920] (-1459.425) (-1459.785) * (-1460.055) (-1462.945) [-1458.841] (-1462.206) -- 0:00:49
      196500 -- (-1458.403) [-1458.925] (-1458.874) (-1459.202) * (-1458.949) [-1458.387] (-1458.848) (-1461.391) -- 0:00:49
      197000 -- (-1460.188) (-1459.597) (-1458.813) [-1459.590] * [-1457.990] (-1459.113) (-1458.022) (-1462.372) -- 0:00:48
      197500 -- [-1461.210] (-1461.530) (-1458.993) (-1459.668) * [-1460.946] (-1466.058) (-1458.022) (-1459.440) -- 0:00:52
      198000 -- [-1458.841] (-1459.542) (-1463.386) (-1458.624) * (-1460.214) (-1462.250) [-1458.185] (-1460.176) -- 0:00:52
      198500 -- (-1457.697) (-1463.108) [-1460.255] (-1461.706) * (-1460.795) (-1458.856) [-1457.454] (-1461.239) -- 0:00:52
      199000 -- (-1460.257) [-1462.819] (-1458.319) (-1461.462) * (-1460.703) (-1457.527) [-1457.597] (-1458.665) -- 0:00:52
      199500 -- (-1461.146) (-1460.943) [-1457.771] (-1458.157) * (-1460.252) [-1460.739] (-1460.864) (-1459.581) -- 0:00:52
      200000 -- (-1457.876) (-1460.691) (-1461.500) [-1458.791] * (-1457.260) (-1460.691) (-1459.041) [-1463.329] -- 0:00:51

      Average standard deviation of split frequencies: 0.023100

      200500 -- (-1458.727) (-1464.064) (-1461.761) [-1460.826] * (-1457.292) (-1459.943) [-1458.592] (-1463.830) -- 0:00:51
      201000 -- (-1460.915) (-1461.372) [-1459.532] (-1458.632) * (-1459.404) [-1458.755] (-1458.432) (-1461.032) -- 0:00:51
      201500 -- [-1460.689] (-1464.781) (-1459.653) (-1457.661) * (-1460.074) [-1459.582] (-1459.347) (-1461.646) -- 0:00:51
      202000 -- (-1460.926) (-1457.512) [-1458.326] (-1457.227) * [-1460.712] (-1460.534) (-1468.003) (-1460.129) -- 0:00:51
      202500 -- (-1462.527) (-1460.121) (-1463.834) [-1457.389] * (-1457.804) (-1460.715) [-1459.244] (-1459.641) -- 0:00:51
      203000 -- (-1459.976) (-1457.176) (-1463.190) [-1457.445] * (-1457.892) (-1460.773) (-1459.130) [-1458.060] -- 0:00:51
      203500 -- (-1458.635) (-1458.376) (-1458.234) [-1458.554] * (-1460.403) [-1459.773] (-1459.143) (-1459.215) -- 0:00:50
      204000 -- [-1458.391] (-1458.403) (-1460.683) (-1459.669) * (-1457.950) [-1459.352] (-1459.034) (-1460.868) -- 0:00:50
      204500 -- [-1457.868] (-1458.558) (-1458.242) (-1460.782) * (-1458.605) (-1458.535) [-1458.597] (-1457.771) -- 0:00:50
      205000 -- (-1459.699) (-1461.301) [-1457.852] (-1459.667) * (-1457.933) (-1459.621) (-1458.504) [-1457.933] -- 0:00:50

      Average standard deviation of split frequencies: 0.024155

      205500 -- (-1460.760) (-1461.718) (-1459.048) [-1459.504] * [-1457.888] (-1463.008) (-1458.007) (-1462.464) -- 0:00:50
      206000 -- (-1461.877) (-1461.120) (-1458.009) [-1458.323] * (-1458.455) (-1458.544) (-1461.381) [-1459.564] -- 0:00:50
      206500 -- (-1459.999) (-1460.571) (-1458.261) [-1458.535] * (-1458.376) (-1457.682) (-1457.590) [-1457.781] -- 0:00:49
      207000 -- (-1459.418) (-1458.559) [-1458.881] (-1468.107) * (-1459.542) [-1458.773] (-1458.868) (-1463.971) -- 0:00:49
      207500 -- (-1460.860) (-1457.870) (-1458.188) [-1461.567] * (-1459.913) (-1459.822) [-1458.479] (-1462.206) -- 0:00:49
      208000 -- (-1459.236) (-1459.641) [-1458.188] (-1460.420) * (-1461.132) (-1460.455) (-1457.391) [-1458.224] -- 0:00:49
      208500 -- (-1459.194) [-1460.493] (-1457.904) (-1460.415) * (-1458.650) (-1458.193) (-1457.534) [-1459.789] -- 0:00:49
      209000 -- (-1458.415) (-1459.996) (-1459.202) [-1460.481] * (-1462.879) (-1458.054) (-1457.560) [-1459.539] -- 0:00:49
      209500 -- (-1459.798) (-1459.208) [-1458.868] (-1457.719) * (-1464.744) (-1457.605) (-1463.313) [-1459.323] -- 0:00:49
      210000 -- (-1459.755) (-1461.102) (-1457.657) [-1460.078] * (-1462.974) (-1457.580) (-1460.173) [-1458.692] -- 0:00:48

      Average standard deviation of split frequencies: 0.024242

      210500 -- [-1462.049] (-1463.147) (-1459.689) (-1458.616) * (-1462.505) (-1460.129) [-1458.922] (-1459.191) -- 0:00:48
      211000 -- (-1462.890) (-1466.164) (-1460.432) [-1458.105] * (-1464.645) (-1458.221) (-1459.451) [-1460.384] -- 0:00:48
      211500 -- (-1461.528) (-1460.341) (-1460.576) [-1459.609] * (-1460.576) [-1459.754] (-1459.387) (-1460.998) -- 0:00:48
      212000 -- (-1461.777) (-1460.066) [-1458.049] (-1462.808) * (-1460.867) (-1459.971) (-1459.615) [-1460.532] -- 0:00:48
      212500 -- (-1462.547) (-1462.950) (-1458.080) [-1458.136] * (-1463.922) (-1461.221) [-1458.191] (-1459.678) -- 0:00:48
      213000 -- (-1459.443) [-1461.054] (-1458.099) (-1458.922) * (-1465.208) [-1460.636] (-1460.840) (-1462.271) -- 0:00:48
      213500 -- (-1463.332) [-1459.683] (-1458.642) (-1458.025) * [-1458.458] (-1457.824) (-1462.303) (-1462.173) -- 0:00:51
      214000 -- (-1464.458) (-1460.008) [-1459.867] (-1458.108) * (-1458.934) (-1458.052) [-1461.606] (-1461.061) -- 0:00:51
      214500 -- (-1459.637) (-1459.825) (-1459.343) [-1459.454] * (-1459.299) (-1457.891) [-1462.293] (-1459.468) -- 0:00:51
      215000 -- (-1459.698) (-1459.697) [-1458.855] (-1458.554) * (-1459.029) [-1458.367] (-1459.056) (-1460.917) -- 0:00:51

      Average standard deviation of split frequencies: 0.023400

      215500 -- (-1460.424) (-1458.976) [-1461.381] (-1459.221) * (-1461.510) (-1459.979) (-1461.772) [-1460.062] -- 0:00:50
      216000 -- [-1459.113] (-1458.840) (-1461.118) (-1459.078) * (-1459.813) [-1459.246] (-1464.363) (-1464.191) -- 0:00:50
      216500 -- (-1468.460) (-1460.186) [-1464.329] (-1458.307) * (-1465.708) (-1461.648) [-1459.406] (-1458.794) -- 0:00:50
      217000 -- [-1462.292] (-1459.662) (-1464.107) (-1457.894) * (-1465.720) (-1457.428) (-1459.486) [-1459.400] -- 0:00:50
      217500 -- (-1460.439) (-1459.031) [-1461.761] (-1457.876) * [-1461.432] (-1459.856) (-1458.625) (-1459.100) -- 0:00:50
      218000 -- (-1461.277) (-1459.175) [-1462.880] (-1457.237) * (-1463.587) (-1459.901) [-1458.720] (-1459.711) -- 0:00:50
      218500 -- (-1458.934) (-1458.834) [-1461.932] (-1460.278) * (-1460.292) (-1458.450) (-1459.908) [-1458.873] -- 0:00:50
      219000 -- (-1465.789) [-1459.877] (-1458.233) (-1460.882) * (-1460.451) (-1458.527) (-1460.528) [-1459.554] -- 0:00:49
      219500 -- (-1458.576) (-1458.699) [-1457.955] (-1459.766) * (-1460.203) (-1458.403) [-1457.547] (-1462.350) -- 0:00:49
      220000 -- (-1463.644) (-1459.048) (-1458.043) [-1458.746] * [-1459.551] (-1459.758) (-1458.386) (-1461.267) -- 0:00:49

      Average standard deviation of split frequencies: 0.022075

      220500 -- [-1457.908] (-1459.233) (-1457.980) (-1459.120) * (-1458.178) [-1461.155] (-1458.445) (-1458.195) -- 0:00:49
      221000 -- (-1457.317) (-1459.790) [-1458.067] (-1458.293) * (-1460.886) [-1460.443] (-1457.548) (-1457.724) -- 0:00:49
      221500 -- (-1457.317) (-1459.215) [-1457.530] (-1461.562) * (-1460.164) (-1459.578) (-1457.877) [-1457.325] -- 0:00:49
      222000 -- (-1462.047) (-1459.216) (-1460.980) [-1457.556] * (-1458.693) (-1457.694) (-1459.233) [-1458.204] -- 0:00:49
      222500 -- (-1460.291) (-1460.543) (-1458.182) [-1459.281] * [-1457.893] (-1459.956) (-1461.027) (-1458.530) -- 0:00:48
      223000 -- (-1459.828) (-1461.948) [-1458.183] (-1459.026) * [-1457.758] (-1459.046) (-1463.766) (-1459.576) -- 0:00:48
      223500 -- (-1459.804) (-1457.939) [-1458.463] (-1459.251) * (-1459.062) (-1458.780) (-1462.427) [-1458.736] -- 0:00:48
      224000 -- (-1459.114) [-1457.530] (-1458.676) (-1460.410) * (-1457.896) (-1459.032) (-1468.217) [-1458.234] -- 0:00:48
      224500 -- [-1459.347] (-1458.906) (-1460.695) (-1461.000) * [-1457.900] (-1461.686) (-1458.768) (-1457.741) -- 0:00:48
      225000 -- [-1459.478] (-1457.584) (-1458.930) (-1467.619) * [-1457.803] (-1459.504) (-1457.227) (-1459.566) -- 0:00:48

      Average standard deviation of split frequencies: 0.020511

      225500 -- (-1459.240) [-1457.785] (-1458.971) (-1464.895) * (-1460.259) (-1460.942) [-1460.680] (-1458.645) -- 0:00:48
      226000 -- [-1458.324] (-1459.075) (-1460.516) (-1460.643) * (-1457.303) [-1458.611] (-1460.828) (-1458.966) -- 0:00:47
      226500 -- (-1460.666) [-1457.451] (-1459.676) (-1458.999) * [-1457.674] (-1461.318) (-1458.056) (-1458.568) -- 0:00:47
      227000 -- (-1457.721) (-1461.454) (-1459.641) [-1458.062] * [-1457.518] (-1460.942) (-1457.441) (-1458.675) -- 0:00:47
      227500 -- (-1458.475) (-1460.828) [-1457.954] (-1458.168) * [-1457.919] (-1460.569) (-1458.446) (-1461.213) -- 0:00:47
      228000 -- (-1457.741) (-1459.738) [-1458.147] (-1460.035) * [-1458.167] (-1460.858) (-1457.219) (-1458.656) -- 0:00:47
      228500 -- (-1458.849) (-1460.966) [-1458.926] (-1460.258) * [-1459.031] (-1460.392) (-1460.108) (-1458.769) -- 0:00:47
      229000 -- (-1458.819) (-1460.636) [-1460.363] (-1460.834) * (-1461.671) [-1463.290] (-1457.841) (-1459.501) -- 0:00:47
      229500 -- (-1458.906) [-1459.069] (-1463.309) (-1461.653) * (-1459.516) [-1463.082] (-1457.600) (-1458.941) -- 0:00:50
      230000 -- [-1458.735] (-1459.537) (-1460.955) (-1459.117) * [-1458.429] (-1461.889) (-1458.259) (-1458.717) -- 0:00:50

      Average standard deviation of split frequencies: 0.019301

      230500 -- (-1459.273) [-1457.961] (-1461.150) (-1461.020) * (-1459.465) (-1459.548) (-1460.062) [-1462.071] -- 0:00:50
      231000 -- [-1458.387] (-1458.356) (-1458.872) (-1459.090) * [-1458.534] (-1460.861) (-1461.199) (-1460.185) -- 0:00:49
      231500 -- [-1458.763] (-1458.280) (-1457.539) (-1461.829) * (-1460.191) (-1464.290) (-1460.872) [-1458.359] -- 0:00:49
      232000 -- [-1457.429] (-1458.339) (-1459.027) (-1459.277) * (-1463.674) (-1462.473) [-1459.051] (-1458.753) -- 0:00:49
      232500 -- (-1458.267) [-1459.060] (-1458.180) (-1459.725) * [-1465.105] (-1458.745) (-1459.395) (-1458.662) -- 0:00:49
      233000 -- [-1458.168] (-1458.872) (-1462.045) (-1462.019) * [-1458.846] (-1458.462) (-1458.315) (-1458.662) -- 0:00:49
      233500 -- [-1457.658] (-1457.830) (-1460.967) (-1458.348) * [-1460.508] (-1461.287) (-1457.716) (-1458.180) -- 0:00:49
      234000 -- (-1458.187) [-1457.957] (-1459.142) (-1458.636) * (-1464.950) [-1462.126] (-1458.826) (-1459.073) -- 0:00:49
      234500 -- (-1458.311) [-1457.923] (-1459.804) (-1458.112) * (-1460.996) (-1457.995) [-1459.360] (-1458.690) -- 0:00:48
      235000 -- (-1459.418) (-1460.161) [-1458.835] (-1458.791) * (-1462.010) (-1458.060) (-1459.306) [-1460.819] -- 0:00:48

      Average standard deviation of split frequencies: 0.017977

      235500 -- (-1460.731) (-1460.453) (-1460.589) [-1457.767] * (-1458.617) [-1458.808] (-1458.701) (-1458.737) -- 0:00:48
      236000 -- (-1458.287) [-1463.289] (-1460.326) (-1457.173) * [-1458.991] (-1461.879) (-1459.631) (-1457.472) -- 0:00:48
      236500 -- (-1458.922) [-1461.367] (-1461.539) (-1457.918) * (-1459.267) (-1459.905) [-1458.537] (-1459.947) -- 0:00:48
      237000 -- (-1460.176) (-1462.479) [-1462.624] (-1460.371) * (-1458.323) (-1458.324) [-1459.834] (-1459.658) -- 0:00:48
      237500 -- (-1459.084) (-1467.858) [-1458.647] (-1461.686) * (-1461.030) [-1461.839] (-1460.272) (-1462.355) -- 0:00:48
      238000 -- [-1460.510] (-1465.317) (-1459.673) (-1458.937) * (-1458.993) [-1460.853] (-1461.079) (-1462.440) -- 0:00:48
      238500 -- [-1459.713] (-1462.906) (-1458.392) (-1462.026) * (-1459.887) [-1463.297] (-1460.668) (-1461.986) -- 0:00:47
      239000 -- (-1460.689) (-1459.737) [-1459.665] (-1460.793) * [-1459.840] (-1464.095) (-1458.188) (-1461.672) -- 0:00:47
      239500 -- [-1460.338] (-1463.570) (-1461.171) (-1458.973) * (-1463.438) [-1457.505] (-1461.535) (-1459.436) -- 0:00:47
      240000 -- [-1460.485] (-1462.664) (-1459.480) (-1462.786) * [-1461.075] (-1457.437) (-1460.881) (-1466.318) -- 0:00:47

      Average standard deviation of split frequencies: 0.016976

      240500 -- (-1461.698) [-1458.886] (-1463.708) (-1461.497) * (-1460.400) (-1457.973) [-1457.593] (-1465.768) -- 0:00:47
      241000 -- (-1460.820) (-1459.921) [-1463.425] (-1461.331) * (-1458.154) [-1458.966] (-1462.381) (-1459.289) -- 0:00:47
      241500 -- (-1457.855) [-1458.672] (-1458.171) (-1463.661) * (-1458.766) [-1458.250] (-1466.761) (-1457.921) -- 0:00:47
      242000 -- (-1461.086) (-1459.890) (-1458.768) [-1462.778] * [-1461.649] (-1457.885) (-1467.835) (-1460.867) -- 0:00:46
      242500 -- (-1457.665) (-1461.623) (-1459.786) [-1461.017] * (-1462.073) (-1457.399) (-1467.312) [-1459.978] -- 0:00:46
      243000 -- (-1463.223) (-1461.154) (-1457.827) [-1460.247] * (-1458.980) [-1457.430] (-1462.431) (-1459.602) -- 0:00:46
      243500 -- [-1461.793] (-1462.858) (-1458.961) (-1459.957) * (-1458.338) (-1457.839) (-1461.042) [-1460.362] -- 0:00:46
      244000 -- (-1463.440) (-1463.657) [-1459.716] (-1464.946) * (-1461.157) (-1457.894) (-1460.217) [-1458.305] -- 0:00:46
      244500 -- (-1459.742) (-1465.918) (-1460.874) [-1463.729] * (-1459.021) (-1459.542) [-1459.961] (-1461.127) -- 0:00:46
      245000 -- [-1458.490] (-1464.039) (-1463.791) (-1463.049) * [-1459.013] (-1459.064) (-1459.825) (-1460.674) -- 0:00:49

      Average standard deviation of split frequencies: 0.016608

      245500 -- (-1458.687) (-1459.746) (-1460.142) [-1462.479] * (-1464.828) (-1457.285) (-1460.777) [-1460.985] -- 0:00:49
      246000 -- [-1458.772] (-1459.421) (-1460.836) (-1462.870) * (-1459.015) (-1457.366) [-1459.945] (-1459.891) -- 0:00:49
      246500 -- [-1458.473] (-1459.840) (-1458.101) (-1461.826) * (-1459.040) (-1457.366) (-1461.121) [-1461.887] -- 0:00:48
      247000 -- (-1460.763) [-1460.117] (-1457.507) (-1461.119) * (-1459.855) (-1457.238) [-1460.920] (-1462.343) -- 0:00:48
      247500 -- [-1460.966] (-1460.244) (-1458.663) (-1457.340) * (-1462.627) (-1458.816) (-1460.581) [-1461.651] -- 0:00:48
      248000 -- (-1459.394) (-1459.949) [-1458.702] (-1458.858) * (-1462.029) [-1458.816] (-1460.544) (-1459.859) -- 0:00:48
      248500 -- (-1457.711) (-1458.419) (-1458.702) [-1458.427] * [-1457.723] (-1459.388) (-1460.766) (-1459.060) -- 0:00:48
      249000 -- (-1458.969) (-1457.714) [-1459.138] (-1458.164) * (-1457.633) [-1459.374] (-1460.358) (-1459.060) -- 0:00:48
      249500 -- (-1461.575) (-1460.906) (-1459.305) [-1459.107] * (-1457.985) [-1461.655] (-1459.571) (-1459.730) -- 0:00:48
      250000 -- [-1457.846] (-1459.003) (-1457.272) (-1457.804) * (-1457.846) (-1462.922) (-1461.248) [-1459.299] -- 0:00:48

      Average standard deviation of split frequencies: 0.016194

      250500 -- (-1458.898) (-1458.605) (-1459.609) [-1457.970] * (-1460.681) [-1459.018] (-1459.074) (-1457.420) -- 0:00:47
      251000 -- (-1461.853) (-1458.667) [-1458.464] (-1461.653) * (-1459.821) [-1459.316] (-1458.598) (-1457.991) -- 0:00:47
      251500 -- [-1458.873] (-1459.145) (-1457.931) (-1461.466) * (-1457.767) (-1459.632) [-1459.223] (-1459.516) -- 0:00:47
      252000 -- (-1458.817) (-1459.056) (-1460.816) [-1460.325] * (-1459.701) [-1460.121] (-1459.798) (-1457.453) -- 0:00:47
      252500 -- (-1458.818) (-1459.881) (-1459.204) [-1460.008] * [-1460.728] (-1459.145) (-1462.540) (-1458.154) -- 0:00:47
      253000 -- (-1460.195) [-1459.269] (-1459.192) (-1461.267) * [-1457.742] (-1458.341) (-1461.001) (-1459.690) -- 0:00:47
      253500 -- [-1461.456] (-1459.680) (-1457.272) (-1460.199) * (-1462.298) (-1460.923) [-1458.550] (-1460.392) -- 0:00:47
      254000 -- (-1458.034) (-1459.856) [-1457.272] (-1459.902) * [-1462.497] (-1460.166) (-1459.946) (-1459.738) -- 0:00:46
      254500 -- (-1457.856) (-1459.245) (-1458.538) [-1460.279] * (-1460.328) (-1460.865) [-1459.263] (-1459.967) -- 0:00:46
      255000 -- (-1458.530) (-1463.684) (-1458.743) [-1460.000] * (-1461.284) [-1462.049] (-1458.717) (-1459.983) -- 0:00:46

      Average standard deviation of split frequencies: 0.016471

      255500 -- (-1459.647) [-1462.403] (-1462.143) (-1458.944) * (-1463.646) (-1460.869) (-1457.813) [-1459.521] -- 0:00:46
      256000 -- [-1459.056] (-1461.224) (-1464.143) (-1461.353) * (-1458.757) (-1458.397) [-1457.566] (-1458.685) -- 0:00:46
      256500 -- [-1458.385] (-1459.542) (-1459.090) (-1458.678) * (-1457.823) (-1458.414) [-1459.789] (-1459.412) -- 0:00:46
      257000 -- (-1459.291) (-1461.042) [-1459.989] (-1459.648) * (-1459.723) [-1459.293] (-1459.178) (-1458.612) -- 0:00:46
      257500 -- [-1459.480] (-1461.636) (-1461.775) (-1459.705) * (-1457.718) (-1461.420) (-1463.673) [-1460.394] -- 0:00:46
      258000 -- (-1461.820) (-1463.148) [-1458.375] (-1458.703) * (-1458.750) [-1460.477] (-1461.990) (-1458.005) -- 0:00:46
      258500 -- (-1462.398) (-1463.908) (-1457.525) [-1459.444] * (-1461.240) (-1458.675) (-1460.852) [-1458.074] -- 0:00:45
      259000 -- (-1460.969) (-1459.724) [-1461.387] (-1458.803) * (-1460.999) (-1459.114) (-1460.245) [-1457.981] -- 0:00:45
      259500 -- (-1460.446) (-1459.662) (-1462.327) [-1458.504] * (-1458.780) [-1460.739] (-1457.918) (-1459.747) -- 0:00:45
      260000 -- [-1460.635] (-1460.008) (-1458.952) (-1459.076) * (-1458.257) [-1460.570] (-1457.478) (-1459.430) -- 0:00:45

      Average standard deviation of split frequencies: 0.015472

      260500 -- (-1461.891) (-1458.022) [-1460.720] (-1460.909) * (-1459.477) [-1458.264] (-1459.113) (-1463.610) -- 0:00:48
      261000 -- [-1457.715] (-1457.837) (-1460.426) (-1458.198) * (-1459.271) (-1458.598) [-1458.148] (-1463.041) -- 0:00:48
      261500 -- (-1458.155) (-1458.555) [-1461.750] (-1459.498) * [-1458.214] (-1458.369) (-1460.823) (-1461.600) -- 0:00:48
      262000 -- (-1459.564) (-1460.968) [-1460.316] (-1459.446) * [-1457.396] (-1458.877) (-1461.591) (-1461.132) -- 0:00:47
      262500 -- (-1459.607) [-1462.557] (-1463.416) (-1458.027) * (-1457.763) [-1457.691] (-1462.161) (-1460.234) -- 0:00:47
      263000 -- [-1459.223] (-1465.741) (-1461.085) (-1458.027) * (-1457.898) (-1460.118) (-1465.217) [-1459.997] -- 0:00:47
      263500 -- (-1463.624) (-1463.274) (-1458.795) [-1461.628] * [-1458.252] (-1459.228) (-1460.472) (-1459.322) -- 0:00:47
      264000 -- (-1464.641) (-1461.406) (-1461.156) [-1462.824] * (-1457.851) (-1458.044) [-1460.838] (-1460.186) -- 0:00:47
      264500 -- (-1461.577) (-1461.300) [-1458.359] (-1460.213) * [-1459.737] (-1461.773) (-1461.883) (-1460.895) -- 0:00:47
      265000 -- (-1458.356) [-1463.309] (-1463.436) (-1461.221) * (-1459.915) (-1459.814) (-1461.761) [-1461.107] -- 0:00:47

      Average standard deviation of split frequencies: 0.015950

      265500 -- [-1458.154] (-1459.532) (-1459.015) (-1465.848) * (-1459.752) (-1457.517) [-1461.297] (-1460.121) -- 0:00:47
      266000 -- (-1458.934) [-1459.068] (-1459.077) (-1460.689) * (-1459.012) (-1458.424) (-1459.100) [-1458.738] -- 0:00:46
      266500 -- (-1458.481) [-1461.262] (-1460.144) (-1460.113) * (-1459.012) (-1459.503) (-1459.841) [-1459.194] -- 0:00:46
      267000 -- [-1457.657] (-1458.146) (-1457.629) (-1457.906) * [-1457.794] (-1462.512) (-1458.894) (-1457.995) -- 0:00:46
      267500 -- (-1459.043) [-1461.499] (-1457.341) (-1459.102) * (-1460.177) (-1464.262) (-1458.693) [-1457.733] -- 0:00:46
      268000 -- (-1458.065) [-1460.386] (-1457.251) (-1467.215) * (-1459.646) (-1466.377) (-1459.903) [-1459.735] -- 0:00:46
      268500 -- (-1458.908) (-1463.039) [-1458.038] (-1459.803) * (-1460.947) (-1462.798) [-1459.332] (-1459.290) -- 0:00:46
      269000 -- (-1457.753) (-1459.208) [-1457.805] (-1461.415) * (-1458.064) (-1459.314) [-1458.915] (-1461.393) -- 0:00:46
      269500 -- [-1457.754] (-1459.475) (-1461.531) (-1463.530) * (-1460.636) [-1458.784] (-1457.888) (-1460.895) -- 0:00:46
      270000 -- [-1459.668] (-1460.039) (-1463.442) (-1460.690) * (-1459.227) (-1460.295) [-1459.319] (-1461.034) -- 0:00:45

      Average standard deviation of split frequencies: 0.015578

      270500 -- (-1461.134) (-1457.730) [-1457.781] (-1460.033) * (-1458.987) [-1458.372] (-1459.450) (-1462.698) -- 0:00:45
      271000 -- (-1457.972) (-1459.759) (-1457.781) [-1460.811] * (-1459.535) [-1457.547] (-1462.267) (-1460.185) -- 0:00:45
      271500 -- (-1457.756) [-1458.327] (-1459.715) (-1463.782) * (-1458.289) [-1458.553] (-1463.416) (-1462.126) -- 0:00:45
      272000 -- [-1458.444] (-1459.146) (-1460.963) (-1461.571) * [-1459.921] (-1458.722) (-1463.300) (-1458.477) -- 0:00:45
      272500 -- (-1459.844) (-1459.786) [-1465.061] (-1460.020) * (-1461.370) (-1457.776) [-1460.295] (-1462.785) -- 0:00:45
      273000 -- (-1459.197) (-1458.388) [-1462.837] (-1458.259) * (-1464.821) (-1462.432) [-1458.192] (-1462.991) -- 0:00:45
      273500 -- [-1459.377] (-1460.183) (-1460.860) (-1460.124) * (-1464.778) (-1460.867) [-1457.846] (-1458.971) -- 0:00:45
      274000 -- [-1458.275] (-1459.506) (-1458.998) (-1459.684) * (-1461.460) (-1462.626) [-1459.744] (-1459.112) -- 0:00:45
      274500 -- [-1458.363] (-1459.438) (-1459.904) (-1460.352) * (-1459.825) [-1461.995] (-1458.343) (-1459.843) -- 0:00:44
      275000 -- (-1457.274) [-1458.510] (-1458.381) (-1458.721) * (-1458.065) (-1461.538) (-1460.204) [-1458.439] -- 0:00:44

      Average standard deviation of split frequencies: 0.015941

      275500 -- (-1462.230) [-1458.113] (-1459.331) (-1458.443) * (-1462.629) [-1460.165] (-1461.188) (-1459.026) -- 0:00:44
      276000 -- (-1458.264) [-1460.237] (-1459.029) (-1458.123) * (-1463.292) (-1458.552) (-1459.649) [-1459.846] -- 0:00:44
      276500 -- [-1459.932] (-1459.064) (-1458.363) (-1457.634) * (-1459.213) (-1459.901) (-1459.498) [-1463.221] -- 0:00:47
      277000 -- (-1460.653) [-1458.829] (-1461.666) (-1457.747) * (-1459.175) (-1460.167) [-1458.440] (-1459.592) -- 0:00:46
      277500 -- (-1462.520) [-1458.610] (-1461.525) (-1457.692) * (-1458.252) (-1461.583) (-1459.419) [-1458.944] -- 0:00:46
      278000 -- (-1464.852) (-1459.959) [-1458.859] (-1460.198) * (-1459.330) (-1462.819) (-1460.284) [-1462.379] -- 0:00:46
      278500 -- (-1465.129) [-1458.873] (-1460.793) (-1462.685) * (-1461.059) (-1461.104) (-1459.538) [-1458.783] -- 0:00:46
      279000 -- (-1464.802) (-1461.409) [-1460.934] (-1465.823) * (-1459.361) (-1463.357) [-1463.376] (-1462.852) -- 0:00:46
      279500 -- (-1465.680) (-1462.432) [-1459.271] (-1465.719) * (-1463.039) (-1463.620) (-1461.126) [-1458.386] -- 0:00:46
      280000 -- (-1463.859) (-1460.431) [-1458.456] (-1462.306) * [-1459.592] (-1458.748) (-1460.896) (-1460.724) -- 0:00:46

      Average standard deviation of split frequencies: 0.016143

      280500 -- (-1461.421) (-1459.477) [-1460.947] (-1458.660) * [-1459.708] (-1457.862) (-1460.922) (-1462.213) -- 0:00:46
      281000 -- (-1458.167) (-1458.843) (-1461.381) [-1457.675] * (-1461.536) (-1458.624) (-1460.406) [-1458.652] -- 0:00:46
      281500 -- [-1458.557] (-1458.179) (-1461.342) (-1460.883) * (-1459.840) (-1459.332) [-1459.320] (-1458.688) -- 0:00:45
      282000 -- [-1462.123] (-1459.934) (-1460.708) (-1459.723) * (-1459.763) [-1458.406] (-1458.970) (-1462.644) -- 0:00:45
      282500 -- (-1459.434) [-1461.418] (-1465.498) (-1462.669) * [-1458.549] (-1459.726) (-1458.250) (-1463.734) -- 0:00:45
      283000 -- (-1457.736) (-1459.203) [-1460.967] (-1463.862) * (-1460.385) [-1460.784] (-1462.028) (-1460.567) -- 0:00:45
      283500 -- (-1459.296) [-1458.835] (-1458.489) (-1466.783) * (-1462.214) [-1458.875] (-1461.073) (-1459.924) -- 0:00:45
      284000 -- (-1459.383) [-1457.566] (-1458.738) (-1467.471) * (-1462.530) (-1458.806) [-1460.686] (-1459.867) -- 0:00:45
      284500 -- [-1458.202] (-1460.068) (-1460.290) (-1464.397) * (-1459.844) (-1459.128) (-1460.441) [-1458.859] -- 0:00:45
      285000 -- (-1458.694) (-1460.994) [-1458.941] (-1460.230) * (-1461.012) (-1458.080) [-1459.773] (-1458.441) -- 0:00:45

      Average standard deviation of split frequencies: 0.015109

      285500 -- [-1458.218] (-1458.073) (-1459.348) (-1459.272) * [-1460.202] (-1458.187) (-1457.549) (-1460.612) -- 0:00:45
      286000 -- (-1460.923) (-1458.089) [-1459.197] (-1459.325) * (-1462.194) (-1457.947) (-1458.460) [-1458.553] -- 0:00:44
      286500 -- (-1458.776) [-1457.611] (-1458.213) (-1462.808) * [-1460.904] (-1460.879) (-1458.972) (-1459.207) -- 0:00:44
      287000 -- (-1458.985) (-1457.671) (-1458.118) [-1460.000] * (-1459.762) (-1458.094) [-1459.982] (-1460.161) -- 0:00:44
      287500 -- (-1458.595) (-1458.375) (-1459.235) [-1460.447] * (-1461.438) (-1459.525) (-1460.742) [-1461.837] -- 0:00:44
      288000 -- [-1458.851] (-1458.695) (-1458.441) (-1461.687) * (-1460.801) (-1459.897) [-1459.398] (-1459.622) -- 0:00:44
      288500 -- (-1457.754) [-1461.597] (-1458.353) (-1458.605) * (-1461.215) (-1458.115) [-1460.215] (-1460.212) -- 0:00:44
      289000 -- [-1459.889] (-1460.687) (-1460.653) (-1458.635) * [-1459.312] (-1457.721) (-1461.387) (-1459.662) -- 0:00:44
      289500 -- (-1459.463) (-1458.771) [-1460.885] (-1458.471) * (-1459.881) [-1461.604] (-1462.881) (-1461.216) -- 0:00:44
      290000 -- (-1458.487) (-1458.883) (-1459.939) [-1459.033] * (-1464.100) (-1459.296) (-1468.392) [-1458.389] -- 0:00:44

      Average standard deviation of split frequencies: 0.015677

      290500 -- (-1458.192) [-1459.349] (-1458.140) (-1458.573) * (-1464.905) [-1458.380] (-1460.651) (-1458.420) -- 0:00:43
      291000 -- (-1463.639) (-1460.374) (-1460.896) [-1460.505] * [-1461.081] (-1458.928) (-1458.325) (-1458.286) -- 0:00:43
      291500 -- (-1459.899) (-1458.459) (-1459.012) [-1458.628] * (-1459.073) (-1459.586) [-1458.721] (-1459.536) -- 0:00:43
      292000 -- [-1461.852] (-1457.775) (-1459.708) (-1460.188) * (-1460.154) (-1461.236) [-1458.799] (-1461.007) -- 0:00:43
      292500 -- (-1462.237) (-1457.790) [-1461.524] (-1459.789) * (-1459.057) [-1461.132] (-1458.309) (-1460.645) -- 0:00:45
      293000 -- (-1458.752) (-1462.574) [-1457.127] (-1462.117) * (-1458.447) [-1461.328] (-1459.843) (-1459.448) -- 0:00:45
      293500 -- (-1458.750) [-1459.615] (-1459.053) (-1462.991) * (-1460.226) (-1458.966) [-1458.971] (-1458.226) -- 0:00:45
      294000 -- (-1460.503) [-1458.571] (-1460.031) (-1463.910) * [-1459.328] (-1459.093) (-1458.656) (-1458.859) -- 0:00:45
      294500 -- (-1458.963) (-1458.097) [-1460.066] (-1460.547) * [-1459.292] (-1459.441) (-1459.993) (-1459.479) -- 0:00:45
      295000 -- (-1458.073) [-1461.025] (-1460.946) (-1460.443) * (-1458.070) (-1458.759) [-1457.702] (-1460.826) -- 0:00:45

      Average standard deviation of split frequencies: 0.014599

      295500 -- (-1459.045) (-1459.793) [-1459.932] (-1460.288) * [-1457.964] (-1458.759) (-1458.031) (-1459.145) -- 0:00:45
      296000 -- (-1460.374) (-1459.757) (-1458.924) [-1458.127] * (-1462.119) (-1460.283) (-1457.144) [-1461.059] -- 0:00:45
      296500 -- (-1457.691) (-1462.975) [-1458.662] (-1457.985) * (-1462.441) (-1464.461) (-1457.243) [-1462.426] -- 0:00:45
      297000 -- [-1457.307] (-1459.126) (-1457.289) (-1459.254) * [-1464.653] (-1463.728) (-1459.255) (-1458.073) -- 0:00:44
      297500 -- [-1457.737] (-1458.311) (-1460.464) (-1461.598) * (-1460.898) (-1460.310) [-1459.818] (-1463.113) -- 0:00:44
      298000 -- (-1461.751) [-1458.567] (-1460.588) (-1460.895) * (-1460.779) [-1460.363] (-1459.958) (-1459.149) -- 0:00:44
      298500 -- (-1458.943) (-1458.924) (-1459.346) [-1463.593] * (-1459.117) (-1459.085) (-1459.725) [-1457.655] -- 0:00:44
      299000 -- (-1458.631) (-1460.246) [-1465.534] (-1461.217) * [-1458.539] (-1458.538) (-1459.726) (-1458.276) -- 0:00:44
      299500 -- [-1458.210] (-1457.926) (-1457.741) (-1462.840) * (-1459.685) (-1459.285) [-1459.543] (-1457.707) -- 0:00:44
      300000 -- (-1459.246) (-1459.111) [-1457.120] (-1463.324) * [-1459.265] (-1458.589) (-1463.706) (-1459.139) -- 0:00:44

      Average standard deviation of split frequencies: 0.015069

      300500 -- [-1459.088] (-1459.041) (-1461.222) (-1460.187) * (-1459.902) [-1457.279] (-1458.094) (-1458.190) -- 0:00:44
      301000 -- [-1459.302] (-1458.162) (-1461.044) (-1460.424) * (-1459.411) (-1458.601) [-1458.537] (-1457.624) -- 0:00:44
      301500 -- [-1459.702] (-1457.595) (-1461.881) (-1460.212) * (-1460.198) (-1458.637) [-1457.592] (-1457.555) -- 0:00:44
      302000 -- [-1459.340] (-1457.968) (-1461.841) (-1459.039) * (-1459.830) (-1461.150) [-1457.814] (-1460.102) -- 0:00:43
      302500 -- (-1459.128) (-1457.929) (-1461.270) [-1458.580] * [-1459.911] (-1460.498) (-1459.556) (-1462.245) -- 0:00:43
      303000 -- (-1457.634) (-1463.223) [-1462.371] (-1460.600) * (-1461.268) (-1459.599) [-1460.367] (-1460.705) -- 0:00:43
      303500 -- (-1460.165) (-1465.170) [-1460.183] (-1462.530) * (-1459.589) (-1465.169) (-1458.944) [-1460.153] -- 0:00:43
      304000 -- (-1462.092) (-1469.019) [-1458.853] (-1459.316) * (-1460.455) (-1459.297) (-1458.924) [-1459.882] -- 0:00:43
      304500 -- (-1462.660) [-1459.750] (-1457.470) (-1458.592) * (-1460.523) [-1459.572] (-1459.692) (-1460.178) -- 0:00:43
      305000 -- (-1461.537) (-1457.787) [-1457.991] (-1459.628) * (-1460.676) (-1460.158) (-1458.698) [-1457.900] -- 0:00:43

      Average standard deviation of split frequencies: 0.015833

      305500 -- (-1462.563) (-1458.991) (-1457.992) [-1458.003] * (-1460.436) (-1457.815) [-1459.019] (-1459.503) -- 0:00:43
      306000 -- [-1462.810] (-1457.228) (-1458.097) (-1457.723) * [-1461.009] (-1460.075) (-1459.708) (-1458.844) -- 0:00:43
      306500 -- (-1462.409) (-1459.078) (-1457.911) [-1459.090] * (-1461.068) (-1460.021) [-1459.579] (-1458.588) -- 0:00:42
      307000 -- (-1461.130) [-1458.500] (-1458.504) (-1458.151) * (-1457.641) (-1460.101) [-1460.085] (-1459.157) -- 0:00:42
      307500 -- (-1461.555) [-1460.188] (-1458.516) (-1459.677) * (-1457.786) (-1463.210) [-1457.806] (-1457.862) -- 0:00:42
      308000 -- (-1462.543) [-1457.985] (-1460.953) (-1458.542) * (-1461.788) [-1460.774] (-1459.008) (-1462.034) -- 0:00:44
      308500 -- [-1459.192] (-1457.647) (-1458.248) (-1459.471) * [-1459.924] (-1458.396) (-1460.111) (-1462.797) -- 0:00:44
      309000 -- (-1459.999) (-1457.348) (-1463.992) [-1458.850] * (-1458.691) (-1458.242) (-1459.102) [-1459.446] -- 0:00:44
      309500 -- (-1459.467) (-1457.397) [-1461.228] (-1458.830) * (-1458.641) [-1459.248] (-1458.375) (-1458.915) -- 0:00:44
      310000 -- (-1460.765) [-1458.234] (-1465.626) (-1458.533) * (-1458.802) (-1459.940) [-1458.270] (-1458.543) -- 0:00:44

      Average standard deviation of split frequencies: 0.014615

      310500 -- [-1459.816] (-1458.732) (-1464.512) (-1457.944) * (-1459.497) [-1458.552] (-1459.281) (-1457.776) -- 0:00:44
      311000 -- [-1458.267] (-1458.999) (-1460.015) (-1457.280) * (-1458.085) (-1458.353) [-1458.527] (-1457.921) -- 0:00:44
      311500 -- (-1463.486) (-1461.395) (-1458.353) [-1457.295] * (-1459.299) (-1458.102) [-1458.998] (-1458.650) -- 0:00:44
      312000 -- (-1461.327) (-1458.583) (-1459.259) [-1458.832] * (-1462.085) [-1457.774] (-1459.214) (-1460.555) -- 0:00:44
      312500 -- (-1460.859) (-1458.004) (-1461.176) [-1458.831] * (-1458.716) (-1458.806) (-1458.378) [-1459.391] -- 0:00:44
      313000 -- (-1459.697) (-1460.594) (-1461.392) [-1458.384] * (-1458.728) (-1459.061) [-1458.919] (-1460.171) -- 0:00:43
      313500 -- (-1458.487) (-1460.423) [-1461.670] (-1459.521) * (-1458.853) (-1459.064) [-1458.983] (-1463.704) -- 0:00:43
      314000 -- (-1458.920) [-1461.131] (-1460.605) (-1457.984) * (-1461.137) (-1462.178) [-1459.702] (-1457.621) -- 0:00:43
      314500 -- [-1460.367] (-1462.047) (-1463.274) (-1458.074) * (-1460.204) (-1458.443) [-1459.740] (-1459.363) -- 0:00:43
      315000 -- (-1460.158) [-1459.571] (-1460.140) (-1459.518) * [-1458.240] (-1459.536) (-1458.463) (-1458.911) -- 0:00:43

      Average standard deviation of split frequencies: 0.014338

      315500 -- (-1460.263) [-1459.502] (-1460.120) (-1459.372) * (-1460.014) (-1458.197) (-1458.416) [-1459.049] -- 0:00:43
      316000 -- [-1460.697] (-1458.623) (-1463.153) (-1459.552) * (-1460.627) (-1459.012) [-1458.077] (-1458.436) -- 0:00:43
      316500 -- (-1460.905) (-1458.643) (-1464.252) [-1460.474] * (-1460.778) (-1460.343) (-1458.122) [-1460.119] -- 0:00:43
      317000 -- (-1461.811) (-1458.069) [-1461.383] (-1458.779) * (-1463.154) (-1459.430) [-1458.188] (-1460.426) -- 0:00:43
      317500 -- [-1460.462] (-1457.582) (-1461.980) (-1460.012) * (-1459.804) (-1457.297) [-1462.076] (-1460.002) -- 0:00:42
      318000 -- (-1461.347) [-1457.992] (-1457.624) (-1459.336) * (-1460.165) (-1459.095) [-1458.132] (-1457.879) -- 0:00:42
      318500 -- (-1464.709) (-1458.841) (-1457.531) [-1457.574] * (-1460.672) (-1458.347) [-1459.727] (-1459.799) -- 0:00:42
      319000 -- (-1461.776) (-1458.101) [-1458.617] (-1459.002) * (-1463.612) (-1458.428) (-1459.235) [-1459.000] -- 0:00:42
      319500 -- [-1462.635] (-1457.829) (-1459.781) (-1459.575) * (-1458.257) (-1457.726) [-1458.773] (-1461.628) -- 0:00:42
      320000 -- [-1462.338] (-1458.153) (-1459.936) (-1457.925) * (-1459.497) (-1457.737) [-1460.471] (-1461.478) -- 0:00:42

      Average standard deviation of split frequencies: 0.014701

      320500 -- (-1460.116) (-1458.870) [-1459.923] (-1457.752) * (-1464.970) (-1458.570) (-1461.313) [-1458.683] -- 0:00:42
      321000 -- (-1458.730) [-1461.233] (-1459.248) (-1457.991) * (-1458.511) [-1458.874] (-1462.181) (-1458.702) -- 0:00:42
      321500 -- (-1458.586) (-1458.299) [-1459.287] (-1458.483) * (-1459.323) (-1459.999) [-1459.367] (-1458.939) -- 0:00:42
      322000 -- (-1459.384) [-1458.319] (-1461.020) (-1458.498) * (-1459.610) (-1461.290) (-1458.829) [-1457.300] -- 0:00:42
      322500 -- (-1458.771) (-1460.298) [-1458.751] (-1458.124) * (-1460.415) (-1463.705) (-1460.881) [-1457.637] -- 0:00:42
      323000 -- (-1458.461) [-1458.675] (-1459.084) (-1459.042) * (-1462.226) (-1462.229) (-1463.306) [-1458.411] -- 0:00:41
      323500 -- (-1461.166) [-1458.824] (-1457.716) (-1459.324) * (-1460.780) (-1457.333) (-1457.998) [-1458.522] -- 0:00:41
      324000 -- (-1458.090) (-1459.807) (-1457.508) [-1459.955] * (-1459.755) [-1459.908] (-1457.872) (-1458.442) -- 0:00:43
      324500 -- (-1459.119) (-1459.869) (-1458.733) [-1458.757] * (-1460.080) (-1458.039) (-1458.495) [-1459.464] -- 0:00:43
      325000 -- (-1457.913) [-1460.384] (-1457.949) (-1459.648) * [-1460.274] (-1458.553) (-1458.009) (-1459.619) -- 0:00:43

      Average standard deviation of split frequencies: 0.013577

      325500 -- [-1457.574] (-1457.186) (-1457.756) (-1459.328) * (-1462.287) (-1459.493) (-1458.008) [-1457.752] -- 0:00:43
      326000 -- [-1457.484] (-1462.059) (-1457.361) (-1460.627) * (-1462.303) [-1457.363] (-1458.293) (-1459.335) -- 0:00:43
      326500 -- [-1460.120] (-1462.456) (-1459.635) (-1458.030) * (-1464.100) (-1458.501) (-1458.243) [-1457.742] -- 0:00:43
      327000 -- (-1461.030) (-1467.525) [-1460.569] (-1463.657) * [-1461.256] (-1459.894) (-1458.253) (-1459.673) -- 0:00:43
      327500 -- [-1458.922] (-1460.918) (-1459.083) (-1463.519) * [-1460.875] (-1460.156) (-1464.104) (-1461.248) -- 0:00:43
      328000 -- (-1458.724) (-1461.403) (-1459.978) [-1458.281] * (-1457.879) [-1459.380] (-1459.943) (-1459.933) -- 0:00:43
      328500 -- (-1457.767) [-1459.540] (-1459.042) (-1460.613) * (-1458.351) (-1459.729) [-1458.477] (-1459.238) -- 0:00:42
      329000 -- [-1457.716] (-1458.395) (-1458.182) (-1460.894) * (-1463.447) [-1458.850] (-1460.302) (-1458.156) -- 0:00:42
      329500 -- (-1459.189) [-1457.682] (-1459.037) (-1461.023) * (-1461.080) (-1458.095) (-1459.681) [-1458.110] -- 0:00:42
      330000 -- (-1462.122) [-1458.160] (-1460.275) (-1458.448) * (-1459.723) (-1458.924) (-1458.904) [-1458.280] -- 0:00:42

      Average standard deviation of split frequencies: 0.013543

      330500 -- (-1459.319) [-1460.188] (-1458.779) (-1459.652) * (-1458.999) (-1458.912) (-1457.773) [-1458.303] -- 0:00:42
      331000 -- (-1460.928) (-1457.668) [-1457.860] (-1460.785) * (-1459.255) [-1458.728] (-1466.021) (-1458.558) -- 0:00:42
      331500 -- (-1458.303) (-1458.822) [-1459.097] (-1457.975) * (-1459.601) (-1458.993) (-1460.442) [-1459.002] -- 0:00:42
      332000 -- (-1461.626) [-1458.713] (-1464.864) (-1458.894) * (-1457.210) (-1457.559) (-1460.149) [-1460.512] -- 0:00:42
      332500 -- (-1458.737) [-1457.340] (-1462.785) (-1460.142) * [-1459.739] (-1457.590) (-1461.710) (-1460.409) -- 0:00:42
      333000 -- [-1458.577] (-1457.939) (-1458.992) (-1461.673) * [-1459.745] (-1458.446) (-1462.301) (-1464.003) -- 0:00:42
      333500 -- [-1458.526] (-1460.209) (-1458.750) (-1458.405) * [-1458.631] (-1457.654) (-1462.062) (-1461.051) -- 0:00:41
      334000 -- (-1458.280) [-1458.005] (-1459.129) (-1458.621) * (-1461.469) (-1458.401) (-1458.571) [-1460.419] -- 0:00:41
      334500 -- (-1461.016) (-1459.205) (-1458.908) [-1458.489] * (-1461.956) (-1460.868) [-1458.658] (-1462.468) -- 0:00:41
      335000 -- (-1462.083) (-1458.990) [-1458.349] (-1459.124) * (-1462.246) (-1459.261) [-1457.957] (-1459.641) -- 0:00:41

      Average standard deviation of split frequencies: 0.012861

      335500 -- [-1461.252] (-1457.277) (-1459.874) (-1458.994) * (-1467.180) (-1464.220) [-1460.193] (-1459.205) -- 0:00:41
      336000 -- (-1457.892) (-1457.775) [-1459.307] (-1460.101) * (-1458.690) (-1460.446) (-1458.577) [-1459.857] -- 0:00:41
      336500 -- (-1457.785) (-1458.485) [-1458.441] (-1458.032) * (-1459.144) [-1457.516] (-1458.849) (-1459.431) -- 0:00:41
      337000 -- [-1460.922] (-1459.341) (-1460.314) (-1457.721) * (-1459.105) (-1458.410) (-1458.675) [-1458.834] -- 0:00:41
      337500 -- (-1460.965) (-1460.549) [-1460.238] (-1457.583) * (-1459.080) (-1460.180) [-1458.852] (-1458.932) -- 0:00:41
      338000 -- [-1461.143] (-1459.968) (-1458.084) (-1459.551) * (-1458.168) (-1461.103) (-1458.236) [-1459.300] -- 0:00:41
      338500 -- [-1458.351] (-1457.780) (-1458.531) (-1461.059) * (-1458.463) (-1460.339) (-1460.035) [-1457.634] -- 0:00:41
      339000 -- (-1458.667) (-1458.310) (-1458.501) [-1459.231] * [-1459.430] (-1460.910) (-1457.976) (-1458.308) -- 0:00:40
      339500 -- (-1458.665) [-1458.639] (-1459.247) (-1459.618) * (-1462.791) (-1458.725) [-1457.884] (-1460.560) -- 0:00:40
      340000 -- (-1462.577) [-1458.723] (-1459.493) (-1462.224) * (-1460.778) (-1458.992) [-1457.593] (-1458.452) -- 0:00:42

      Average standard deviation of split frequencies: 0.012992

      340500 -- [-1458.551] (-1460.756) (-1459.403) (-1463.434) * (-1460.649) [-1458.479] (-1457.312) (-1458.360) -- 0:00:42
      341000 -- [-1460.567] (-1460.674) (-1458.679) (-1460.378) * (-1461.182) (-1459.288) (-1457.312) [-1459.160] -- 0:00:42
      341500 -- (-1460.692) (-1457.841) [-1459.047] (-1463.324) * [-1461.645] (-1459.296) (-1458.303) (-1458.650) -- 0:00:42
      342000 -- (-1460.980) [-1457.835] (-1460.007) (-1459.420) * (-1459.102) (-1457.744) (-1459.558) [-1461.569] -- 0:00:42
      342500 -- (-1462.864) (-1457.725) (-1459.518) [-1458.498] * [-1459.566] (-1458.080) (-1464.248) (-1459.822) -- 0:00:42
      343000 -- (-1462.729) (-1458.939) (-1460.796) [-1458.437] * (-1459.753) (-1459.776) (-1461.514) [-1459.736] -- 0:00:42
      343500 -- (-1463.497) (-1460.987) [-1457.162] (-1460.836) * (-1465.469) [-1459.973] (-1459.556) (-1465.725) -- 0:00:42
      344000 -- (-1462.074) (-1465.667) [-1458.035] (-1459.426) * [-1459.257] (-1459.995) (-1459.038) (-1457.998) -- 0:00:41
      344500 -- (-1461.294) (-1464.116) [-1458.961] (-1458.797) * [-1460.172] (-1459.848) (-1459.038) (-1459.094) -- 0:00:41
      345000 -- (-1460.473) (-1459.662) [-1460.348] (-1459.881) * (-1459.961) [-1460.478] (-1463.197) (-1461.964) -- 0:00:41

      Average standard deviation of split frequencies: 0.012565

      345500 -- [-1459.769] (-1461.912) (-1459.939) (-1462.008) * [-1458.552] (-1460.858) (-1462.263) (-1468.264) -- 0:00:41
      346000 -- [-1465.810] (-1462.606) (-1458.522) (-1464.945) * (-1460.217) [-1458.815] (-1460.863) (-1463.797) -- 0:00:41
      346500 -- (-1461.155) [-1458.769] (-1459.102) (-1459.407) * [-1460.040] (-1459.565) (-1458.593) (-1460.502) -- 0:00:41
      347000 -- [-1461.471] (-1459.774) (-1458.234) (-1459.137) * (-1463.846) (-1458.482) [-1458.013] (-1459.395) -- 0:00:41
      347500 -- (-1459.799) (-1458.495) (-1460.865) [-1460.164] * (-1467.649) (-1458.504) [-1457.828] (-1459.510) -- 0:00:41
      348000 -- (-1463.203) [-1463.480] (-1460.886) (-1457.886) * (-1462.049) (-1459.037) [-1458.431] (-1467.239) -- 0:00:41
      348500 -- (-1461.869) (-1459.909) (-1462.540) [-1457.776] * [-1461.167] (-1458.720) (-1461.006) (-1473.507) -- 0:00:41
      349000 -- (-1462.773) [-1458.930] (-1458.176) (-1459.414) * (-1459.025) (-1459.493) (-1461.849) [-1465.722] -- 0:00:41
      349500 -- (-1462.025) [-1458.543] (-1464.575) (-1458.739) * (-1465.773) (-1461.622) [-1460.119] (-1461.162) -- 0:00:40
      350000 -- (-1458.444) [-1458.412] (-1459.343) (-1459.886) * (-1461.364) (-1462.445) [-1458.934] (-1460.945) -- 0:00:40

      Average standard deviation of split frequencies: 0.012622

      350500 -- (-1457.728) (-1457.712) (-1461.252) [-1459.888] * (-1459.970) (-1459.363) (-1460.362) [-1458.737] -- 0:00:40
      351000 -- (-1461.192) [-1459.380] (-1457.334) (-1460.504) * (-1458.532) (-1461.542) (-1461.459) [-1461.101] -- 0:00:40
      351500 -- (-1461.960) [-1457.667] (-1460.309) (-1461.141) * [-1459.556] (-1459.323) (-1457.768) (-1460.796) -- 0:00:40
      352000 -- (-1458.049) [-1457.735] (-1458.722) (-1457.788) * (-1462.713) (-1462.811) [-1458.504] (-1458.997) -- 0:00:40
      352500 -- (-1458.383) (-1457.733) (-1464.086) [-1457.725] * (-1459.532) [-1462.053] (-1458.378) (-1460.165) -- 0:00:40
      353000 -- (-1458.898) (-1458.822) [-1461.184] (-1457.996) * [-1459.351] (-1458.035) (-1461.472) (-1461.831) -- 0:00:40
      353500 -- (-1460.289) (-1461.483) [-1460.759] (-1459.262) * (-1459.368) [-1458.489] (-1458.177) (-1461.550) -- 0:00:40
      354000 -- [-1459.946] (-1460.544) (-1461.328) (-1457.524) * [-1459.469] (-1457.606) (-1458.281) (-1461.167) -- 0:00:40
      354500 -- (-1459.174) [-1460.284] (-1462.894) (-1457.892) * [-1458.859] (-1459.848) (-1462.367) (-1460.089) -- 0:00:40
      355000 -- (-1459.249) [-1459.908] (-1459.757) (-1457.589) * (-1458.763) [-1457.993] (-1460.437) (-1461.362) -- 0:00:39

      Average standard deviation of split frequencies: 0.012432

      355500 -- [-1459.359] (-1460.223) (-1459.064) (-1457.126) * [-1458.722] (-1459.541) (-1459.856) (-1458.632) -- 0:00:39
      356000 -- (-1458.764) (-1459.636) [-1460.129] (-1457.201) * (-1458.198) (-1461.072) [-1460.885] (-1458.612) -- 0:00:41
      356500 -- (-1457.569) (-1459.179) [-1460.519] (-1459.093) * (-1458.181) (-1460.572) [-1457.918] (-1457.969) -- 0:00:41
      357000 -- (-1458.533) (-1459.670) [-1460.190] (-1457.861) * [-1460.202] (-1463.636) (-1458.361) (-1459.654) -- 0:00:41
      357500 -- [-1459.724] (-1459.912) (-1461.920) (-1457.748) * (-1460.174) (-1466.462) (-1461.296) [-1460.385] -- 0:00:41
      358000 -- (-1460.375) (-1460.925) (-1464.032) [-1457.891] * [-1458.293] (-1470.432) (-1459.527) (-1458.227) -- 0:00:41
      358500 -- (-1461.429) (-1458.073) (-1463.568) [-1459.808] * (-1458.755) [-1461.969] (-1462.472) (-1458.581) -- 0:00:41
      359000 -- (-1460.607) (-1460.058) (-1460.366) [-1457.759] * (-1459.258) (-1462.639) (-1463.842) [-1460.574] -- 0:00:41
      359500 -- (-1463.813) (-1459.040) (-1461.898) [-1458.197] * [-1457.443] (-1465.665) (-1460.385) (-1458.483) -- 0:00:40
      360000 -- [-1458.054] (-1457.577) (-1460.710) (-1458.078) * (-1458.854) [-1461.268] (-1462.469) (-1458.237) -- 0:00:40

      Average standard deviation of split frequencies: 0.012489

      360500 -- (-1459.703) [-1457.618] (-1460.773) (-1459.552) * (-1457.897) (-1459.745) (-1460.970) [-1458.288] -- 0:00:40
      361000 -- (-1461.831) (-1460.495) [-1461.105] (-1459.410) * [-1459.359] (-1459.954) (-1460.413) (-1458.380) -- 0:00:40
      361500 -- [-1461.689] (-1465.595) (-1459.005) (-1459.052) * (-1458.076) (-1459.027) (-1459.497) [-1460.480] -- 0:00:40
      362000 -- (-1460.013) [-1460.074] (-1462.126) (-1460.045) * [-1458.076] (-1461.919) (-1459.553) (-1459.945) -- 0:00:40
      362500 -- [-1459.353] (-1459.337) (-1458.983) (-1459.470) * [-1458.080] (-1462.611) (-1459.182) (-1461.144) -- 0:00:40
      363000 -- (-1462.683) (-1458.087) [-1458.635] (-1459.440) * (-1457.938) (-1462.291) [-1459.236] (-1460.389) -- 0:00:40
      363500 -- (-1461.211) (-1460.249) (-1460.792) [-1459.686] * (-1459.005) (-1467.647) (-1458.033) [-1459.602] -- 0:00:40
      364000 -- (-1457.841) (-1463.038) (-1459.238) [-1458.842] * (-1464.488) [-1461.098] (-1458.877) (-1459.697) -- 0:00:40
      364500 -- [-1458.258] (-1458.065) (-1458.604) (-1460.978) * (-1464.488) (-1461.117) [-1463.365] (-1461.364) -- 0:00:40
      365000 -- (-1457.804) (-1458.071) (-1461.084) [-1457.785] * (-1459.349) (-1460.818) [-1459.219] (-1458.013) -- 0:00:40

      Average standard deviation of split frequencies: 0.011234

      365500 -- (-1458.024) (-1458.577) (-1460.912) [-1458.813] * (-1459.396) (-1460.402) [-1459.664] (-1457.933) -- 0:00:39
      366000 -- [-1457.903] (-1457.924) (-1459.151) (-1459.717) * (-1459.249) (-1458.383) [-1459.113] (-1460.079) -- 0:00:39
      366500 -- (-1458.330) [-1459.826] (-1458.114) (-1462.338) * (-1462.034) [-1458.611] (-1458.029) (-1460.170) -- 0:00:39
      367000 -- (-1463.656) [-1460.374] (-1459.482) (-1459.343) * (-1460.853) (-1459.113) [-1458.399] (-1462.740) -- 0:00:39
      367500 -- (-1458.951) (-1461.589) (-1460.055) [-1459.400] * (-1459.315) [-1460.175] (-1458.915) (-1458.773) -- 0:00:39
      368000 -- [-1458.148] (-1463.534) (-1462.980) (-1458.081) * [-1458.050] (-1458.679) (-1459.935) (-1461.048) -- 0:00:39
      368500 -- (-1461.646) (-1461.616) [-1458.895] (-1458.380) * (-1458.319) [-1457.552] (-1461.086) (-1459.735) -- 0:00:39
      369000 -- (-1462.529) (-1458.647) (-1460.806) [-1461.012] * [-1459.158] (-1458.738) (-1460.613) (-1458.889) -- 0:00:39
      369500 -- (-1460.150) (-1458.868) [-1458.244] (-1458.058) * (-1460.979) (-1460.390) [-1460.508] (-1460.925) -- 0:00:39
      370000 -- [-1460.792] (-1458.704) (-1458.784) (-1462.993) * (-1460.261) (-1459.416) (-1463.147) [-1459.053] -- 0:00:39

      Average standard deviation of split frequencies: 0.011375

      370500 -- [-1458.458] (-1458.729) (-1459.647) (-1462.417) * (-1458.712) (-1457.746) (-1461.595) [-1457.346] -- 0:00:39
      371000 -- (-1458.887) (-1458.419) [-1459.964] (-1463.034) * (-1457.974) (-1459.884) [-1457.334] (-1457.271) -- 0:00:38
      371500 -- (-1459.266) [-1458.792] (-1460.380) (-1458.264) * [-1459.400] (-1458.723) (-1458.108) (-1458.103) -- 0:00:40
      372000 -- (-1457.964) (-1458.669) (-1460.702) [-1458.724] * (-1459.583) [-1459.185] (-1458.107) (-1459.161) -- 0:00:40
      372500 -- (-1457.428) (-1459.730) (-1459.568) [-1458.038] * [-1459.921] (-1459.511) (-1457.811) (-1458.415) -- 0:00:40
      373000 -- (-1460.204) [-1458.539] (-1458.626) (-1457.781) * (-1461.363) [-1460.316] (-1459.580) (-1457.914) -- 0:00:40
      373500 -- (-1458.182) (-1458.713) (-1458.697) [-1457.730] * (-1458.401) [-1462.233] (-1462.912) (-1458.602) -- 0:00:40
      374000 -- (-1463.991) (-1458.219) [-1459.150] (-1459.373) * (-1460.377) (-1460.124) [-1458.716] (-1463.952) -- 0:00:40
      374500 -- (-1465.972) (-1458.457) (-1460.401) [-1459.309] * (-1460.267) (-1460.106) (-1459.669) [-1460.863] -- 0:00:40
      375000 -- (-1461.429) (-1460.729) [-1459.780] (-1463.442) * (-1461.213) [-1458.838] (-1459.310) (-1458.740) -- 0:00:40

      Average standard deviation of split frequencies: 0.011075

      375500 -- (-1459.954) (-1460.823) (-1459.275) [-1459.781] * [-1459.849] (-1460.046) (-1458.635) (-1460.692) -- 0:00:39
      376000 -- (-1458.377) [-1458.171] (-1459.006) (-1457.557) * (-1460.916) [-1458.985] (-1458.860) (-1463.662) -- 0:00:39
      376500 -- (-1457.258) [-1458.890] (-1458.780) (-1457.538) * (-1459.599) [-1457.404] (-1460.981) (-1465.459) -- 0:00:39
      377000 -- (-1457.748) (-1460.317) (-1458.732) [-1458.669] * (-1459.301) [-1461.109] (-1458.909) (-1460.116) -- 0:00:39
      377500 -- [-1458.634] (-1459.630) (-1457.684) (-1462.962) * (-1461.106) [-1460.309] (-1459.056) (-1459.209) -- 0:00:39
      378000 -- (-1466.176) [-1459.751] (-1460.218) (-1460.963) * [-1459.489] (-1461.534) (-1461.867) (-1460.123) -- 0:00:39
      378500 -- (-1460.734) (-1462.162) (-1459.833) [-1465.807] * [-1463.616] (-1459.252) (-1457.913) (-1459.458) -- 0:00:39
      379000 -- (-1458.831) [-1458.668] (-1457.484) (-1459.539) * (-1460.540) (-1459.885) [-1458.876] (-1458.760) -- 0:00:39
      379500 -- (-1458.280) (-1458.535) (-1458.321) [-1459.541] * (-1460.478) [-1461.554] (-1457.301) (-1459.159) -- 0:00:39
      380000 -- (-1459.496) [-1460.465] (-1465.912) (-1458.344) * (-1458.792) (-1460.633) [-1458.064] (-1458.536) -- 0:00:39

      Average standard deviation of split frequencies: 0.011377

      380500 -- (-1458.358) (-1460.934) (-1459.994) [-1459.569] * (-1459.327) [-1460.707] (-1458.760) (-1461.014) -- 0:00:39
      381000 -- (-1459.144) (-1458.572) (-1461.522) [-1458.523] * (-1459.658) (-1461.469) (-1461.546) [-1458.766] -- 0:00:38
      381500 -- (-1459.560) [-1458.524] (-1459.106) (-1458.639) * (-1463.888) (-1461.360) [-1460.825] (-1457.753) -- 0:00:38
      382000 -- (-1459.879) (-1458.468) (-1460.423) [-1458.398] * (-1458.295) (-1463.062) (-1461.083) [-1458.471] -- 0:00:38
      382500 -- [-1458.712] (-1459.849) (-1459.247) (-1460.381) * [-1460.558] (-1462.672) (-1461.309) (-1457.973) -- 0:00:38
      383000 -- (-1458.499) (-1460.968) (-1458.255) [-1457.299] * (-1459.927) (-1457.592) [-1459.010] (-1461.391) -- 0:00:38
      383500 -- [-1460.045] (-1459.487) (-1458.830) (-1459.268) * (-1459.040) [-1458.882] (-1461.437) (-1459.458) -- 0:00:38
      384000 -- (-1458.180) [-1459.781] (-1461.429) (-1462.626) * (-1458.619) (-1460.420) [-1458.626] (-1458.283) -- 0:00:38
      384500 -- [-1458.867] (-1461.215) (-1458.119) (-1460.418) * (-1458.551) (-1459.190) (-1459.867) [-1458.199] -- 0:00:38
      385000 -- (-1458.627) (-1462.448) (-1459.116) [-1459.578] * (-1464.109) (-1458.446) (-1462.484) [-1457.535] -- 0:00:38

      Average standard deviation of split frequencies: 0.010919

      385500 -- (-1460.912) (-1461.237) [-1458.080] (-1459.346) * [-1460.055] (-1459.038) (-1466.211) (-1462.930) -- 0:00:38
      386000 -- (-1466.308) (-1460.956) (-1458.049) [-1457.963] * (-1459.257) (-1462.727) [-1459.028] (-1461.311) -- 0:00:38
      386500 -- [-1459.589] (-1459.339) (-1458.590) (-1458.224) * (-1458.573) [-1459.712] (-1460.430) (-1458.952) -- 0:00:38
      387000 -- (-1459.376) [-1458.809] (-1461.139) (-1457.545) * (-1459.426) (-1457.225) [-1461.164] (-1458.463) -- 0:00:38
      387500 -- (-1460.015) (-1461.611) (-1460.593) [-1458.648] * (-1460.816) (-1457.606) [-1457.555] (-1458.713) -- 0:00:39
      388000 -- (-1460.793) (-1458.275) (-1464.481) [-1459.083] * (-1459.181) (-1459.564) [-1458.754] (-1458.491) -- 0:00:39
      388500 -- (-1459.461) [-1458.083] (-1462.760) (-1458.590) * [-1457.806] (-1461.847) (-1458.440) (-1458.492) -- 0:00:39
      389000 -- (-1463.022) [-1458.852] (-1460.304) (-1460.794) * (-1465.404) [-1458.590] (-1458.930) (-1458.993) -- 0:00:39
      389500 -- [-1462.682] (-1459.786) (-1461.413) (-1458.677) * (-1461.581) (-1458.551) [-1457.641] (-1460.732) -- 0:00:39
      390000 -- (-1462.595) (-1458.874) [-1457.670] (-1458.492) * (-1461.732) (-1461.457) (-1462.841) [-1458.367] -- 0:00:39

      Average standard deviation of split frequencies: 0.010150

      390500 -- [-1461.516] (-1458.924) (-1459.833) (-1460.972) * (-1459.620) (-1459.939) (-1458.767) [-1458.831] -- 0:00:39
      391000 -- (-1461.845) [-1459.826] (-1460.162) (-1458.136) * [-1465.251] (-1461.189) (-1458.246) (-1460.327) -- 0:00:38
      391500 -- (-1463.983) (-1459.825) [-1458.135] (-1460.609) * (-1458.627) [-1459.096] (-1461.424) (-1462.141) -- 0:00:38
      392000 -- (-1458.549) [-1458.157] (-1461.795) (-1461.249) * (-1458.097) [-1459.884] (-1460.081) (-1459.946) -- 0:00:38
      392500 -- (-1462.887) (-1460.560) (-1461.632) [-1458.840] * (-1461.102) [-1461.079] (-1458.148) (-1458.587) -- 0:00:38
      393000 -- (-1460.878) (-1458.429) (-1457.564) [-1458.701] * (-1458.244) [-1458.943] (-1458.827) (-1458.828) -- 0:00:38
      393500 -- (-1460.767) (-1459.483) (-1461.007) [-1461.230] * [-1458.380] (-1459.539) (-1459.070) (-1461.782) -- 0:00:38
      394000 -- (-1460.630) (-1459.551) (-1458.656) [-1458.030] * (-1458.350) (-1458.542) (-1459.156) [-1465.476] -- 0:00:38
      394500 -- (-1459.653) (-1459.844) [-1458.763] (-1462.226) * (-1458.757) (-1457.810) [-1458.890] (-1462.133) -- 0:00:38
      395000 -- (-1458.719) [-1460.621] (-1457.794) (-1461.108) * (-1459.058) (-1457.604) [-1457.411] (-1458.047) -- 0:00:38

      Average standard deviation of split frequencies: 0.009375

      395500 -- (-1461.661) (-1463.963) (-1460.688) [-1460.131] * (-1459.102) [-1457.695] (-1457.479) (-1458.178) -- 0:00:38
      396000 -- (-1462.959) [-1458.979] (-1462.877) (-1464.210) * (-1461.484) [-1457.901] (-1459.081) (-1459.732) -- 0:00:38
      396500 -- (-1464.873) (-1461.011) [-1459.098] (-1460.424) * (-1460.112) (-1457.928) [-1459.386] (-1460.128) -- 0:00:38
      397000 -- (-1460.486) (-1464.337) (-1457.434) [-1459.495] * (-1458.391) (-1461.164) (-1459.093) [-1459.208] -- 0:00:37
      397500 -- (-1459.958) (-1460.822) [-1458.732] (-1460.666) * (-1458.814) (-1458.058) [-1460.224] (-1461.856) -- 0:00:37
      398000 -- (-1460.489) (-1462.067) [-1457.862] (-1460.217) * (-1459.670) (-1458.541) [-1458.372] (-1460.609) -- 0:00:37
      398500 -- (-1459.172) [-1460.062] (-1459.306) (-1458.716) * (-1459.466) [-1457.965] (-1458.886) (-1461.665) -- 0:00:37
      399000 -- (-1460.723) (-1462.333) [-1459.304] (-1457.863) * (-1460.603) (-1459.127) [-1459.633] (-1465.838) -- 0:00:37
      399500 -- (-1459.015) (-1458.566) [-1461.777] (-1457.832) * (-1458.365) [-1460.077] (-1461.942) (-1465.691) -- 0:00:37
      400000 -- (-1458.386) (-1459.095) (-1460.463) [-1458.573] * (-1458.518) [-1462.764] (-1459.304) (-1461.307) -- 0:00:37

      Average standard deviation of split frequencies: 0.009412

      400500 -- (-1459.748) (-1459.587) [-1459.656] (-1458.638) * [-1459.831] (-1458.768) (-1458.051) (-1461.860) -- 0:00:37
      401000 -- (-1460.689) (-1460.093) (-1461.053) [-1459.876] * (-1460.776) (-1458.812) [-1458.563] (-1459.215) -- 0:00:37
      401500 -- (-1459.586) [-1459.844] (-1459.822) (-1459.522) * (-1461.350) [-1458.952] (-1458.402) (-1458.741) -- 0:00:37
      402000 -- (-1459.976) (-1463.765) (-1459.034) [-1457.491] * [-1458.120] (-1459.105) (-1461.281) (-1459.033) -- 0:00:37
      402500 -- (-1464.028) (-1462.406) (-1460.858) [-1459.480] * (-1459.430) [-1465.097] (-1459.863) (-1461.302) -- 0:00:37
      403000 -- (-1460.778) (-1462.561) [-1458.700] (-1458.370) * (-1458.506) (-1459.967) [-1459.023] (-1460.347) -- 0:00:37
      403500 -- [-1457.798] (-1460.800) (-1460.164) (-1459.299) * (-1457.723) (-1459.946) [-1459.108] (-1461.507) -- 0:00:38
      404000 -- (-1459.571) (-1457.633) (-1462.459) [-1459.019] * (-1457.737) (-1457.707) [-1457.391] (-1459.928) -- 0:00:38
      404500 -- (-1459.218) [-1459.198] (-1459.894) (-1459.794) * (-1457.557) (-1458.189) [-1457.985] (-1458.650) -- 0:00:38
      405000 -- (-1458.010) [-1460.309] (-1458.595) (-1459.729) * (-1458.649) (-1458.331) (-1457.775) [-1460.885] -- 0:00:38

      Average standard deviation of split frequencies: 0.009652

      405500 -- (-1457.459) (-1461.202) [-1457.485] (-1460.314) * (-1459.320) (-1459.025) [-1457.591] (-1459.436) -- 0:00:38
      406000 -- [-1457.459] (-1458.616) (-1458.167) (-1459.681) * (-1457.958) (-1457.910) (-1466.269) [-1457.798] -- 0:00:38
      406500 -- (-1458.657) [-1459.043] (-1460.603) (-1460.240) * (-1457.822) (-1459.890) [-1459.120] (-1459.474) -- 0:00:37
      407000 -- (-1458.076) [-1459.041] (-1462.482) (-1460.142) * [-1458.675] (-1462.471) (-1457.901) (-1460.885) -- 0:00:37
      407500 -- (-1462.285) (-1458.755) (-1459.963) [-1460.830] * (-1458.397) [-1461.221] (-1458.198) (-1459.381) -- 0:00:37
      408000 -- [-1460.194] (-1458.902) (-1458.203) (-1460.151) * (-1459.506) (-1463.160) (-1458.110) [-1459.866] -- 0:00:37
      408500 -- [-1459.781] (-1460.556) (-1459.736) (-1458.188) * (-1460.403) [-1460.149] (-1461.049) (-1459.094) -- 0:00:37
      409000 -- (-1460.534) (-1458.995) (-1461.428) [-1460.990] * (-1459.088) [-1458.805] (-1462.678) (-1462.738) -- 0:00:37
      409500 -- (-1458.331) (-1460.664) [-1459.446] (-1460.049) * [-1460.527] (-1458.622) (-1461.878) (-1461.585) -- 0:00:37
      410000 -- [-1459.696] (-1461.551) (-1463.299) (-1459.297) * [-1458.536] (-1459.330) (-1463.963) (-1461.881) -- 0:00:37

      Average standard deviation of split frequencies: 0.009040

      410500 -- (-1459.142) [-1457.788] (-1464.751) (-1459.175) * (-1457.727) [-1459.423] (-1457.865) (-1460.069) -- 0:00:37
      411000 -- (-1463.029) (-1458.555) [-1464.176] (-1459.310) * [-1458.772] (-1460.149) (-1460.763) (-1460.069) -- 0:00:37
      411500 -- (-1463.029) [-1458.090] (-1460.115) (-1459.798) * (-1461.227) [-1460.825] (-1460.889) (-1458.178) -- 0:00:37
      412000 -- (-1460.865) (-1458.663) [-1461.646] (-1460.129) * (-1459.865) (-1460.268) [-1459.632] (-1463.255) -- 0:00:37
      412500 -- [-1463.471] (-1458.335) (-1459.595) (-1461.921) * [-1460.126] (-1467.655) (-1466.608) (-1458.493) -- 0:00:37
      413000 -- (-1462.406) [-1458.185] (-1459.186) (-1457.787) * (-1459.248) [-1460.802] (-1462.514) (-1457.686) -- 0:00:36
      413500 -- (-1457.751) (-1459.955) [-1459.046] (-1458.692) * (-1460.519) [-1460.867] (-1457.329) (-1457.564) -- 0:00:36
      414000 -- (-1458.183) (-1457.433) [-1458.409] (-1457.964) * (-1458.262) (-1459.197) [-1457.502] (-1459.258) -- 0:00:36
      414500 -- [-1458.517] (-1457.502) (-1458.783) (-1457.573) * (-1458.309) [-1458.805] (-1457.295) (-1459.954) -- 0:00:36
      415000 -- (-1457.293) (-1458.412) (-1457.429) [-1460.154] * [-1463.156] (-1461.000) (-1463.114) (-1459.465) -- 0:00:36

      Average standard deviation of split frequencies: 0.008782

      415500 -- (-1458.116) (-1458.624) [-1457.919] (-1459.927) * (-1463.307) (-1457.906) [-1460.237] (-1457.925) -- 0:00:36
      416000 -- (-1457.803) (-1459.425) [-1458.463] (-1460.567) * (-1459.655) [-1458.596] (-1458.226) (-1459.353) -- 0:00:36
      416500 -- [-1459.107] (-1457.344) (-1460.674) (-1460.868) * (-1461.911) [-1457.661] (-1462.608) (-1460.401) -- 0:00:36
      417000 -- (-1462.582) [-1457.640] (-1459.782) (-1460.830) * [-1459.902] (-1458.506) (-1461.237) (-1460.587) -- 0:00:36
      417500 -- (-1460.802) [-1457.798] (-1461.430) (-1462.720) * [-1461.205] (-1461.939) (-1462.030) (-1463.352) -- 0:00:36
      418000 -- (-1460.403) [-1457.926] (-1458.002) (-1462.424) * [-1460.266] (-1461.645) (-1461.657) (-1461.348) -- 0:00:36
      418500 -- (-1459.958) (-1458.603) (-1459.131) [-1459.538] * (-1458.319) [-1460.954] (-1465.882) (-1459.606) -- 0:00:36
      419000 -- (-1461.110) (-1458.068) (-1458.913) [-1459.060] * [-1457.437] (-1462.057) (-1461.189) (-1458.966) -- 0:00:36
      419500 -- (-1461.268) [-1458.730] (-1459.337) (-1459.283) * (-1461.308) (-1462.986) (-1459.487) [-1460.556] -- 0:00:37
      420000 -- [-1461.122] (-1458.032) (-1459.254) (-1460.841) * (-1459.008) [-1463.665] (-1459.302) (-1460.588) -- 0:00:37

      Average standard deviation of split frequencies: 0.008825

      420500 -- (-1460.692) (-1458.295) [-1459.587] (-1460.980) * (-1461.900) (-1462.817) (-1459.321) [-1459.869] -- 0:00:37
      421000 -- (-1459.089) (-1457.952) (-1460.467) [-1458.007] * (-1461.061) (-1464.085) [-1461.684] (-1459.358) -- 0:00:37
      421500 -- (-1459.031) (-1458.294) (-1459.825) [-1457.948] * [-1463.247] (-1464.257) (-1460.769) (-1459.396) -- 0:00:37
      422000 -- (-1461.980) (-1458.924) (-1461.846) [-1458.033] * (-1462.053) (-1463.277) [-1460.253] (-1459.555) -- 0:00:36
      422500 -- (-1458.950) [-1458.069] (-1461.226) (-1457.838) * (-1460.787) (-1461.187) [-1461.314] (-1458.807) -- 0:00:36
      423000 -- [-1460.483] (-1459.047) (-1460.628) (-1460.022) * (-1459.054) (-1463.980) [-1459.485] (-1459.358) -- 0:00:36
      423500 -- (-1459.729) [-1458.219] (-1461.069) (-1461.143) * (-1463.367) (-1458.024) [-1461.152] (-1460.010) -- 0:00:36
      424000 -- [-1457.788] (-1463.831) (-1457.507) (-1460.977) * (-1461.180) (-1457.445) (-1460.587) [-1461.165] -- 0:00:36
      424500 -- [-1457.904] (-1463.158) (-1461.642) (-1459.355) * [-1463.589] (-1457.406) (-1460.759) (-1459.066) -- 0:00:36
      425000 -- [-1458.332] (-1464.952) (-1461.560) (-1461.828) * (-1460.553) [-1458.324] (-1458.872) (-1464.575) -- 0:00:36

      Average standard deviation of split frequencies: 0.008527

      425500 -- (-1461.189) (-1461.936) [-1459.523] (-1458.829) * (-1457.660) [-1457.960] (-1459.386) (-1460.038) -- 0:00:36
      426000 -- (-1459.354) [-1458.766] (-1460.743) (-1458.109) * [-1459.809] (-1458.096) (-1460.142) (-1458.001) -- 0:00:36
      426500 -- (-1459.425) [-1458.270] (-1460.155) (-1459.260) * (-1462.634) (-1460.960) [-1458.297] (-1460.858) -- 0:00:36
      427000 -- (-1458.186) [-1459.634] (-1459.517) (-1457.923) * (-1460.465) (-1461.008) [-1461.742] (-1459.291) -- 0:00:36
      427500 -- [-1458.058] (-1458.660) (-1458.551) (-1460.709) * [-1460.058] (-1459.635) (-1461.990) (-1460.035) -- 0:00:36
      428000 -- (-1460.509) [-1458.918] (-1459.140) (-1459.485) * (-1458.561) (-1458.965) (-1460.044) [-1460.428] -- 0:00:36
      428500 -- (-1458.448) [-1459.883] (-1458.808) (-1459.608) * (-1460.079) (-1459.544) (-1458.083) [-1459.683] -- 0:00:36
      429000 -- (-1458.146) (-1461.987) [-1458.725] (-1460.225) * (-1459.301) (-1459.045) (-1458.322) [-1461.891] -- 0:00:35
      429500 -- (-1459.993) (-1462.213) (-1461.117) [-1459.118] * [-1461.846] (-1463.905) (-1457.944) (-1460.550) -- 0:00:35
      430000 -- (-1464.449) (-1464.390) [-1458.595] (-1458.953) * (-1459.335) [-1461.311] (-1460.415) (-1458.970) -- 0:00:35

      Average standard deviation of split frequencies: 0.007727

      430500 -- (-1459.427) (-1460.477) (-1460.802) [-1459.139] * (-1459.223) [-1461.992] (-1460.758) (-1459.005) -- 0:00:35
      431000 -- (-1457.809) (-1459.506) (-1460.467) [-1460.533] * (-1462.823) (-1459.846) (-1458.668) [-1462.123] -- 0:00:35
      431500 -- (-1461.475) [-1460.512] (-1463.847) (-1458.434) * (-1457.818) (-1460.200) (-1466.147) [-1458.980] -- 0:00:35
      432000 -- (-1464.998) (-1458.338) [-1459.287] (-1460.307) * (-1457.818) (-1461.238) [-1459.274] (-1458.301) -- 0:00:35
      432500 -- (-1458.655) (-1458.849) (-1463.638) [-1461.639] * [-1457.416] (-1458.768) (-1460.199) (-1458.477) -- 0:00:35
      433000 -- (-1462.271) [-1460.401] (-1460.526) (-1460.329) * [-1458.522] (-1458.869) (-1460.360) (-1460.879) -- 0:00:35
      433500 -- [-1461.079] (-1460.478) (-1459.576) (-1462.811) * (-1458.477) (-1460.601) [-1462.719] (-1460.602) -- 0:00:35
      434000 -- (-1457.546) (-1458.025) (-1458.466) [-1459.623] * (-1458.869) (-1459.347) [-1458.905] (-1467.148) -- 0:00:35
      434500 -- (-1457.784) (-1457.521) [-1459.729] (-1461.116) * (-1460.487) [-1458.421] (-1458.106) (-1459.072) -- 0:00:35
      435000 -- (-1458.967) [-1459.992] (-1459.158) (-1460.846) * (-1458.175) (-1458.338) (-1457.522) [-1458.194] -- 0:00:35

      Average standard deviation of split frequencies: 0.007839

      435500 -- (-1462.447) [-1459.893] (-1459.803) (-1460.136) * [-1457.875] (-1458.926) (-1457.697) (-1461.291) -- 0:00:36
      436000 -- (-1458.910) [-1460.441] (-1458.527) (-1460.713) * (-1457.874) (-1459.416) (-1458.505) [-1459.713] -- 0:00:36
      436500 -- (-1459.588) [-1462.244] (-1459.067) (-1457.809) * (-1457.573) (-1458.548) [-1458.654] (-1465.414) -- 0:00:36
      437000 -- (-1463.809) (-1459.156) (-1458.348) [-1458.055] * (-1461.277) (-1458.157) (-1458.760) [-1459.147] -- 0:00:36
      437500 -- (-1459.205) (-1458.798) (-1459.890) [-1458.090] * [-1462.614] (-1461.193) (-1460.147) (-1463.870) -- 0:00:36
      438000 -- (-1457.936) (-1457.334) [-1460.366] (-1458.618) * [-1460.854] (-1458.329) (-1459.986) (-1458.614) -- 0:00:35
      438500 -- (-1460.224) [-1457.358] (-1462.948) (-1458.707) * (-1461.254) (-1458.422) [-1459.520] (-1458.251) -- 0:00:35
      439000 -- (-1462.164) [-1459.331] (-1462.065) (-1459.862) * (-1459.689) (-1459.441) (-1457.951) [-1458.184] -- 0:00:35
      439500 -- (-1462.094) [-1461.067] (-1460.073) (-1459.424) * (-1459.067) (-1458.979) [-1458.279] (-1459.498) -- 0:00:35
      440000 -- (-1461.014) (-1458.874) (-1460.842) [-1462.008] * [-1460.717] (-1458.214) (-1457.373) (-1458.531) -- 0:00:35

      Average standard deviation of split frequencies: 0.008023

      440500 -- (-1466.116) [-1458.736] (-1464.163) (-1460.733) * (-1460.622) (-1458.793) [-1459.707] (-1458.571) -- 0:00:35
      441000 -- (-1459.056) (-1465.862) [-1458.152] (-1460.072) * [-1460.044] (-1458.769) (-1459.132) (-1462.589) -- 0:00:35
      441500 -- [-1458.747] (-1458.832) (-1458.399) (-1460.292) * (-1466.156) [-1459.219] (-1460.977) (-1459.642) -- 0:00:35
      442000 -- (-1459.552) (-1459.739) [-1458.452] (-1459.186) * [-1460.758] (-1463.947) (-1460.630) (-1458.043) -- 0:00:35
      442500 -- [-1461.967] (-1461.708) (-1461.002) (-1463.106) * (-1457.805) (-1462.867) [-1457.900] (-1457.793) -- 0:00:35
      443000 -- [-1458.765] (-1457.436) (-1458.451) (-1459.995) * [-1458.942] (-1462.132) (-1457.651) (-1459.323) -- 0:00:35
      443500 -- (-1458.880) (-1457.328) [-1458.244] (-1460.174) * [-1459.942] (-1460.571) (-1460.105) (-1459.924) -- 0:00:35
      444000 -- [-1459.841] (-1459.097) (-1458.634) (-1459.663) * (-1459.265) (-1459.426) [-1460.195] (-1459.856) -- 0:00:35
      444500 -- (-1461.678) (-1459.017) [-1458.775] (-1461.411) * (-1458.901) (-1466.741) [-1460.276] (-1458.877) -- 0:00:34
      445000 -- [-1458.343] (-1457.890) (-1461.632) (-1458.139) * [-1461.206] (-1461.324) (-1460.847) (-1458.971) -- 0:00:34

      Average standard deviation of split frequencies: 0.008125

      445500 -- [-1457.880] (-1460.451) (-1460.632) (-1460.508) * (-1460.551) (-1466.549) [-1458.544] (-1458.552) -- 0:00:34
      446000 -- [-1459.639] (-1458.774) (-1459.334) (-1459.359) * [-1460.320] (-1459.152) (-1459.420) (-1459.514) -- 0:00:34
      446500 -- [-1461.337] (-1460.305) (-1458.014) (-1458.325) * (-1463.792) (-1458.852) (-1465.609) [-1458.248] -- 0:00:34
      447000 -- (-1462.054) [-1458.849] (-1458.104) (-1457.923) * (-1461.742) (-1458.120) [-1457.821] (-1458.245) -- 0:00:34
      447500 -- (-1458.366) (-1458.859) (-1461.242) [-1457.378] * [-1461.355] (-1457.602) (-1459.738) (-1458.048) -- 0:00:34
      448000 -- (-1459.684) (-1459.955) [-1458.863] (-1457.520) * [-1461.654] (-1458.213) (-1459.610) (-1460.203) -- 0:00:34
      448500 -- (-1462.474) [-1460.243] (-1458.825) (-1457.473) * (-1458.756) [-1458.206] (-1459.395) (-1465.071) -- 0:00:34
      449000 -- (-1459.857) (-1461.158) (-1459.069) [-1458.195] * (-1460.199) (-1458.282) (-1461.950) [-1460.454] -- 0:00:34
      449500 -- (-1457.944) (-1461.838) [-1458.275] (-1459.273) * [-1458.161] (-1459.441) (-1461.976) (-1464.924) -- 0:00:34
      450000 -- (-1458.159) [-1461.030] (-1459.259) (-1460.593) * (-1460.933) [-1458.769] (-1461.860) (-1459.914) -- 0:00:34

      Average standard deviation of split frequencies: 0.007518

      450500 -- (-1458.126) (-1470.982) (-1457.907) [-1458.637] * (-1460.439) [-1459.404] (-1459.079) (-1458.283) -- 0:00:34
      451000 -- [-1458.781] (-1461.191) (-1460.131) (-1459.510) * (-1458.002) (-1459.852) [-1458.968] (-1458.203) -- 0:00:34
      451500 -- [-1458.765] (-1461.323) (-1457.477) (-1457.849) * (-1460.135) [-1459.800] (-1458.638) (-1458.384) -- 0:00:35
      452000 -- (-1458.609) [-1458.257] (-1458.552) (-1458.956) * (-1464.837) [-1458.769] (-1457.279) (-1457.558) -- 0:00:35
      452500 -- [-1459.727] (-1457.366) (-1459.230) (-1464.247) * (-1469.409) (-1464.093) (-1458.952) [-1458.344] -- 0:00:35
      453000 -- (-1458.942) (-1457.954) [-1460.532] (-1461.503) * (-1462.838) (-1464.311) (-1458.265) [-1465.825] -- 0:00:35
      453500 -- [-1459.191] (-1461.028) (-1457.978) (-1459.995) * [-1459.850] (-1463.425) (-1459.769) (-1461.717) -- 0:00:34
      454000 -- (-1459.620) (-1458.107) [-1458.323] (-1459.799) * (-1463.050) [-1461.263] (-1458.600) (-1462.319) -- 0:00:34
      454500 -- (-1460.045) [-1459.650] (-1459.465) (-1461.973) * (-1459.859) (-1462.307) (-1457.600) [-1459.762] -- 0:00:34
      455000 -- [-1458.887] (-1459.426) (-1458.567) (-1459.997) * (-1459.462) [-1460.755] (-1457.166) (-1458.949) -- 0:00:34

      Average standard deviation of split frequencies: 0.007818

      455500 -- (-1458.823) [-1459.227] (-1459.372) (-1460.309) * (-1461.535) [-1458.320] (-1459.245) (-1459.170) -- 0:00:34
      456000 -- (-1461.978) (-1458.686) [-1458.766] (-1460.083) * [-1461.632] (-1459.657) (-1461.455) (-1458.122) -- 0:00:34
      456500 -- (-1460.686) (-1457.360) [-1463.848] (-1457.988) * (-1458.573) (-1458.292) [-1459.766] (-1458.550) -- 0:00:34
      457000 -- (-1461.169) (-1458.267) [-1459.342] (-1458.015) * [-1458.919] (-1461.863) (-1459.141) (-1458.937) -- 0:00:34
      457500 -- (-1458.933) (-1459.382) (-1462.268) [-1457.463] * (-1462.391) (-1464.430) [-1459.872] (-1460.536) -- 0:00:34
      458000 -- (-1458.584) [-1457.288] (-1462.430) (-1458.128) * (-1459.820) (-1463.448) [-1458.990] (-1460.276) -- 0:00:34
      458500 -- (-1460.569) [-1457.864] (-1460.305) (-1458.970) * (-1461.092) (-1458.479) (-1459.417) [-1459.481] -- 0:00:34
      459000 -- [-1459.684] (-1457.997) (-1459.823) (-1463.034) * (-1458.678) (-1460.576) (-1461.225) [-1457.886] -- 0:00:34
      459500 -- (-1458.459) [-1458.423] (-1458.545) (-1462.092) * (-1459.564) (-1457.879) (-1459.738) [-1458.390] -- 0:00:34
      460000 -- (-1458.637) (-1459.881) (-1459.446) [-1461.855] * (-1459.059) (-1459.253) (-1459.590) [-1459.530] -- 0:00:34

      Average standard deviation of split frequencies: 0.008066

      460500 -- (-1459.104) (-1458.467) (-1462.328) [-1458.277] * (-1458.199) (-1458.356) [-1458.867] (-1463.811) -- 0:00:33
      461000 -- [-1457.946] (-1459.556) (-1458.981) (-1458.856) * (-1458.904) (-1458.266) (-1458.203) [-1460.462] -- 0:00:33
      461500 -- [-1459.859] (-1464.732) (-1460.034) (-1458.280) * (-1458.053) [-1459.474] (-1457.260) (-1459.983) -- 0:00:33
      462000 -- (-1461.030) (-1461.317) [-1460.506] (-1458.667) * [-1457.923] (-1461.754) (-1457.400) (-1460.747) -- 0:00:33
      462500 -- (-1460.650) [-1457.669] (-1464.255) (-1459.306) * (-1459.488) (-1459.356) [-1457.448] (-1462.065) -- 0:00:33
      463000 -- [-1460.437] (-1457.808) (-1458.545) (-1458.776) * (-1459.549) (-1458.208) [-1459.352] (-1468.066) -- 0:00:33
      463500 -- (-1459.680) [-1457.632] (-1459.996) (-1466.100) * [-1457.867] (-1461.487) (-1459.171) (-1459.059) -- 0:00:33
      464000 -- [-1459.239] (-1467.608) (-1458.252) (-1461.529) * (-1461.612) (-1459.405) (-1459.050) [-1458.096] -- 0:00:33
      464500 -- (-1458.480) [-1459.953] (-1457.896) (-1463.005) * (-1464.376) (-1461.416) (-1460.701) [-1457.235] -- 0:00:33
      465000 -- (-1457.907) (-1459.779) [-1461.364] (-1462.470) * (-1459.744) (-1462.061) (-1458.571) [-1457.223] -- 0:00:33

      Average standard deviation of split frequencies: 0.007676

      465500 -- (-1458.879) (-1459.716) (-1459.177) [-1458.173] * (-1458.875) (-1461.243) (-1460.738) [-1459.858] -- 0:00:33
      466000 -- (-1461.627) (-1466.860) (-1459.017) [-1459.918] * (-1458.135) (-1460.939) [-1462.430] (-1461.098) -- 0:00:33
      466500 -- (-1461.173) [-1459.409] (-1461.564) (-1460.928) * [-1457.668] (-1460.436) (-1462.773) (-1464.271) -- 0:00:33
      467000 -- (-1460.227) (-1458.619) [-1457.911] (-1460.096) * (-1457.691) (-1461.057) (-1460.616) [-1461.104] -- 0:00:33
      467500 -- (-1462.000) [-1459.358] (-1461.455) (-1458.638) * (-1459.333) [-1458.366] (-1460.329) (-1459.226) -- 0:00:34
      468000 -- (-1459.116) (-1463.737) (-1460.576) [-1460.514] * (-1463.505) (-1458.283) [-1459.568] (-1459.344) -- 0:00:34
      468500 -- [-1457.465] (-1460.284) (-1460.001) (-1458.988) * (-1458.586) [-1460.832] (-1460.405) (-1459.541) -- 0:00:34
      469000 -- (-1457.241) (-1460.670) [-1458.668] (-1459.164) * (-1458.851) (-1458.271) (-1458.972) [-1460.601] -- 0:00:33
      469500 -- [-1459.261] (-1467.184) (-1462.785) (-1457.378) * (-1459.566) [-1458.155] (-1461.654) (-1460.180) -- 0:00:33
      470000 -- (-1459.134) (-1457.968) (-1461.807) [-1457.374] * (-1458.929) [-1458.123] (-1458.231) (-1460.532) -- 0:00:33

      Average standard deviation of split frequencies: 0.008425

      470500 -- [-1457.792] (-1460.703) (-1457.951) (-1458.413) * (-1461.655) (-1458.236) (-1459.927) [-1461.292] -- 0:00:33
      471000 -- (-1459.422) (-1457.873) (-1459.039) [-1459.925] * (-1462.597) (-1459.100) [-1459.763] (-1460.432) -- 0:00:33
      471500 -- (-1459.790) (-1462.205) [-1458.037] (-1459.219) * (-1462.541) [-1458.149] (-1458.870) (-1462.670) -- 0:00:33
      472000 -- (-1458.857) [-1462.358] (-1462.339) (-1459.380) * (-1459.971) [-1457.801] (-1457.450) (-1461.248) -- 0:00:33
      472500 -- (-1462.953) (-1458.544) [-1457.933] (-1458.824) * (-1458.533) (-1459.770) [-1459.080] (-1461.118) -- 0:00:33
      473000 -- [-1462.232] (-1458.355) (-1457.945) (-1457.753) * (-1459.537) (-1460.521) [-1463.036] (-1459.282) -- 0:00:33
      473500 -- [-1459.284] (-1458.752) (-1457.945) (-1460.702) * (-1463.102) (-1459.130) (-1459.568) [-1459.389] -- 0:00:33
      474000 -- [-1459.155] (-1460.245) (-1458.426) (-1459.423) * (-1468.851) (-1462.257) (-1461.280) [-1459.510] -- 0:00:33
      474500 -- [-1459.029] (-1459.928) (-1462.885) (-1460.013) * [-1458.554] (-1461.742) (-1461.478) (-1459.206) -- 0:00:33
      475000 -- (-1457.697) [-1459.522] (-1460.345) (-1459.583) * (-1458.602) [-1460.329] (-1459.763) (-1459.468) -- 0:00:33

      Average standard deviation of split frequencies: 0.007981

      475500 -- (-1459.017) [-1458.406] (-1459.101) (-1459.750) * (-1458.314) (-1459.229) [-1461.937] (-1457.317) -- 0:00:33
      476000 -- [-1458.768] (-1459.548) (-1457.738) (-1461.924) * (-1462.155) (-1458.