--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:20:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/dcd/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -784.48 -788.26
2 -784.43 -787.55
--------------------------------------
TOTAL -784.45 -787.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882701 0.085419 0.389841 1.498074 0.852894 1212.52 1334.63 1.000
r(A<->C){all} 0.163890 0.019780 0.000066 0.448616 0.126935 151.31 200.37 1.001
r(A<->G){all} 0.163136 0.019291 0.000004 0.451903 0.127031 156.00 190.12 1.001
r(A<->T){all} 0.161379 0.020005 0.000147 0.453598 0.118573 274.75 350.17 1.000
r(C<->G){all} 0.183532 0.023097 0.000033 0.493335 0.142446 178.96 248.52 1.006
r(C<->T){all} 0.161698 0.019229 0.000088 0.444596 0.123327 233.85 253.72 1.008
r(G<->T){all} 0.166363 0.019835 0.000095 0.457652 0.127505 128.35 187.70 1.000
pi(A){all} 0.208960 0.000275 0.177561 0.241584 0.208530 1096.34 1160.88 1.000
pi(C){all} 0.301844 0.000356 0.264974 0.336182 0.301334 1271.91 1312.26 1.000
pi(G){all} 0.276737 0.000336 0.239769 0.312287 0.276740 1170.39 1272.47 1.000
pi(T){all} 0.212459 0.000283 0.179536 0.246499 0.211836 1259.91 1331.46 1.000
alpha{1,2} 0.446697 0.243204 0.000308 1.422536 0.290670 1054.92 1156.25 1.000
alpha{3} 0.458963 0.236490 0.000219 1.456701 0.297959 1202.34 1236.46 1.000
pinvar{all} 0.997292 0.000011 0.991227 0.999998 0.998336 1284.52 1322.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -765.328726
Model 2: PositiveSelection -765.328784
Model 0: one-ratio -765.328682
Model 7: beta -765.328593
Model 8: beta&w>1 -765.328793
Model 0 vs 1 8.800000000519503E-5
Model 2 vs 1 1.160000001618755E-4
Model 8 vs 7 4.0000000012696546E-4
>C1
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C2
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C3
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C4
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C5
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C6
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=190
C1 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C2 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C3 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C4 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C5 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C6 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
**************************************************
C1 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C2 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C3 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C4 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C5 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C6 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
**************************************************
C1 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C2 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C3 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C4 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C5 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C6 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
**************************************************
C1 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C2 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C3 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C4 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C5 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C6 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
****************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 190 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 190 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5700]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5700]--->[5700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.478 Mb, Max= 30.731 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C2 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C3 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C4 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C5 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
C6 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
**************************************************
C1 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C2 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C3 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C4 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C5 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
C6 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
**************************************************
C1 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C2 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C3 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C4 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C5 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
C6 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
**************************************************
C1 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C2 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C3 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C4 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C5 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
C6 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
****************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
C2 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
C3 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
C4 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
C5 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
C6 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
**************************************************
C1 CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
C2 CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
C3 CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
C4 CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
C5 CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
C6 CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
**************************************************
C1 TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
C2 TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
C3 TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
C4 TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
C5 TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
C6 TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
**************************************************
C1 ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
C2 ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
C3 ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
C4 ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
C5 ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
C6 ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
**************************************************
C1 TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
C2 TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
C3 TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
C4 TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
C5 TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
C6 TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
**************************************************
C1 CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
C2 CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
C3 CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
C4 CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
C5 CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
C6 CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
**************************************************
C1 AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
C2 AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
C3 AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
C4 AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
C5 AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
C6 AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
**************************************************
C1 CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
C2 CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
C3 CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
C4 CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
C5 CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
C6 CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
**************************************************
C1 CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
C2 CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
C3 CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
C4 CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
C5 CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
C6 CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
**************************************************
C1 GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
C2 GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
C3 GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
C4 GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
C5 GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
C6 GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
**************************************************
C1 GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
C2 GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
C3 GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
C4 GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
C5 GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
C6 GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
**************************************************
C1 AGAATTTCATAAAAAATACC
C2 AGAATTTCATAAAAAATACC
C3 AGAATTTCATAAAAAATACC
C4 AGAATTTCATAAAAAATACC
C5 AGAATTTCATAAAAAATACC
C6 AGAATTTCATAAAAAATACC
********************
>C1
GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
AGAATTTCATAAAAAATACC
>C2
GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
AGAATTTCATAAAAAATACC
>C3
GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
AGAATTTCATAAAAAATACC
>C4
GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
AGAATTTCATAAAAAATACC
>C5
GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
AGAATTTCATAAAAAATACC
>C6
GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT
CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG
TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC
ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT
TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA
CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC
AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT
CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG
CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC
GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC
GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG
AGAATTTCATAAAAAATACC
>C1
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C2
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C3
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C4
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C5
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
>C6
VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 570 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774783
Setting output file names to "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1189547114
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9796803718
Seed = 1170258433
Swapseed = 1579774783
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1275.687328 -- -24.965149
Chain 2 -- -1275.687255 -- -24.965149
Chain 3 -- -1275.687328 -- -24.965149
Chain 4 -- -1275.687255 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1275.687255 -- -24.965149
Chain 2 -- -1275.687255 -- -24.965149
Chain 3 -- -1275.687133 -- -24.965149
Chain 4 -- -1275.687328 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1275.687] (-1275.687) (-1275.687) (-1275.687) * [-1275.687] (-1275.687) (-1275.687) (-1275.687)
500 -- (-805.469) (-790.369) [-809.849] (-806.126) * (-793.750) (-796.037) (-793.409) [-797.916] -- 0:00:00
1000 -- (-799.174) (-793.673) [-793.317] (-806.421) * [-794.844] (-795.360) (-794.495) (-801.005) -- 0:00:00
1500 -- (-791.962) (-796.637) [-793.842] (-792.849) * (-796.284) (-797.084) (-793.140) [-790.962] -- 0:00:00
2000 -- [-792.793] (-792.559) (-793.998) (-792.019) * (-793.490) [-791.059] (-790.471) (-791.959) -- 0:00:00
2500 -- (-795.585) (-803.012) [-793.121] (-798.126) * (-800.437) (-793.103) (-794.822) [-796.890] -- 0:00:00
3000 -- [-795.125] (-799.025) (-795.530) (-793.674) * (-792.298) [-793.378] (-795.580) (-795.150) -- 0:00:00
3500 -- (-796.793) [-790.006] (-797.233) (-790.250) * [-799.992] (-799.978) (-793.087) (-792.698) -- 0:00:00
4000 -- (-791.935) (-798.437) (-791.340) [-792.024] * (-800.380) [-792.617] (-798.870) (-794.358) -- 0:00:00
4500 -- (-797.558) (-790.955) (-797.883) [-791.787] * [-799.010] (-793.851) (-795.042) (-798.591) -- 0:00:00
5000 -- (-795.115) (-793.504) (-791.811) [-792.712] * (-798.983) (-794.790) [-793.591] (-796.670) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- (-791.574) (-798.799) [-803.235] (-793.199) * [-793.989] (-797.988) (-797.179) (-792.824) -- 0:00:00
6000 -- [-793.749] (-798.340) (-790.231) (-794.102) * (-801.190) (-790.712) [-797.082] (-792.410) -- 0:00:00
6500 -- (-795.794) (-798.917) (-791.727) [-792.266] * (-795.372) (-795.644) [-792.105] (-798.728) -- 0:00:00
7000 -- (-793.878) (-801.909) [-791.207] (-790.679) * (-798.958) [-792.443] (-791.445) (-794.898) -- 0:00:00
7500 -- (-799.705) (-793.617) (-807.018) [-791.534] * (-793.896) (-794.699) [-796.782] (-797.027) -- 0:00:00
8000 -- (-794.424) (-790.810) (-794.758) [-795.970] * (-798.680) [-791.509] (-798.058) (-800.298) -- 0:00:00
8500 -- (-797.286) (-790.561) (-793.012) [-791.623] * [-807.156] (-803.437) (-792.540) (-795.976) -- 0:00:00
9000 -- (-798.840) [-792.246] (-791.166) (-802.460) * (-794.542) (-792.268) (-799.107) [-794.746] -- 0:01:50
9500 -- (-793.660) (-795.204) (-794.420) [-795.803] * (-791.632) (-795.805) (-801.962) [-793.852] -- 0:01:44
10000 -- (-798.015) (-799.029) [-790.193] (-808.129) * (-794.422) (-791.711) [-791.134] (-792.690) -- 0:01:39
Average standard deviation of split frequencies: 0.060476
10500 -- (-792.145) [-799.462] (-800.304) (-795.478) * (-804.218) [-793.383] (-791.892) (-793.980) -- 0:01:34
11000 -- (-793.893) (-795.674) [-793.500] (-783.308) * (-801.200) [-793.344] (-796.938) (-797.668) -- 0:01:29
11500 -- (-802.086) (-797.493) (-798.534) [-785.590] * [-795.946] (-789.898) (-792.936) (-790.041) -- 0:01:25
12000 -- (-798.888) [-794.026] (-802.274) (-784.507) * (-792.298) (-791.734) [-789.536] (-800.768) -- 0:01:22
12500 -- [-790.837] (-798.458) (-797.179) (-786.656) * (-797.278) (-793.489) [-789.987] (-794.683) -- 0:01:19
13000 -- (-788.910) (-794.238) [-796.159] (-786.375) * [-798.775] (-795.145) (-796.297) (-792.847) -- 0:01:15
13500 -- [-792.972] (-800.988) (-792.884) (-788.109) * (-796.770) (-804.271) (-796.739) [-796.090] -- 0:01:13
14000 -- (-799.827) (-790.484) (-793.788) [-783.439] * (-791.083) (-789.333) (-790.333) [-790.854] -- 0:01:10
14500 -- (-800.208) [-789.737] (-795.861) (-785.282) * (-789.238) (-793.951) [-787.720] (-796.014) -- 0:01:07
15000 -- (-798.732) (-790.920) (-795.134) [-785.649] * (-793.311) (-792.802) [-790.723] (-791.650) -- 0:01:05
Average standard deviation of split frequencies: 0.055979
15500 -- [-789.976] (-813.534) (-793.407) (-784.805) * [-789.271] (-796.373) (-806.722) (-798.488) -- 0:01:03
16000 -- (-798.748) (-786.147) [-786.567] (-787.701) * [-795.523] (-797.298) (-792.393) (-805.062) -- 0:01:01
16500 -- [-788.742] (-786.953) (-787.393) (-785.486) * (-796.606) (-796.521) (-804.396) [-785.509] -- 0:00:59
17000 -- [-795.682] (-784.065) (-788.963) (-785.024) * (-797.205) (-793.311) (-795.222) [-790.850] -- 0:00:57
17500 -- (-798.778) (-784.825) [-788.561] (-785.009) * (-792.932) (-796.566) [-791.252] (-790.512) -- 0:00:56
18000 -- (-801.384) [-784.096] (-786.984) (-785.693) * (-794.481) (-792.302) (-796.268) [-791.208] -- 0:00:54
18500 -- [-791.181] (-787.954) (-787.919) (-784.729) * (-793.526) (-795.786) [-796.590] (-795.628) -- 0:00:53
19000 -- [-792.224] (-783.134) (-787.905) (-785.401) * (-794.233) (-800.680) [-794.313] (-788.095) -- 0:00:51
19500 -- (-797.368) [-784.959] (-787.406) (-785.574) * (-794.237) (-795.207) [-796.327] (-798.702) -- 0:00:50
20000 -- [-792.954] (-786.820) (-786.677) (-784.694) * (-794.365) (-798.351) (-800.864) [-793.855] -- 0:00:49
Average standard deviation of split frequencies: 0.048154
20500 -- (-792.959) [-785.678] (-786.538) (-784.482) * (-793.130) (-793.698) (-792.878) [-790.811] -- 0:00:47
21000 -- [-789.648] (-787.351) (-788.626) (-785.454) * (-798.243) [-796.803] (-790.194) (-793.319) -- 0:00:46
21500 -- (-796.013) (-785.922) [-785.248] (-783.223) * (-792.839) (-792.607) (-788.489) [-789.093] -- 0:00:45
22000 -- (-804.624) [-783.929] (-785.492) (-785.262) * [-798.264] (-795.249) (-796.462) (-790.794) -- 0:00:44
22500 -- (-799.657) (-784.101) (-785.486) [-786.570] * (-790.682) (-796.035) [-792.048] (-791.795) -- 0:00:43
23000 -- (-793.191) (-785.691) [-784.417] (-783.400) * [-802.515] (-791.521) (-797.759) (-797.035) -- 0:00:42
23500 -- (-799.421) [-785.082] (-784.626) (-783.635) * (-794.708) [-794.231] (-797.429) (-798.610) -- 0:00:41
24000 -- (-806.102) [-784.304] (-783.214) (-785.757) * (-805.835) (-796.114) (-800.085) [-790.304] -- 0:00:40
24500 -- [-794.260] (-790.481) (-786.696) (-789.924) * (-795.223) [-796.230] (-798.593) (-796.184) -- 0:01:19
25000 -- (-788.735) (-785.484) (-787.873) [-786.271] * (-808.616) [-792.031] (-793.497) (-791.211) -- 0:01:18
Average standard deviation of split frequencies: 0.050076
25500 -- [-790.090] (-784.625) (-786.507) (-786.160) * (-803.197) [-787.764] (-797.297) (-795.061) -- 0:01:16
26000 -- (-798.210) (-784.034) (-787.497) [-783.959] * (-801.205) (-788.880) [-801.088] (-804.971) -- 0:01:14
26500 -- (-793.905) [-784.327] (-787.968) (-784.814) * (-799.106) (-789.927) (-794.180) [-791.666] -- 0:01:13
27000 -- (-793.949) [-784.219] (-787.796) (-783.684) * (-797.923) (-796.863) [-795.706] (-793.862) -- 0:01:12
27500 -- (-799.572) [-786.210] (-784.285) (-785.455) * (-796.275) (-797.444) [-793.738] (-795.046) -- 0:01:10
28000 -- (-790.122) [-787.487] (-784.793) (-788.453) * [-797.549] (-795.703) (-798.111) (-792.469) -- 0:01:09
28500 -- (-794.963) (-787.674) [-785.242] (-784.962) * (-798.423) [-800.604] (-807.052) (-792.972) -- 0:01:08
29000 -- (-799.426) (-787.345) (-785.889) [-787.661] * (-802.712) (-793.895) [-800.188] (-805.702) -- 0:01:06
29500 -- (-799.804) (-782.939) (-785.426) [-786.294] * [-800.871] (-799.902) (-796.461) (-798.815) -- 0:01:05
30000 -- (-796.864) (-786.506) [-790.698] (-785.787) * [-790.375] (-788.269) (-814.532) (-796.726) -- 0:01:04
Average standard deviation of split frequencies: 0.036600
30500 -- (-796.473) (-785.925) (-786.079) [-783.671] * [-785.734] (-800.510) (-797.076) (-784.899) -- 0:01:03
31000 -- (-795.259) (-787.479) [-785.364] (-786.100) * (-786.264) (-793.120) [-790.494] (-793.731) -- 0:01:02
31500 -- (-797.131) [-787.473] (-784.655) (-785.692) * (-786.914) (-797.367) (-791.026) [-785.532] -- 0:01:01
32000 -- [-792.305] (-784.992) (-785.082) (-784.713) * (-788.513) (-797.124) (-793.439) [-783.694] -- 0:01:00
32500 -- [-800.123] (-785.109) (-787.405) (-786.193) * (-784.985) (-822.908) [-797.580] (-786.403) -- 0:00:59
33000 -- (-795.481) [-784.336] (-786.386) (-785.030) * (-785.247) (-814.318) [-789.569] (-787.571) -- 0:00:58
33500 -- [-795.685] (-784.241) (-786.505) (-785.658) * (-784.090) (-799.087) [-793.961] (-784.974) -- 0:00:57
34000 -- (-800.209) [-790.155] (-786.997) (-783.168) * (-784.821) [-787.252] (-793.515) (-787.101) -- 0:00:56
34500 -- (-791.427) (-787.969) (-788.885) [-785.824] * (-783.867) [-783.106] (-790.833) (-785.696) -- 0:00:55
35000 -- (-800.216) (-785.262) (-785.841) [-787.580] * (-785.373) [-783.322] (-791.577) (-784.786) -- 0:00:55
Average standard deviation of split frequencies: 0.030772
35500 -- (-794.361) [-784.846] (-787.912) (-784.389) * (-783.903) (-784.586) [-789.884] (-789.426) -- 0:00:54
36000 -- (-792.174) (-787.573) (-786.309) [-787.290] * (-784.892) (-785.461) [-796.544] (-788.587) -- 0:00:53
36500 -- (-789.796) [-784.159] (-785.807) (-785.046) * [-785.896] (-783.826) (-793.421) (-785.639) -- 0:00:52
37000 -- (-802.248) [-784.576] (-788.123) (-784.462) * (-785.490) (-787.294) (-793.035) [-785.314] -- 0:00:52
37500 -- (-795.780) (-783.588) (-784.769) [-784.360] * (-784.396) (-783.370) [-795.400] (-788.394) -- 0:00:51
38000 -- (-798.519) [-783.333] (-783.688) (-784.429) * (-783.786) [-784.228] (-795.710) (-791.361) -- 0:00:50
38500 -- (-799.130) [-784.387] (-783.514) (-785.001) * [-785.881] (-785.311) (-802.428) (-785.812) -- 0:00:49
39000 -- (-787.510) [-784.320] (-783.322) (-790.225) * (-783.955) (-783.588) (-805.960) [-784.951] -- 0:00:49
39500 -- (-791.096) (-784.438) (-783.585) [-785.698] * (-784.351) [-783.530] (-796.825) (-783.534) -- 0:00:48
40000 -- (-791.858) (-783.441) (-783.996) [-785.374] * [-783.917] (-783.585) (-796.098) (-783.969) -- 0:00:48
Average standard deviation of split frequencies: 0.028704
40500 -- [-796.552] (-785.593) (-784.328) (-783.385) * [-784.325] (-784.430) (-794.277) (-788.730) -- 0:01:11
41000 -- (-790.759) (-785.337) [-785.947] (-785.977) * (-785.006) [-785.149] (-800.320) (-788.554) -- 0:01:10
41500 -- (-796.989) [-784.811] (-786.200) (-783.964) * (-786.722) (-783.923) (-797.433) [-785.577] -- 0:01:09
42000 -- [-793.064] (-784.638) (-784.600) (-785.038) * (-785.959) (-791.740) (-787.063) [-785.795] -- 0:01:08
42500 -- (-795.225) [-783.666] (-784.395) (-785.066) * (-785.772) (-785.303) (-792.591) [-786.042] -- 0:01:07
43000 -- [-792.073] (-785.993) (-786.080) (-786.122) * (-788.590) (-788.782) [-795.972] (-790.829) -- 0:01:06
43500 -- (-794.664) (-786.504) [-787.976] (-786.936) * (-787.290) (-785.685) (-803.418) [-788.385] -- 0:01:05
44000 -- [-794.721] (-786.560) (-785.431) (-785.668) * (-783.364) [-783.878] (-797.397) (-786.723) -- 0:01:05
44500 -- (-795.246) [-785.951] (-784.675) (-787.066) * (-788.972) [-783.394] (-793.428) (-784.989) -- 0:01:04
45000 -- (-804.001) (-784.346) [-787.832] (-795.723) * (-784.877) [-783.751] (-789.214) (-786.608) -- 0:01:03
Average standard deviation of split frequencies: 0.027816
45500 -- (-785.539) (-786.630) [-789.187] (-789.336) * (-784.632) [-784.229] (-790.594) (-785.961) -- 0:01:02
46000 -- (-784.689) (-785.988) [-784.359] (-785.232) * [-785.084] (-784.980) (-787.033) (-786.929) -- 0:01:02
46500 -- [-790.234] (-787.786) (-784.017) (-783.689) * (-784.322) (-784.980) (-799.341) [-784.112] -- 0:01:01
47000 -- (-785.855) (-789.874) [-782.867] (-783.668) * (-784.250) (-784.714) (-784.375) [-783.846] -- 0:01:00
47500 -- (-787.284) [-784.029] (-788.418) (-784.684) * [-784.351] (-785.051) (-783.964) (-787.654) -- 0:01:00
48000 -- (-787.609) [-786.401] (-789.269) (-786.478) * [-783.452] (-785.697) (-787.795) (-786.399) -- 0:00:59
48500 -- (-784.253) [-786.277] (-786.451) (-786.235) * (-786.002) (-790.028) (-786.314) [-782.983] -- 0:00:58
49000 -- (-785.778) (-783.609) (-783.581) [-784.215] * (-785.136) (-788.830) (-787.433) [-783.488] -- 0:00:58
49500 -- (-784.150) (-783.009) (-784.949) [-785.157] * (-783.282) (-788.199) (-783.917) [-787.853] -- 0:00:57
50000 -- (-784.294) (-783.551) [-786.660] (-783.534) * [-785.710] (-789.001) (-784.748) (-786.896) -- 0:00:57
Average standard deviation of split frequencies: 0.031900
50500 -- (-784.080) [-786.201] (-783.904) (-783.322) * (-786.360) [-786.877] (-786.800) (-787.363) -- 0:00:56
51000 -- [-784.031] (-787.849) (-785.896) (-783.833) * [-785.241] (-785.061) (-785.682) (-784.840) -- 0:00:55
51500 -- (-786.816) (-786.510) [-785.299] (-785.113) * (-787.556) (-784.578) (-783.404) [-785.004] -- 0:00:55
52000 -- [-784.098] (-786.618) (-783.397) (-784.723) * (-789.084) (-786.908) [-783.436] (-784.512) -- 0:00:54
52500 -- [-786.380] (-786.383) (-784.552) (-784.156) * (-786.536) (-788.384) [-783.638] (-789.448) -- 0:00:54
53000 -- (-784.011) (-787.020) [-784.299] (-784.160) * [-784.428] (-786.968) (-786.361) (-788.392) -- 0:00:53
53500 -- (-785.146) [-788.262] (-783.889) (-784.044) * (-785.470) (-787.279) (-787.134) [-785.376] -- 0:00:53
54000 -- (-783.465) (-792.023) [-786.309] (-785.650) * (-787.235) (-784.030) [-785.571] (-784.895) -- 0:00:52
54500 -- (-786.158) [-786.146] (-787.050) (-786.640) * [-785.689] (-787.628) (-786.570) (-783.413) -- 0:00:52
55000 -- [-785.166] (-784.583) (-784.936) (-784.105) * [-785.972] (-787.265) (-790.344) (-786.720) -- 0:00:51
Average standard deviation of split frequencies: 0.030127
55500 -- [-784.197] (-784.655) (-784.075) (-783.707) * (-786.886) [-783.418] (-786.500) (-784.575) -- 0:00:51
56000 -- [-783.875] (-786.214) (-785.806) (-784.547) * (-786.514) [-785.215] (-786.566) (-784.474) -- 0:00:50
56500 -- (-787.474) [-784.718] (-787.044) (-783.534) * (-795.133) (-786.206) [-785.974] (-783.756) -- 0:00:50
57000 -- [-784.237] (-784.106) (-795.497) (-783.552) * (-788.465) [-787.428] (-785.560) (-785.267) -- 0:01:06
57500 -- [-786.218] (-785.277) (-787.030) (-783.836) * (-789.388) (-788.552) (-785.064) [-783.401] -- 0:01:05
58000 -- (-786.028) (-784.764) [-787.448] (-787.501) * (-784.832) [-783.665] (-784.227) (-783.685) -- 0:01:04
58500 -- [-783.827] (-786.018) (-784.039) (-783.580) * (-785.527) [-784.083] (-784.000) (-784.048) -- 0:01:04
59000 -- (-783.961) [-784.298] (-784.840) (-783.551) * (-786.539) (-786.186) [-784.131] (-785.262) -- 0:01:03
59500 -- [-784.001] (-784.108) (-784.877) (-787.528) * (-783.512) (-787.001) [-784.469] (-784.446) -- 0:01:03
60000 -- (-784.275) (-785.425) (-788.470) [-785.564] * (-784.258) (-785.788) [-785.682] (-783.629) -- 0:01:02
Average standard deviation of split frequencies: 0.024129
60500 -- (-789.229) (-784.614) (-788.264) [-785.160] * (-787.579) (-790.173) [-786.689] (-783.105) -- 0:01:02
61000 -- (-785.638) [-783.714] (-784.126) (-787.109) * (-790.669) (-783.869) [-785.535] (-783.512) -- 0:01:01
61500 -- (-787.371) (-786.863) (-786.103) [-788.703] * (-788.749) (-786.915) (-785.207) [-783.725] -- 0:01:01
62000 -- (-788.747) (-785.537) [-784.242] (-787.018) * (-786.287) [-786.252] (-783.299) (-783.484) -- 0:01:00
62500 -- (-787.703) (-783.551) (-785.522) [-784.931] * [-783.758] (-790.482) (-783.117) (-784.733) -- 0:01:00
63000 -- [-786.437] (-784.802) (-786.143) (-786.318) * [-787.979] (-792.720) (-785.121) (-786.352) -- 0:00:59
63500 -- (-786.157) (-784.887) (-786.005) [-785.646] * [-786.158] (-786.826) (-785.145) (-787.744) -- 0:00:58
64000 -- [-785.463] (-786.702) (-786.437) (-785.244) * (-789.472) (-785.429) [-784.541] (-786.958) -- 0:00:58
64500 -- [-783.480] (-785.560) (-785.986) (-787.799) * (-784.839) [-786.850] (-785.784) (-783.920) -- 0:00:58
65000 -- (-789.888) (-784.197) [-786.349] (-786.062) * [-784.846] (-787.957) (-784.420) (-786.106) -- 0:00:57
Average standard deviation of split frequencies: 0.020407
65500 -- [-783.632] (-788.774) (-784.231) (-783.359) * [-786.533] (-784.925) (-785.200) (-784.089) -- 0:00:57
66000 -- (-783.277) (-785.378) [-785.588] (-783.760) * (-785.130) (-784.796) [-784.618] (-783.397) -- 0:00:56
66500 -- (-785.497) [-787.690] (-784.658) (-783.088) * (-785.550) (-785.622) [-784.110] (-784.980) -- 0:00:56
67000 -- (-784.522) (-790.598) (-786.696) [-787.234] * (-783.956) (-787.717) (-788.095) [-783.567] -- 0:00:55
67500 -- [-784.607] (-788.780) (-785.947) (-787.152) * (-786.587) (-788.214) [-785.975] (-784.151) -- 0:00:55
68000 -- (-786.801) (-785.395) [-782.999] (-785.167) * (-788.880) (-785.567) [-784.540] (-784.610) -- 0:00:54
68500 -- [-787.399] (-786.465) (-783.411) (-783.924) * (-789.551) [-784.929] (-787.047) (-786.144) -- 0:00:54
69000 -- (-788.041) (-787.073) [-784.732] (-783.847) * [-783.204] (-785.422) (-784.759) (-783.442) -- 0:00:53
69500 -- [-785.707] (-786.197) (-785.392) (-787.064) * (-784.508) (-785.301) [-784.026] (-783.197) -- 0:00:53
70000 -- (-784.256) (-783.596) (-783.466) [-785.095] * [-784.852] (-785.861) (-788.556) (-782.910) -- 0:00:53
Average standard deviation of split frequencies: 0.020648
70500 -- (-783.498) [-785.006] (-787.197) (-787.011) * (-783.822) (-787.872) [-788.253] (-784.065) -- 0:00:52
71000 -- (-786.189) (-786.397) [-784.194] (-786.475) * (-783.670) (-786.860) (-784.908) [-784.949] -- 0:00:52
71500 -- (-788.060) [-785.006] (-783.982) (-785.210) * (-786.923) [-788.620] (-785.011) (-785.705) -- 0:00:51
72000 -- (-783.494) (-783.666) [-784.497] (-784.839) * [-785.302] (-787.153) (-787.277) (-785.840) -- 0:00:51
72500 -- [-783.113] (-784.162) (-784.090) (-785.021) * (-784.210) [-783.787] (-787.704) (-785.880) -- 0:00:51
73000 -- [-785.648] (-784.433) (-785.093) (-785.236) * [-785.977] (-784.427) (-784.996) (-785.640) -- 0:00:50
73500 -- [-787.965] (-789.223) (-784.228) (-787.096) * [-786.544] (-787.777) (-784.300) (-784.868) -- 0:00:50
74000 -- (-785.595) (-787.855) [-785.738] (-785.797) * (-784.451) (-784.239) (-785.752) [-784.531] -- 0:01:02
74500 -- [-785.812] (-784.732) (-785.523) (-785.320) * (-786.085) (-784.510) (-784.660) [-783.667] -- 0:01:02
75000 -- (-785.860) (-786.513) [-783.931] (-784.673) * (-786.515) (-788.818) [-784.175] (-786.430) -- 0:01:01
Average standard deviation of split frequencies: 0.019199
75500 -- [-787.970] (-785.724) (-786.130) (-783.542) * (-783.780) [-784.008] (-784.763) (-785.503) -- 0:01:01
76000 -- (-785.944) [-784.134] (-786.355) (-783.371) * (-783.357) (-783.373) [-784.186] (-784.151) -- 0:01:00
76500 -- (-783.433) [-784.195] (-784.947) (-783.741) * (-787.479) (-785.335) (-785.152) [-784.888] -- 0:01:00
77000 -- (-786.716) [-785.048] (-784.492) (-786.358) * (-787.334) [-784.346] (-784.458) (-785.980) -- 0:00:59
77500 -- [-785.962] (-783.478) (-786.252) (-784.769) * [-785.222] (-784.570) (-784.270) (-784.476) -- 0:00:59
78000 -- (-786.220) (-783.308) (-785.598) [-783.504] * (-783.162) [-786.164] (-786.156) (-783.587) -- 0:00:59
78500 -- (-787.207) (-783.524) [-783.683] (-790.132) * [-785.675] (-784.001) (-784.921) (-783.776) -- 0:00:58
79000 -- (-789.085) (-784.030) [-783.808] (-786.476) * (-787.785) [-783.117] (-784.277) (-784.197) -- 0:00:58
79500 -- (-782.921) [-784.293] (-784.899) (-788.451) * (-787.096) [-783.647] (-785.711) (-784.256) -- 0:00:57
80000 -- (-791.567) (-783.291) [-784.764] (-784.615) * [-788.603] (-783.782) (-787.543) (-785.366) -- 0:00:57
Average standard deviation of split frequencies: 0.018147
80500 -- [-787.542] (-784.176) (-784.615) (-786.202) * (-787.329) [-786.723] (-790.708) (-783.244) -- 0:00:57
81000 -- (-785.877) (-784.217) [-784.118] (-786.399) * (-787.711) (-783.458) (-785.685) [-783.734] -- 0:00:56
81500 -- (-786.441) (-786.821) [-785.017] (-789.964) * (-785.187) [-785.931] (-785.544) (-783.366) -- 0:00:56
82000 -- (-787.280) (-784.959) (-783.956) [-787.582] * [-783.934] (-783.232) (-784.887) (-784.003) -- 0:00:55
82500 -- [-786.434] (-787.037) (-787.661) (-785.516) * (-784.859) (-784.780) [-783.492] (-783.871) -- 0:00:55
83000 -- [-784.786] (-785.821) (-790.062) (-784.246) * (-784.208) (-783.893) [-783.188] (-785.164) -- 0:00:55
83500 -- [-784.412] (-785.971) (-786.480) (-787.090) * (-783.709) [-785.977] (-783.357) (-783.551) -- 0:00:54
84000 -- [-785.240] (-786.497) (-783.733) (-785.242) * (-783.292) (-784.174) (-783.927) [-784.843] -- 0:00:54
84500 -- (-783.536) (-783.276) [-786.010] (-784.620) * [-783.115] (-784.351) (-786.177) (-786.906) -- 0:00:54
85000 -- [-785.412] (-784.127) (-784.530) (-785.349) * (-784.644) (-790.722) [-784.232] (-784.339) -- 0:00:53
Average standard deviation of split frequencies: 0.016170
85500 -- (-784.822) (-783.119) [-785.416] (-783.351) * [-784.878] (-787.215) (-784.013) (-785.321) -- 0:00:53
86000 -- (-784.716) (-785.596) (-787.994) [-783.770] * (-786.629) [-786.872] (-785.760) (-786.419) -- 0:00:53
86500 -- [-784.022] (-786.832) (-785.318) (-786.816) * (-783.209) (-783.356) (-786.982) [-785.182] -- 0:00:52
87000 -- (-786.275) (-783.554) [-783.736] (-785.656) * [-784.695] (-783.347) (-784.995) (-786.309) -- 0:00:52
87500 -- (-785.946) [-785.793] (-785.469) (-783.687) * (-785.062) (-784.011) (-784.279) [-784.098] -- 0:00:52
88000 -- [-785.841] (-786.932) (-784.322) (-784.593) * [-784.624] (-784.487) (-786.918) (-784.126) -- 0:00:51
88500 -- [-784.369] (-787.007) (-784.563) (-784.231) * (-786.559) (-785.376) (-785.147) [-785.195] -- 0:00:51
89000 -- (-784.866) (-788.013) (-785.879) [-785.191] * [-784.630] (-783.336) (-785.350) (-784.556) -- 0:00:51
89500 -- (-785.853) (-787.037) [-785.749] (-786.282) * [-784.045] (-783.572) (-785.178) (-783.577) -- 0:00:50
90000 -- (-785.652) (-784.365) [-787.902] (-787.370) * (-785.581) (-786.171) [-784.918] (-787.003) -- 0:00:50
Average standard deviation of split frequencies: 0.019807
90500 -- (-788.778) (-787.514) (-787.693) [-784.008] * [-784.954] (-783.658) (-783.201) (-785.516) -- 0:01:00
91000 -- (-785.691) [-786.050] (-785.316) (-783.871) * [-788.646] (-784.763) (-784.533) (-785.836) -- 0:00:59
91500 -- (-782.842) [-785.687] (-784.630) (-784.467) * (-785.388) (-785.210) [-785.604] (-783.504) -- 0:00:59
92000 -- (-784.947) (-786.729) [-784.372] (-785.417) * [-786.628] (-784.064) (-785.565) (-783.532) -- 0:00:59
92500 -- (-789.997) [-785.677] (-784.157) (-783.187) * [-785.751] (-782.921) (-785.653) (-789.588) -- 0:00:58
93000 -- (-790.227) (-784.528) (-784.130) [-786.882] * [-783.679] (-784.591) (-784.244) (-784.403) -- 0:00:58
93500 -- [-784.228] (-785.507) (-784.186) (-785.380) * (-786.150) (-785.516) [-784.891] (-787.525) -- 0:00:58
94000 -- (-783.272) (-790.058) (-783.751) [-784.346] * (-787.047) (-787.520) [-784.125] (-786.584) -- 0:00:57
94500 -- (-784.166) (-784.550) (-791.843) [-783.877] * (-787.354) (-784.442) [-783.884] (-786.313) -- 0:00:57
95000 -- (-790.649) [-784.159] (-785.130) (-784.999) * (-784.284) (-785.198) [-791.186] (-783.806) -- 0:00:57
Average standard deviation of split frequencies: 0.023079
95500 -- (-790.754) (-783.478) [-785.140] (-787.927) * (-785.783) (-786.371) (-785.248) [-785.534] -- 0:00:56
96000 -- (-790.531) (-787.448) [-783.859] (-785.097) * [-786.876] (-785.160) (-790.091) (-785.467) -- 0:00:56
96500 -- [-784.804] (-787.699) (-783.857) (-784.780) * (-788.880) (-783.524) [-785.021] (-785.066) -- 0:00:56
97000 -- [-783.398] (-788.807) (-786.447) (-784.815) * (-787.677) [-783.886] (-785.637) (-786.642) -- 0:00:55
97500 -- (-784.487) [-786.388] (-784.096) (-784.505) * (-787.506) [-785.510] (-785.725) (-783.118) -- 0:00:55
98000 -- (-792.063) (-783.339) (-784.379) [-783.195] * (-786.534) (-785.747) [-784.634] (-783.761) -- 0:00:55
98500 -- (-787.396) (-783.531) [-783.803] (-784.924) * [-783.854] (-784.928) (-784.344) (-784.483) -- 0:00:54
99000 -- [-787.079] (-785.343) (-786.261) (-784.827) * (-783.783) [-786.237] (-785.674) (-784.300) -- 0:00:54
99500 -- [-785.963] (-783.383) (-786.911) (-783.323) * (-783.074) [-784.024] (-784.567) (-793.401) -- 0:00:54
100000 -- [-783.674] (-789.385) (-784.816) (-784.877) * [-786.308] (-790.692) (-785.170) (-790.537) -- 0:00:54
Average standard deviation of split frequencies: 0.022675
100500 -- [-786.434] (-786.344) (-786.263) (-785.140) * [-783.393] (-785.658) (-785.951) (-792.258) -- 0:00:53
101000 -- (-786.335) [-790.870] (-788.228) (-790.105) * [-783.403] (-786.289) (-783.778) (-784.600) -- 0:00:53
101500 -- (-787.841) [-790.223] (-789.731) (-790.501) * (-783.422) (-785.772) (-784.028) [-784.529] -- 0:00:53
102000 -- (-783.940) (-786.113) (-785.216) [-784.675] * (-782.872) (-786.186) (-784.773) [-785.130] -- 0:00:52
102500 -- [-787.848] (-787.887) (-786.215) (-785.159) * [-783.333] (-785.788) (-785.049) (-788.079) -- 0:00:52
103000 -- (-789.662) (-783.461) (-784.589) [-784.788] * [-786.191] (-785.238) (-785.680) (-788.401) -- 0:00:52
103500 -- [-784.279] (-788.337) (-784.460) (-785.114) * [-786.431] (-785.842) (-790.327) (-785.645) -- 0:00:51
104000 -- (-784.487) (-786.809) (-786.183) [-785.724] * (-792.061) [-784.007] (-785.637) (-785.894) -- 0:00:51
104500 -- (-784.286) [-785.918] (-786.898) (-786.722) * (-787.023) (-783.643) [-785.293] (-783.977) -- 0:00:51
105000 -- [-785.145] (-785.463) (-785.103) (-784.009) * (-787.446) [-783.675] (-787.419) (-784.285) -- 0:00:51
Average standard deviation of split frequencies: 0.019406
105500 -- (-786.189) [-785.386] (-788.868) (-787.628) * (-785.053) (-785.166) [-786.963] (-784.421) -- 0:00:50
106000 -- [-787.337] (-787.325) (-789.544) (-786.852) * (-786.633) (-785.573) [-786.565] (-785.245) -- 0:00:50
106500 -- (-786.241) (-784.607) (-783.902) [-785.059] * (-784.681) [-785.198] (-786.980) (-788.048) -- 0:00:50
107000 -- (-784.286) (-785.126) [-784.739] (-786.422) * (-784.271) (-784.493) (-785.500) [-784.808] -- 0:00:58
107500 -- [-786.641] (-784.419) (-785.844) (-783.213) * (-785.575) (-788.548) [-783.926] (-785.571) -- 0:00:58
108000 -- (-786.210) [-784.955] (-787.758) (-784.001) * (-784.830) (-783.490) (-787.239) [-786.975] -- 0:00:57
108500 -- [-788.101] (-785.024) (-784.213) (-790.123) * (-787.742) [-784.628] (-787.100) (-787.476) -- 0:00:57
109000 -- (-786.891) [-785.079] (-783.880) (-784.538) * (-784.898) (-784.382) [-787.445] (-785.659) -- 0:00:57
109500 -- [-784.104] (-784.498) (-787.498) (-784.183) * (-783.961) (-784.638) [-784.818] (-787.564) -- 0:00:56
110000 -- (-786.768) (-784.463) [-790.468] (-786.086) * (-786.313) (-784.858) [-787.303] (-784.780) -- 0:00:56
Average standard deviation of split frequencies: 0.020872
110500 -- [-787.184] (-786.213) (-789.950) (-785.560) * [-785.119] (-786.254) (-784.079) (-784.274) -- 0:00:56
111000 -- (-783.893) [-783.748] (-790.201) (-785.550) * (-788.417) (-788.479) (-783.713) [-790.937] -- 0:00:56
111500 -- (-784.827) (-786.188) [-784.674] (-788.133) * [-785.322] (-786.372) (-786.416) (-790.663) -- 0:00:55
112000 -- (-783.193) (-784.486) [-785.230] (-786.334) * (-784.709) (-783.843) [-785.389] (-786.920) -- 0:00:55
112500 -- (-785.538) [-786.916] (-784.516) (-785.072) * (-784.656) [-785.410] (-784.110) (-785.440) -- 0:00:55
113000 -- (-785.783) (-784.547) [-784.130] (-784.556) * [-785.457] (-784.655) (-784.004) (-785.301) -- 0:00:54
113500 -- (-786.193) (-785.367) (-784.689) [-786.561] * (-783.656) [-784.153] (-785.404) (-785.087) -- 0:00:54
114000 -- (-786.321) (-784.886) [-783.498] (-787.017) * (-784.170) (-784.721) (-785.153) [-788.994] -- 0:00:54
114500 -- (-783.567) [-787.583] (-785.296) (-786.807) * (-783.611) [-784.046] (-783.340) (-787.055) -- 0:00:54
115000 -- [-783.937] (-786.714) (-784.617) (-786.953) * (-784.016) (-788.699) [-782.926] (-785.890) -- 0:00:53
Average standard deviation of split frequencies: 0.016897
115500 -- (-785.317) (-787.184) [-784.464] (-786.638) * (-786.700) (-784.329) (-784.223) [-784.274] -- 0:00:53
116000 -- (-785.547) (-785.641) [-786.824] (-785.057) * [-783.628] (-787.738) (-783.897) (-786.717) -- 0:00:53
116500 -- [-784.961] (-784.832) (-785.688) (-785.179) * (-787.513) (-785.919) (-787.268) [-784.794] -- 0:00:53
117000 -- (-785.110) (-785.465) (-784.848) [-784.295] * (-787.306) [-785.062] (-786.007) (-784.492) -- 0:00:52
117500 -- (-785.178) [-784.270] (-786.945) (-782.821) * (-786.841) (-786.590) (-786.786) [-789.759] -- 0:00:52
118000 -- (-784.484) (-784.877) (-787.028) [-783.357] * (-784.400) (-788.050) (-787.652) [-783.931] -- 0:00:52
118500 -- (-784.830) [-785.532] (-783.840) (-783.109) * (-784.991) (-784.247) [-784.182] (-785.086) -- 0:00:52
119000 -- (-783.820) (-789.674) (-783.479) [-784.817] * (-785.232) (-785.549) (-789.086) [-783.773] -- 0:00:51
119500 -- [-783.814] (-784.636) (-786.112) (-784.437) * [-784.370] (-784.837) (-787.020) (-784.737) -- 0:00:51
120000 -- (-792.968) [-785.848] (-785.113) (-785.533) * (-786.205) (-787.265) (-785.913) [-785.189] -- 0:00:51
Average standard deviation of split frequencies: 0.018014
120500 -- (-787.563) [-784.122] (-783.358) (-787.041) * (-786.258) (-787.587) [-783.880] (-783.645) -- 0:00:51
121000 -- [-785.109] (-786.647) (-783.916) (-790.173) * (-786.516) (-785.237) (-786.178) [-784.280] -- 0:00:50
121500 -- (-784.840) [-784.987] (-783.530) (-786.909) * (-783.900) (-785.021) [-783.705] (-785.232) -- 0:00:50
122000 -- (-785.824) (-784.715) (-783.485) [-783.907] * [-784.400] (-784.067) (-788.105) (-785.672) -- 0:00:50
122500 -- (-785.942) (-783.843) (-783.430) [-784.078] * [-787.246] (-787.479) (-786.103) (-784.475) -- 0:00:50
123000 -- (-784.936) [-783.793] (-786.267) (-785.293) * (-783.899) [-786.075] (-788.563) (-783.802) -- 0:00:49
123500 -- (-786.833) (-789.694) (-787.970) [-785.594] * [-785.065] (-783.120) (-787.219) (-784.432) -- 0:00:56
124000 -- (-789.924) (-784.221) (-789.176) [-783.872] * (-783.566) (-783.811) (-785.712) [-786.345] -- 0:00:56
124500 -- (-787.675) [-784.988] (-786.915) (-787.335) * [-783.881] (-784.793) (-785.292) (-785.547) -- 0:00:56
125000 -- (-785.228) (-785.184) [-785.148] (-785.447) * (-785.953) (-784.246) (-785.238) [-785.530] -- 0:00:56
Average standard deviation of split frequencies: 0.017816
125500 -- (-783.553) [-784.480] (-785.768) (-784.324) * (-784.326) (-787.142) [-785.549] (-783.397) -- 0:00:55
126000 -- (-786.210) (-787.795) [-785.794] (-784.255) * (-784.860) [-784.726] (-783.569) (-785.443) -- 0:00:55
126500 -- (-786.338) (-783.936) [-785.336] (-784.674) * (-786.636) (-786.061) (-784.266) [-785.710] -- 0:00:55
127000 -- [-785.166] (-784.576) (-785.369) (-787.326) * [-783.341] (-785.611) (-786.906) (-785.613) -- 0:00:54
127500 -- [-785.881] (-787.022) (-785.403) (-787.949) * (-783.503) (-785.012) [-785.398] (-784.817) -- 0:00:54
128000 -- (-784.607) (-785.605) [-783.911] (-787.579) * (-784.508) (-786.525) (-788.707) [-785.170] -- 0:00:54
128500 -- (-784.380) (-785.690) [-785.058] (-785.099) * (-784.521) (-783.800) (-785.565) [-784.101] -- 0:00:54
129000 -- (-785.917) [-783.955] (-783.883) (-785.112) * (-785.032) (-784.441) (-784.050) [-785.237] -- 0:00:54
129500 -- (-788.534) (-785.396) [-784.204] (-786.432) * [-785.773] (-784.986) (-785.323) (-785.447) -- 0:00:53
130000 -- (-786.234) (-783.385) (-784.771) [-786.445] * (-785.557) [-784.556] (-786.837) (-785.005) -- 0:00:53
Average standard deviation of split frequencies: 0.019413
130500 -- [-784.570] (-784.628) (-783.484) (-784.949) * (-785.754) (-784.676) (-785.581) [-787.192] -- 0:00:53
131000 -- [-783.732] (-784.541) (-785.107) (-787.296) * (-786.013) (-784.013) (-787.485) [-786.697] -- 0:00:53
131500 -- (-784.428) (-786.556) [-785.569] (-786.674) * (-784.800) (-783.916) [-784.303] (-789.030) -- 0:00:52
132000 -- (-784.612) (-786.209) (-790.277) [-784.864] * (-786.022) (-783.117) [-784.844] (-785.133) -- 0:00:52
132500 -- (-785.265) (-786.238) (-786.109) [-784.974] * (-783.960) (-784.539) (-787.403) [-786.131] -- 0:00:52
133000 -- (-786.206) (-786.872) [-784.000] (-783.236) * [-785.782] (-784.985) (-787.060) (-783.939) -- 0:00:52
133500 -- [-787.172] (-785.324) (-789.098) (-784.211) * [-784.328] (-783.835) (-783.967) (-786.500) -- 0:00:51
134000 -- (-784.935) (-784.592) (-785.065) [-784.453] * (-784.989) [-784.772] (-785.468) (-784.873) -- 0:00:51
134500 -- [-785.935] (-784.350) (-786.656) (-784.666) * (-784.540) (-786.191) [-783.729] (-786.627) -- 0:00:51
135000 -- (-784.283) (-787.014) [-786.689] (-784.038) * [-786.011] (-783.720) (-787.203) (-787.178) -- 0:00:51
Average standard deviation of split frequencies: 0.021585
135500 -- (-787.743) [-785.535] (-787.335) (-784.311) * (-786.339) (-784.616) (-785.167) [-783.612] -- 0:00:51
136000 -- (-785.844) [-784.754] (-785.023) (-785.600) * (-784.131) (-785.971) (-786.756) [-784.439] -- 0:00:50
136500 -- [-784.318] (-787.030) (-787.509) (-784.690) * (-783.458) (-784.915) (-784.060) [-784.313] -- 0:00:50
137000 -- (-784.321) [-784.096] (-784.480) (-783.449) * (-786.428) (-784.737) (-784.543) [-789.575] -- 0:00:50
137500 -- (-785.229) (-784.869) (-790.405) [-784.652] * (-794.361) (-785.611) [-783.557] (-790.641) -- 0:00:50
138000 -- (-785.030) (-784.724) (-785.963) [-785.538] * (-785.932) (-785.077) (-782.903) [-785.077] -- 0:00:49
138500 -- [-788.868] (-783.642) (-784.918) (-783.932) * (-787.443) (-785.282) [-787.827] (-787.246) -- 0:00:49
139000 -- (-786.318) [-783.994] (-784.702) (-785.197) * (-783.377) [-784.217] (-787.811) (-788.767) -- 0:00:49
139500 -- (-784.020) (-785.191) (-783.748) [-788.001] * (-784.354) [-784.795] (-790.133) (-784.000) -- 0:00:49
140000 -- (-785.076) (-785.443) (-784.886) [-784.665] * (-786.722) [-784.647] (-789.608) (-786.720) -- 0:00:55
Average standard deviation of split frequencies: 0.022621
140500 -- (-783.567) (-787.358) (-785.219) [-783.388] * (-786.953) (-784.265) (-785.301) [-785.283] -- 0:00:55
141000 -- [-783.429] (-786.992) (-786.666) (-785.328) * (-783.665) [-785.579] (-783.816) (-784.948) -- 0:00:54
141500 -- (-784.337) (-788.764) (-787.410) [-783.557] * (-784.359) (-789.898) [-784.062] (-784.384) -- 0:00:54
142000 -- (-786.310) (-785.401) (-788.218) [-784.390] * (-785.726) [-789.244] (-787.249) (-785.752) -- 0:00:54
142500 -- [-787.088] (-788.791) (-787.011) (-785.307) * (-785.223) (-786.475) (-785.874) [-786.761] -- 0:00:54
143000 -- [-783.128] (-786.380) (-789.071) (-784.876) * (-784.170) (-787.372) [-783.950] (-784.101) -- 0:00:53
143500 -- (-783.790) (-784.029) [-785.505] (-788.880) * (-783.224) (-791.129) (-784.260) [-784.312] -- 0:00:53
144000 -- (-790.103) (-785.672) (-786.330) [-789.998] * (-784.284) (-786.832) [-784.872] (-785.201) -- 0:00:53
144500 -- (-785.285) (-784.416) [-785.940] (-788.497) * (-783.889) [-783.634] (-784.357) (-789.181) -- 0:00:53
145000 -- (-784.541) [-786.859] (-786.695) (-786.451) * (-785.738) [-787.019] (-785.215) (-788.240) -- 0:00:53
Average standard deviation of split frequencies: 0.022279
145500 -- (-784.977) [-787.550] (-783.964) (-786.078) * (-784.414) [-785.478] (-787.691) (-784.412) -- 0:00:52
146000 -- (-784.296) (-783.684) (-787.359) [-783.254] * (-784.783) (-785.514) (-784.400) [-787.391] -- 0:00:52
146500 -- (-788.810) (-787.255) (-784.291) [-783.920] * (-785.689) (-784.178) (-783.944) [-784.022] -- 0:00:52
147000 -- (-786.638) (-783.967) [-784.987] (-785.798) * (-785.284) [-786.712] (-784.982) (-784.109) -- 0:00:52
147500 -- (-784.755) (-785.829) (-786.296) [-789.375] * (-783.918) (-788.456) (-783.346) [-785.267] -- 0:00:52
148000 -- [-786.027] (-787.905) (-785.137) (-784.243) * (-784.260) [-785.795] (-784.535) (-784.027) -- 0:00:51
148500 -- (-784.268) [-784.630] (-786.910) (-783.750) * (-786.035) (-787.207) (-784.026) [-784.934] -- 0:00:51
149000 -- (-783.366) (-787.607) [-783.916] (-785.454) * (-787.146) (-783.806) [-783.459] (-784.140) -- 0:00:51
149500 -- (-784.351) (-788.523) [-784.867] (-786.398) * (-789.550) [-783.765] (-784.733) (-786.794) -- 0:00:51
150000 -- [-784.394] (-787.312) (-785.372) (-786.193) * (-785.626) (-784.475) (-783.689) [-784.762] -- 0:00:51
Average standard deviation of split frequencies: 0.020806
150500 -- (-786.336) (-784.829) (-785.047) [-789.416] * (-786.192) (-785.445) (-790.549) [-784.853] -- 0:00:50
151000 -- (-787.726) (-785.492) [-785.320] (-793.025) * (-784.768) (-786.220) [-792.310] (-784.873) -- 0:00:50
151500 -- (-786.282) (-789.490) (-785.949) [-787.244] * (-784.581) (-785.028) (-786.874) [-783.692] -- 0:00:50
152000 -- [-784.117] (-786.294) (-783.793) (-783.921) * (-785.120) (-784.752) (-785.804) [-785.093] -- 0:00:50
152500 -- (-784.486) [-785.225] (-785.928) (-783.933) * (-784.219) (-783.190) (-785.310) [-786.703] -- 0:00:50
153000 -- (-784.146) (-785.963) (-785.808) [-783.625] * (-783.346) (-784.398) [-789.546] (-788.174) -- 0:00:49
153500 -- (-785.076) (-785.329) [-784.367] (-783.679) * (-789.318) (-785.835) (-790.344) [-786.631] -- 0:00:49
154000 -- (-783.587) (-784.746) [-784.194] (-788.805) * (-787.592) [-784.051] (-784.423) (-786.599) -- 0:00:49
154500 -- [-785.701] (-788.574) (-788.300) (-784.105) * (-788.122) [-784.130] (-785.174) (-784.529) -- 0:00:49
155000 -- (-783.931) (-787.993) [-784.634] (-789.500) * (-785.481) [-784.413] (-787.523) (-784.444) -- 0:00:49
Average standard deviation of split frequencies: 0.017268
155500 -- (-783.854) (-785.710) (-783.820) [-784.062] * (-784.462) [-784.009] (-790.050) (-787.361) -- 0:00:48
156000 -- [-784.448] (-791.495) (-786.575) (-783.068) * (-784.509) (-783.720) [-783.945] (-785.980) -- 0:00:48
156500 -- (-792.881) (-790.399) [-785.784] (-784.564) * (-788.304) [-785.921] (-784.332) (-784.157) -- 0:00:53
157000 -- (-786.226) (-784.679) (-788.416) [-787.941] * [-785.952] (-786.293) (-785.083) (-786.048) -- 0:00:53
157500 -- (-784.754) (-789.605) [-786.418] (-783.646) * [-783.956] (-784.927) (-783.470) (-784.673) -- 0:00:53
158000 -- (-784.935) (-784.092) [-785.462] (-783.691) * (-787.050) [-783.569] (-786.037) (-783.549) -- 0:00:53
158500 -- (-786.415) [-789.874] (-785.418) (-786.060) * [-786.461] (-784.955) (-787.605) (-784.219) -- 0:00:53
159000 -- (-785.096) [-787.260] (-786.232) (-786.394) * (-787.058) (-784.310) (-788.853) [-790.161] -- 0:00:52
159500 -- (-790.075) (-785.532) [-787.412] (-784.938) * [-788.095] (-787.292) (-791.305) (-787.375) -- 0:00:52
160000 -- (-784.497) (-787.211) [-785.330] (-784.120) * (-786.506) (-785.158) (-787.453) [-787.477] -- 0:00:52
Average standard deviation of split frequencies: 0.016463
160500 -- (-786.524) (-786.509) [-784.957] (-784.204) * [-785.464] (-785.509) (-789.177) (-787.037) -- 0:00:52
161000 -- (-784.762) (-783.408) [-783.943] (-784.795) * (-786.512) [-783.320] (-786.736) (-785.479) -- 0:00:52
161500 -- (-785.277) (-785.819) [-784.902] (-784.119) * (-788.408) (-785.956) [-784.951] (-783.589) -- 0:00:51
162000 -- (-783.902) [-788.547] (-787.373) (-787.640) * (-783.797) (-784.328) [-784.313] (-784.136) -- 0:00:51
162500 -- (-785.072) (-784.070) [-787.427] (-785.007) * [-785.503] (-786.304) (-785.121) (-785.958) -- 0:00:51
163000 -- [-783.745] (-785.580) (-784.769) (-785.690) * (-783.710) [-785.984] (-784.402) (-789.862) -- 0:00:51
163500 -- [-784.483] (-784.078) (-783.748) (-784.793) * [-784.294] (-790.649) (-784.732) (-786.318) -- 0:00:51
164000 -- [-784.052] (-787.322) (-786.664) (-783.988) * (-786.123) (-785.980) (-783.053) [-784.556] -- 0:00:50
164500 -- (-789.916) (-785.468) (-783.226) [-784.872] * (-790.163) [-788.515] (-785.962) (-785.110) -- 0:00:50
165000 -- (-787.523) (-784.359) (-791.879) [-785.031] * (-784.135) [-783.673] (-784.629) (-786.583) -- 0:00:50
Average standard deviation of split frequencies: 0.016187
165500 -- (-787.240) (-783.984) [-785.565] (-786.878) * [-784.437] (-787.371) (-787.950) (-783.651) -- 0:00:50
166000 -- (-784.448) (-784.042) [-785.177] (-786.315) * (-784.043) (-783.797) [-783.741] (-784.147) -- 0:00:50
166500 -- [-783.990] (-783.989) (-784.875) (-786.766) * (-785.801) (-784.641) [-785.128] (-785.221) -- 0:00:50
167000 -- (-785.046) (-784.033) [-785.098] (-787.887) * [-785.421] (-786.646) (-785.506) (-785.649) -- 0:00:49
167500 -- [-784.355] (-784.850) (-784.867) (-785.430) * (-785.584) (-785.860) [-784.758] (-785.740) -- 0:00:49
168000 -- (-787.361) (-789.907) [-785.108] (-786.182) * [-787.206] (-784.919) (-783.884) (-784.459) -- 0:00:49
168500 -- (-784.647) (-792.779) [-783.487] (-785.356) * (-787.539) (-784.244) (-783.522) [-785.138] -- 0:00:49
169000 -- [-785.310] (-784.165) (-784.771) (-784.290) * (-788.030) [-784.821] (-785.327) (-783.872) -- 0:00:49
169500 -- (-787.441) (-786.450) [-787.187] (-786.660) * (-786.645) (-785.864) [-786.767] (-783.871) -- 0:00:48
170000 -- (-783.819) [-787.899] (-785.444) (-783.952) * (-785.660) (-783.592) (-785.863) [-783.430] -- 0:00:48
Average standard deviation of split frequencies: 0.013665
170500 -- (-786.242) (-785.822) (-790.214) [-787.924] * (-785.230) [-783.425] (-786.701) (-784.092) -- 0:00:48
171000 -- (-784.506) [-784.015] (-786.103) (-783.504) * (-785.488) [-784.905] (-783.942) (-787.192) -- 0:00:48
171500 -- [-789.624] (-788.454) (-788.790) (-786.541) * (-788.006) (-783.910) [-788.423] (-786.050) -- 0:00:48
172000 -- (-789.319) (-784.376) [-789.111] (-786.662) * (-785.914) (-783.769) (-786.488) [-783.476] -- 0:00:48
172500 -- [-790.662] (-783.010) (-786.514) (-784.194) * (-786.144) (-783.215) (-785.803) [-783.387] -- 0:00:47
173000 -- (-790.398) [-783.649] (-785.320) (-784.801) * [-783.875] (-785.702) (-786.642) (-783.975) -- 0:00:52
173500 -- (-787.015) (-783.909) [-785.157] (-786.841) * [-784.125] (-787.011) (-785.345) (-783.229) -- 0:00:52
174000 -- (-787.341) (-783.945) (-785.807) [-783.470] * (-785.259) [-788.812] (-787.175) (-787.266) -- 0:00:52
174500 -- [-785.644] (-786.635) (-784.030) (-783.614) * (-787.397) (-788.146) (-788.573) [-789.145] -- 0:00:52
175000 -- (-784.567) [-787.938] (-788.920) (-784.627) * (-784.676) [-785.329] (-784.911) (-785.824) -- 0:00:51
Average standard deviation of split frequencies: 0.015267
175500 -- (-786.560) [-785.707] (-785.883) (-783.791) * (-788.700) (-785.680) (-787.374) [-785.192] -- 0:00:51
176000 -- (-788.370) [-783.862] (-784.736) (-783.939) * (-794.293) (-784.240) [-784.497] (-783.648) -- 0:00:51
176500 -- (-786.197) (-784.241) [-783.861] (-785.035) * (-788.250) (-786.373) (-785.545) [-784.994] -- 0:00:51
177000 -- (-785.007) (-784.395) (-784.640) [-786.347] * [-784.790] (-786.197) (-785.378) (-784.045) -- 0:00:51
177500 -- [-786.296] (-786.882) (-786.618) (-785.363) * (-782.885) (-788.406) [-785.492] (-787.131) -- 0:00:50
178000 -- [-789.201] (-783.876) (-788.051) (-784.199) * (-784.515) (-788.542) (-790.281) [-784.854] -- 0:00:50
178500 -- (-784.852) [-788.582] (-787.153) (-783.441) * [-787.326] (-786.745) (-783.665) (-785.277) -- 0:00:50
179000 -- (-787.467) [-787.852] (-784.420) (-784.127) * (-785.200) (-785.716) (-785.697) [-783.312] -- 0:00:50
179500 -- (-783.844) [-783.845] (-784.094) (-786.379) * (-788.007) [-783.964] (-785.613) (-784.077) -- 0:00:50
180000 -- (-785.118) (-786.820) (-787.036) [-790.389] * [-785.084] (-786.346) (-787.710) (-786.997) -- 0:00:50
Average standard deviation of split frequencies: 0.014969
180500 -- (-784.132) (-783.979) [-784.932] (-786.708) * (-783.887) (-790.317) (-786.994) [-783.909] -- 0:00:49
181000 -- [-784.176] (-784.433) (-785.715) (-785.683) * [-784.124] (-785.281) (-787.982) (-784.725) -- 0:00:49
181500 -- (-783.629) [-786.206] (-785.921) (-786.012) * (-782.869) [-788.135] (-785.898) (-786.000) -- 0:00:49
182000 -- [-786.180] (-784.667) (-786.370) (-785.627) * [-783.565] (-788.140) (-784.501) (-783.587) -- 0:00:49
182500 -- (-784.489) (-783.926) (-785.215) [-784.776] * (-783.657) (-787.365) [-786.814] (-784.696) -- 0:00:49
183000 -- (-784.773) (-784.598) (-785.153) [-790.520] * (-783.576) (-785.411) (-789.383) [-783.571] -- 0:00:49
183500 -- (-785.312) (-784.486) [-784.583] (-785.479) * [-783.247] (-786.404) (-785.583) (-790.270) -- 0:00:48
184000 -- (-783.890) [-784.700] (-785.326) (-786.289) * (-784.602) [-788.248] (-784.040) (-786.072) -- 0:00:48
184500 -- (-784.178) (-784.670) (-786.565) [-784.667] * (-784.835) (-787.653) [-785.251] (-783.541) -- 0:00:48
185000 -- (-787.256) (-784.058) (-787.599) [-783.333] * (-785.626) (-785.351) [-783.728] (-786.343) -- 0:00:48
Average standard deviation of split frequencies: 0.013813
185500 -- [-788.015] (-788.163) (-784.495) (-786.556) * (-783.617) (-785.906) (-785.665) [-783.953] -- 0:00:48
186000 -- (-786.391) [-783.208] (-784.695) (-786.728) * (-784.237) [-787.235] (-783.582) (-786.302) -- 0:00:48
186500 -- [-784.047] (-783.587) (-783.624) (-788.394) * (-788.168) (-785.852) [-784.482] (-788.553) -- 0:00:47
187000 -- (-782.993) (-786.292) (-784.405) [-787.325] * (-783.507) (-788.358) (-784.181) [-784.470] -- 0:00:47
187500 -- (-790.438) [-784.685] (-786.346) (-784.079) * (-783.451) (-785.402) [-785.861] (-791.884) -- 0:00:47
188000 -- (-784.918) (-783.527) (-785.549) [-786.898] * (-784.224) (-790.418) (-785.790) [-784.295] -- 0:00:47
188500 -- (-784.664) (-784.442) [-784.764] (-784.009) * [-783.900] (-789.228) (-785.122) (-789.136) -- 0:00:47
189000 -- (-783.266) (-785.148) [-783.272] (-783.638) * [-784.468] (-783.521) (-786.349) (-787.235) -- 0:00:47
189500 -- [-784.755] (-785.279) (-783.639) (-783.662) * (-784.869) [-784.178] (-783.925) (-785.183) -- 0:00:51
190000 -- (-784.051) (-787.425) (-783.863) [-783.742] * (-783.131) (-786.183) [-783.321] (-787.004) -- 0:00:51
Average standard deviation of split frequencies: 0.013273
190500 -- (-786.881) [-784.954] (-784.589) (-784.704) * (-783.184) [-785.315] (-783.747) (-784.770) -- 0:00:50
191000 -- (-786.454) [-785.931] (-784.493) (-785.688) * (-784.467) [-785.182] (-787.453) (-784.378) -- 0:00:50
191500 -- (-783.650) [-784.084] (-784.755) (-783.843) * (-784.261) (-784.866) (-786.039) [-785.943] -- 0:00:50
192000 -- (-783.075) (-783.820) (-783.351) [-784.465] * (-784.040) [-786.923] (-784.163) (-791.444) -- 0:00:50
192500 -- (-783.443) (-787.417) (-783.339) [-783.194] * (-784.883) (-785.776) [-783.130] (-785.623) -- 0:00:50
193000 -- (-785.709) [-784.905] (-787.923) (-783.309) * [-786.748] (-785.485) (-783.917) (-785.713) -- 0:00:50
193500 -- (-785.830) (-783.831) (-783.608) [-784.128] * (-784.297) (-785.440) [-783.381] (-786.396) -- 0:00:50
194000 -- (-785.304) (-788.507) (-785.224) [-783.841] * [-785.371] (-785.364) (-785.080) (-785.994) -- 0:00:49
194500 -- (-783.703) [-786.021] (-785.649) (-794.560) * (-785.159) (-786.657) [-787.561] (-786.111) -- 0:00:49
195000 -- [-784.069] (-785.589) (-783.988) (-783.692) * [-786.035] (-789.391) (-783.730) (-784.166) -- 0:00:49
Average standard deviation of split frequencies: 0.013924
195500 -- [-783.600] (-787.548) (-784.548) (-787.496) * (-787.334) (-785.029) [-783.766] (-785.514) -- 0:00:49
196000 -- (-784.137) (-784.719) [-783.495] (-785.691) * (-789.021) [-785.109] (-788.808) (-784.736) -- 0:00:49
196500 -- (-786.645) [-784.207] (-783.365) (-786.028) * (-785.739) [-783.035] (-784.061) (-786.412) -- 0:00:49
197000 -- [-784.318] (-784.275) (-783.382) (-786.360) * (-786.088) [-786.722] (-784.049) (-783.950) -- 0:00:48
197500 -- (-784.740) [-786.791] (-784.394) (-783.783) * (-788.232) (-786.561) (-783.920) [-784.112] -- 0:00:48
198000 -- (-784.728) (-785.419) (-786.396) [-786.846] * (-785.566) (-786.289) (-785.229) [-785.313] -- 0:00:48
198500 -- (-784.242) (-785.913) [-784.103] (-785.285) * (-785.953) (-786.612) [-783.718] (-785.029) -- 0:00:48
199000 -- [-786.087] (-789.440) (-784.069) (-784.679) * (-783.641) [-784.837] (-786.947) (-784.861) -- 0:00:48
199500 -- (-785.518) (-787.359) [-785.077] (-787.738) * [-784.774] (-785.389) (-783.699) (-785.656) -- 0:00:48
200000 -- [-785.750] (-787.806) (-784.536) (-788.631) * (-785.275) [-784.119] (-785.422) (-783.320) -- 0:00:48
Average standard deviation of split frequencies: 0.015455
200500 -- [-785.220] (-785.343) (-786.540) (-786.183) * (-784.975) (-786.706) [-784.949] (-783.588) -- 0:00:47
201000 -- [-783.548] (-783.674) (-785.296) (-787.456) * (-784.723) (-785.810) [-785.011] (-785.000) -- 0:00:47
201500 -- (-784.096) (-784.952) (-785.746) [-787.640] * (-787.108) (-785.366) [-784.392] (-784.537) -- 0:00:47
202000 -- (-787.754) [-783.932] (-784.564) (-787.621) * (-788.091) (-785.842) [-784.512] (-784.432) -- 0:00:47
202500 -- (-784.115) (-785.953) [-784.888] (-787.160) * (-785.705) (-785.072) [-785.481] (-785.985) -- 0:00:47
203000 -- (-784.353) [-784.177] (-787.809) (-787.847) * [-783.352] (-785.450) (-787.737) (-788.148) -- 0:00:47
203500 -- (-785.695) [-785.671] (-789.026) (-784.504) * [-785.563] (-784.374) (-784.527) (-787.552) -- 0:00:46
204000 -- (-787.108) (-786.272) [-784.463] (-785.208) * [-785.014] (-783.192) (-785.134) (-785.037) -- 0:00:46
204500 -- [-786.404] (-786.747) (-786.476) (-785.649) * (-787.985) (-783.239) [-786.932] (-786.156) -- 0:00:46
205000 -- (-786.753) (-788.250) [-787.391] (-787.773) * (-784.568) (-787.228) [-784.353] (-786.337) -- 0:00:46
Average standard deviation of split frequencies: 0.014453
205500 -- (-785.903) (-786.251) (-789.760) [-785.531] * [-783.389] (-783.974) (-784.639) (-786.471) -- 0:00:46
206000 -- (-785.960) (-783.722) (-789.619) [-782.927] * (-785.310) (-785.170) [-784.732] (-785.699) -- 0:00:50
206500 -- (-785.679) (-784.597) [-783.755] (-787.224) * (-784.877) (-788.344) (-787.471) [-786.761] -- 0:00:49
207000 -- (-785.565) [-785.800] (-783.069) (-789.044) * (-787.459) [-787.060] (-785.594) (-786.148) -- 0:00:49
207500 -- (-794.773) [-787.909] (-783.090) (-784.467) * [-786.819] (-785.124) (-784.869) (-785.890) -- 0:00:49
208000 -- (-792.158) [-784.280] (-785.967) (-785.860) * (-783.259) (-785.272) [-785.140] (-785.843) -- 0:00:49
208500 -- (-790.984) [-786.578] (-784.925) (-786.313) * (-784.326) (-784.627) (-784.772) [-784.228] -- 0:00:49
209000 -- (-783.929) (-785.963) (-786.413) [-786.657] * [-788.284] (-786.263) (-784.759) (-787.104) -- 0:00:49
209500 -- (-786.101) (-786.660) (-787.822) [-786.047] * (-785.423) [-785.209] (-784.655) (-785.574) -- 0:00:49
210000 -- (-787.020) [-785.821] (-785.351) (-785.052) * (-785.322) (-786.037) [-788.123] (-783.529) -- 0:00:48
Average standard deviation of split frequencies: 0.014839
210500 -- (-785.989) [-787.120] (-786.445) (-787.219) * (-786.127) [-784.427] (-784.526) (-784.540) -- 0:00:48
211000 -- (-787.239) (-785.338) (-786.399) [-788.023] * (-788.055) (-786.028) (-785.159) [-783.483] -- 0:00:48
211500 -- (-788.805) [-784.714] (-782.993) (-786.475) * (-788.245) (-784.520) [-783.894] (-786.722) -- 0:00:48
212000 -- [-784.809] (-788.960) (-792.126) (-791.565) * (-787.063) (-785.307) [-783.945] (-785.227) -- 0:00:48
212500 -- (-783.343) [-785.577] (-788.414) (-790.142) * [-790.028] (-786.848) (-784.094) (-783.228) -- 0:00:48
213000 -- (-787.010) (-786.097) [-785.975] (-786.711) * (-786.329) [-789.831] (-783.125) (-783.658) -- 0:00:48
213500 -- [-786.311] (-784.258) (-786.751) (-784.489) * (-786.010) (-787.619) [-784.794] (-783.883) -- 0:00:47
214000 -- [-784.738] (-784.519) (-788.188) (-783.426) * [-784.890] (-786.829) (-785.174) (-783.255) -- 0:00:47
214500 -- [-784.231] (-783.509) (-786.306) (-785.233) * (-786.398) (-785.843) [-786.505] (-785.463) -- 0:00:47
215000 -- (-784.224) (-788.996) (-783.861) [-784.150] * (-786.612) (-787.140) [-785.117] (-784.949) -- 0:00:47
Average standard deviation of split frequencies: 0.014358
215500 -- (-783.320) (-785.931) [-784.011] (-784.367) * (-785.987) (-786.755) (-785.091) [-784.999] -- 0:00:47
216000 -- (-786.666) [-787.715] (-783.932) (-787.716) * (-789.884) (-786.551) [-784.668] (-785.842) -- 0:00:47
216500 -- (-785.643) (-784.032) [-786.326] (-786.485) * (-787.017) [-785.428] (-783.850) (-784.885) -- 0:00:47
217000 -- (-785.283) (-785.450) [-785.541] (-787.355) * (-785.915) (-783.028) [-786.496] (-785.341) -- 0:00:46
217500 -- (-788.253) (-783.824) [-787.343] (-785.320) * (-788.768) (-789.833) (-784.313) [-785.493] -- 0:00:46
218000 -- [-787.582] (-784.097) (-786.436) (-785.327) * (-790.238) [-787.457] (-784.901) (-784.195) -- 0:00:46
218500 -- (-785.567) (-784.361) [-787.590] (-789.402) * (-786.766) (-785.448) [-785.250] (-783.207) -- 0:00:46
219000 -- (-787.665) (-788.809) [-790.796] (-784.801) * (-784.695) [-787.825] (-785.126) (-783.706) -- 0:00:46
219500 -- (-784.760) (-787.978) (-787.031) [-787.296] * (-788.751) (-785.135) (-786.775) [-784.110] -- 0:00:46
220000 -- (-786.723) [-787.032] (-786.862) (-784.265) * (-784.517) [-787.412] (-792.385) (-787.953) -- 0:00:46
Average standard deviation of split frequencies: 0.013830
220500 -- (-784.463) (-783.831) (-785.775) [-786.323] * (-785.630) (-786.917) [-784.814] (-783.905) -- 0:00:45
221000 -- (-784.829) (-787.622) (-783.784) [-784.957] * (-784.328) (-787.817) (-789.868) [-787.485] -- 0:00:45
221500 -- (-785.276) (-787.064) (-784.822) [-784.104] * (-787.394) [-783.253] (-784.694) (-785.686) -- 0:00:45
222000 -- (-785.243) [-783.349] (-786.832) (-792.064) * (-785.202) [-783.284] (-793.680) (-785.141) -- 0:00:45
222500 -- (-787.380) [-783.240] (-784.238) (-787.359) * (-785.618) (-786.297) (-785.639) [-784.175] -- 0:00:48
223000 -- (-784.655) (-783.556) [-783.923] (-784.623) * (-783.822) (-786.994) (-787.008) [-785.830] -- 0:00:48
223500 -- (-784.835) (-788.527) (-784.229) [-785.712] * (-783.209) (-784.388) [-783.237] (-789.084) -- 0:00:48
224000 -- (-783.822) (-785.646) (-784.060) [-788.546] * (-785.709) (-786.261) [-784.148] (-785.744) -- 0:00:48
224500 -- (-784.188) (-785.030) (-784.207) [-784.417] * [-784.251] (-784.981) (-783.401) (-784.871) -- 0:00:48
225000 -- (-785.644) (-797.580) [-784.301] (-783.632) * (-783.623) (-784.723) [-783.055] (-784.347) -- 0:00:48
Average standard deviation of split frequencies: 0.014601
225500 -- (-785.155) [-786.805] (-785.201) (-783.516) * [-786.748] (-784.735) (-785.386) (-784.472) -- 0:00:48
226000 -- [-784.082] (-784.418) (-786.858) (-784.087) * (-785.865) (-787.952) [-785.979] (-786.592) -- 0:00:47
226500 -- [-784.735] (-786.707) (-785.857) (-784.028) * (-785.789) (-787.017) (-786.417) [-784.681] -- 0:00:47
227000 -- (-785.088) (-784.519) (-787.365) [-783.831] * (-784.088) (-785.070) [-785.716] (-787.005) -- 0:00:47
227500 -- (-787.930) (-784.644) [-785.126] (-783.467) * [-784.539] (-787.409) (-785.223) (-783.083) -- 0:00:47
228000 -- (-784.370) (-783.885) (-786.899) [-785.692] * [-783.912] (-785.011) (-784.416) (-783.364) -- 0:00:47
228500 -- (-784.429) [-786.217] (-789.831) (-787.619) * (-785.119) (-783.164) (-783.118) [-784.747] -- 0:00:47
229000 -- [-787.198] (-786.938) (-784.417) (-786.426) * [-784.182] (-788.239) (-783.472) (-783.955) -- 0:00:47
229500 -- (-785.344) (-786.677) (-787.701) [-790.207] * [-783.957] (-784.445) (-788.400) (-786.377) -- 0:00:47
230000 -- (-786.580) (-787.506) [-786.358] (-783.530) * (-783.554) [-783.711] (-787.394) (-790.190) -- 0:00:46
Average standard deviation of split frequencies: 0.013738
230500 -- [-785.531] (-789.776) (-783.800) (-785.600) * (-783.932) (-785.216) [-783.927] (-783.212) -- 0:00:46
231000 -- (-784.823) [-787.234] (-783.341) (-787.887) * (-783.241) (-783.061) (-786.121) [-784.478] -- 0:00:46
231500 -- (-783.736) (-786.524) [-783.283] (-785.734) * (-783.345) [-783.653] (-792.678) (-786.309) -- 0:00:46
232000 -- (-783.189) [-787.213] (-790.193) (-785.110) * (-783.396) [-784.455] (-788.982) (-786.535) -- 0:00:46
232500 -- (-785.838) [-785.540] (-788.632) (-786.462) * (-784.919) (-784.626) (-784.608) [-785.969] -- 0:00:46
233000 -- (-784.948) [-785.901] (-786.764) (-786.650) * [-785.480] (-783.774) (-786.596) (-787.197) -- 0:00:46
233500 -- (-784.260) [-785.787] (-786.842) (-784.735) * (-783.936) [-784.404] (-784.002) (-784.523) -- 0:00:45
234000 -- [-784.162] (-786.627) (-786.463) (-784.983) * (-783.764) (-786.741) (-785.127) [-783.397] -- 0:00:45
234500 -- (-785.845) (-788.246) (-783.411) [-785.972] * (-783.231) [-789.366] (-784.087) (-783.555) -- 0:00:45
235000 -- [-786.002] (-783.847) (-783.902) (-785.278) * (-786.506) [-783.724] (-783.587) (-787.532) -- 0:00:45
Average standard deviation of split frequencies: 0.014823
235500 -- (-784.792) [-785.224] (-783.858) (-787.108) * (-784.916) (-785.127) [-785.074] (-787.913) -- 0:00:45
236000 -- [-788.254] (-785.799) (-786.790) (-786.222) * [-785.685] (-785.035) (-788.338) (-784.176) -- 0:00:45
236500 -- (-785.921) [-783.808] (-785.082) (-786.767) * (-784.422) (-784.729) [-793.350] (-783.970) -- 0:00:45
237000 -- (-784.399) (-785.142) [-784.439] (-783.825) * (-787.850) (-784.881) [-787.173] (-784.443) -- 0:00:45
237500 -- (-783.942) (-785.485) (-785.691) [-785.983] * (-787.633) (-784.797) [-783.726] (-783.761) -- 0:00:44
238000 -- (-783.205) (-787.288) [-784.201] (-788.000) * (-785.908) (-786.582) [-785.754] (-783.895) -- 0:00:44
238500 -- (-784.240) (-786.905) (-785.732) [-785.749] * (-787.186) (-784.894) [-785.577] (-790.934) -- 0:00:44
239000 -- (-788.257) [-786.083] (-784.661) (-787.083) * [-783.314] (-785.078) (-783.966) (-786.508) -- 0:00:44
239500 -- [-784.143] (-783.964) (-784.117) (-787.471) * (-784.316) [-786.786] (-784.113) (-784.668) -- 0:00:47
240000 -- (-789.173) [-784.081] (-783.498) (-786.943) * (-786.739) (-784.140) (-785.930) [-785.522] -- 0:00:47
Average standard deviation of split frequencies: 0.014799
240500 -- (-787.565) [-786.800] (-784.548) (-783.577) * (-787.219) [-784.593] (-784.855) (-785.128) -- 0:00:47
241000 -- (-787.563) [-787.109] (-785.271) (-784.421) * (-783.681) (-786.917) (-785.194) [-785.952] -- 0:00:47
241500 -- (-786.651) [-783.952] (-787.231) (-788.093) * (-786.561) (-784.915) [-784.465] (-788.627) -- 0:00:47
242000 -- (-783.391) (-788.549) [-792.509] (-786.657) * (-785.509) [-784.550] (-784.654) (-784.382) -- 0:00:46
242500 -- (-783.370) (-786.501) (-784.225) [-790.815] * [-785.705] (-790.565) (-784.932) (-787.575) -- 0:00:46
243000 -- (-784.312) (-786.948) (-784.000) [-785.131] * (-787.580) (-787.903) [-784.579] (-787.329) -- 0:00:46
243500 -- (-785.065) [-789.376] (-785.452) (-786.705) * (-786.496) (-785.196) [-783.694] (-783.588) -- 0:00:46
244000 -- (-784.342) [-783.704] (-785.159) (-784.718) * (-789.068) (-786.262) (-784.601) [-784.189] -- 0:00:46
244500 -- (-783.028) (-788.422) (-785.842) [-784.059] * (-786.542) (-785.078) [-783.709] (-789.358) -- 0:00:46
245000 -- (-784.988) (-783.590) (-785.282) [-785.546] * (-787.011) [-783.119] (-786.604) (-784.002) -- 0:00:46
Average standard deviation of split frequencies: 0.015426
245500 -- (-786.246) (-783.025) [-784.659] (-785.415) * (-783.514) [-784.194] (-785.529) (-786.966) -- 0:00:46
246000 -- (-786.230) (-783.207) [-783.935] (-784.786) * [-784.055] (-787.451) (-784.456) (-789.231) -- 0:00:45
246500 -- (-787.983) (-783.286) [-784.490] (-786.075) * (-785.032) (-787.647) (-785.370) [-786.431] -- 0:00:45
247000 -- (-785.390) [-784.382] (-788.475) (-784.834) * [-785.738] (-787.647) (-784.445) (-784.082) -- 0:00:45
247500 -- (-785.127) [-783.577] (-787.620) (-783.307) * (-790.105) (-785.906) [-783.767] (-785.425) -- 0:00:45
248000 -- (-786.116) (-784.374) (-784.623) [-784.011] * (-785.950) (-785.668) (-784.651) [-787.388] -- 0:00:45
248500 -- (-785.168) [-784.345] (-784.551) (-784.322) * (-787.896) (-785.128) [-784.997] (-783.973) -- 0:00:45
249000 -- (-785.624) [-783.673] (-784.301) (-783.714) * (-785.627) (-789.615) [-785.340] (-786.678) -- 0:00:45
249500 -- (-784.606) (-783.925) (-786.347) [-785.355] * [-785.261] (-787.586) (-785.985) (-784.477) -- 0:00:45
250000 -- (-783.410) (-786.083) (-784.658) [-784.201] * (-783.962) (-785.610) [-786.603] (-784.798) -- 0:00:45
Average standard deviation of split frequencies: 0.014731
250500 -- [-784.657] (-785.404) (-785.184) (-785.464) * [-785.118] (-785.556) (-786.260) (-784.627) -- 0:00:44
251000 -- (-785.473) (-786.173) (-785.531) [-785.641] * (-785.045) (-786.386) [-787.311] (-786.218) -- 0:00:44
251500 -- (-785.014) (-785.070) [-787.733] (-783.973) * (-788.447) [-787.366] (-785.719) (-784.268) -- 0:00:44
252000 -- (-785.132) [-786.486] (-785.390) (-787.800) * (-784.642) (-786.290) (-787.781) [-785.533] -- 0:00:44
252500 -- (-787.709) [-784.068] (-785.922) (-784.510) * (-785.199) [-784.675] (-784.684) (-788.471) -- 0:00:44
253000 -- (-783.487) (-788.874) (-786.477) [-785.747] * (-783.305) (-785.167) (-785.482) [-785.466] -- 0:00:44
253500 -- (-786.807) (-786.150) (-789.721) [-783.914] * (-784.754) (-784.128) (-792.367) [-786.891] -- 0:00:44
254000 -- (-785.012) [-785.730] (-786.694) (-783.617) * [-788.159] (-787.219) (-786.120) (-785.818) -- 0:00:44
254500 -- (-784.984) (-788.748) (-785.145) [-785.483] * [-783.241] (-783.028) (-785.596) (-785.510) -- 0:00:43
255000 -- [-787.003] (-786.193) (-786.255) (-784.903) * [-783.186] (-783.857) (-784.438) (-784.044) -- 0:00:43
Average standard deviation of split frequencies: 0.013606
255500 -- (-783.894) (-786.177) [-784.391] (-784.604) * [-785.349] (-785.248) (-784.664) (-786.287) -- 0:00:46
256000 -- (-783.585) (-787.066) [-783.517] (-784.628) * (-785.037) [-785.813] (-784.882) (-784.372) -- 0:00:46
256500 -- (-783.815) (-785.254) [-787.102] (-784.579) * (-785.779) [-784.258] (-786.886) (-786.447) -- 0:00:46
257000 -- [-784.164] (-784.457) (-789.174) (-786.037) * [-783.908] (-784.202) (-788.131) (-784.885) -- 0:00:46
257500 -- (-784.338) [-783.500] (-785.601) (-786.522) * (-789.076) (-784.170) [-785.265] (-787.316) -- 0:00:46
258000 -- (-784.642) (-786.998) [-785.803] (-785.779) * [-783.496] (-785.103) (-787.049) (-784.673) -- 0:00:46
258500 -- (-784.181) (-783.488) [-784.092] (-785.053) * (-784.199) (-783.965) (-785.861) [-783.355] -- 0:00:45
259000 -- (-784.375) (-785.594) (-786.377) [-787.028] * (-786.784) (-784.295) [-785.367] (-785.855) -- 0:00:45
259500 -- (-783.583) [-783.782] (-786.080) (-794.398) * (-785.325) [-784.139] (-792.069) (-786.600) -- 0:00:45
260000 -- (-785.044) (-784.221) [-789.476] (-785.656) * (-785.878) (-784.083) (-786.952) [-787.142] -- 0:00:45
Average standard deviation of split frequencies: 0.013463
260500 -- (-784.528) (-787.577) (-784.920) [-786.007] * (-785.459) (-786.424) (-785.908) [-786.633] -- 0:00:45
261000 -- [-785.486] (-786.042) (-786.573) (-787.685) * (-785.836) (-787.618) [-785.525] (-783.495) -- 0:00:45
261500 -- (-784.522) (-785.015) (-785.730) [-784.658] * [-784.714] (-786.123) (-786.212) (-783.809) -- 0:00:45
262000 -- [-785.474] (-784.808) (-788.711) (-783.696) * [-785.105] (-784.575) (-784.762) (-785.156) -- 0:00:45
262500 -- (-784.365) (-784.246) (-784.404) [-784.031] * [-784.417] (-786.147) (-784.340) (-787.438) -- 0:00:44
263000 -- (-784.224) (-782.908) (-783.396) [-783.564] * (-789.184) [-784.229] (-787.286) (-786.236) -- 0:00:44
263500 -- [-789.456] (-785.619) (-784.547) (-785.961) * [-783.661] (-784.216) (-784.390) (-789.410) -- 0:00:44
264000 -- (-784.804) [-786.441] (-783.083) (-786.130) * (-786.687) [-783.810] (-785.699) (-787.233) -- 0:00:44
264500 -- (-784.959) (-788.098) (-784.042) [-783.178] * [-786.446] (-786.626) (-785.134) (-787.308) -- 0:00:44
265000 -- [-787.783] (-787.198) (-785.943) (-783.834) * (-786.800) (-783.574) (-783.720) [-785.655] -- 0:00:44
Average standard deviation of split frequencies: 0.013245
265500 -- (-785.833) (-783.828) (-788.357) [-783.617] * (-788.995) (-783.365) [-786.973] (-785.154) -- 0:00:44
266000 -- [-790.745] (-790.296) (-788.367) (-786.362) * (-788.031) (-784.355) (-786.133) [-790.382] -- 0:00:44
266500 -- (-784.253) [-790.095] (-784.203) (-784.216) * (-786.865) (-786.324) [-785.593] (-784.905) -- 0:00:44
267000 -- (-786.307) (-786.665) [-783.965] (-788.718) * [-786.224] (-784.002) (-783.419) (-785.768) -- 0:00:43
267500 -- [-786.787] (-783.752) (-784.145) (-791.612) * (-785.214) [-784.070] (-787.168) (-784.075) -- 0:00:43
268000 -- (-784.452) (-786.376) (-784.105) [-784.590] * (-788.855) [-783.602] (-786.725) (-786.470) -- 0:00:43
268500 -- [-790.620] (-785.929) (-788.347) (-784.707) * (-785.585) [-785.314] (-786.791) (-788.114) -- 0:00:43
269000 -- (-784.596) (-784.792) [-784.478] (-784.800) * (-784.515) (-783.767) [-784.354] (-789.753) -- 0:00:43
269500 -- (-785.174) [-784.834] (-788.209) (-789.136) * [-785.111] (-788.487) (-787.075) (-786.997) -- 0:00:43
270000 -- [-789.067] (-785.012) (-787.245) (-790.520) * (-783.132) [-784.373] (-783.966) (-786.154) -- 0:00:43
Average standard deviation of split frequencies: 0.011804
270500 -- (-784.779) (-786.171) (-786.093) [-785.930] * (-783.412) (-784.614) (-789.255) [-783.482] -- 0:00:43
271000 -- (-784.899) (-784.393) [-784.979] (-783.269) * [-783.681] (-784.478) (-787.722) (-784.076) -- 0:00:43
271500 -- (-784.978) (-785.702) (-784.907) [-785.002] * [-783.082] (-786.547) (-784.807) (-785.490) -- 0:00:42
272000 -- [-784.758] (-785.762) (-788.713) (-785.224) * [-784.098] (-788.533) (-785.503) (-786.785) -- 0:00:45
272500 -- (-788.084) (-786.816) [-787.740] (-787.655) * (-784.549) (-784.685) [-785.139] (-784.938) -- 0:00:45
273000 -- (-785.883) (-787.444) [-785.976] (-785.620) * [-784.532] (-784.543) (-787.782) (-786.730) -- 0:00:45
273500 -- [-784.721] (-786.607) (-784.823) (-784.887) * [-784.847] (-789.780) (-786.919) (-785.010) -- 0:00:45
274000 -- (-784.253) (-785.917) [-784.498] (-785.334) * (-783.453) (-786.576) (-787.293) [-785.591] -- 0:00:45
274500 -- (-783.666) (-785.548) [-784.180] (-785.815) * (-783.640) (-791.682) (-787.419) [-784.348] -- 0:00:44
275000 -- [-784.732] (-784.555) (-784.143) (-786.563) * (-783.150) [-783.729] (-785.019) (-783.775) -- 0:00:44
Average standard deviation of split frequencies: 0.011481
275500 -- (-788.061) [-786.366] (-784.936) (-785.390) * (-783.652) (-783.647) (-787.030) [-786.355] -- 0:00:44
276000 -- [-785.242] (-790.680) (-784.071) (-786.707) * (-784.065) (-785.159) [-783.119] (-785.257) -- 0:00:44
276500 -- [-786.286] (-784.822) (-786.201) (-785.721) * (-786.624) (-791.392) (-783.368) [-783.879] -- 0:00:44
277000 -- [-784.026] (-784.879) (-783.970) (-787.611) * (-784.530) (-786.557) [-782.834] (-787.016) -- 0:00:44
277500 -- [-783.119] (-784.061) (-784.557) (-784.734) * (-783.839) [-788.542] (-783.079) (-787.918) -- 0:00:44
278000 -- (-784.334) (-785.330) [-785.780] (-786.990) * (-786.625) (-787.064) (-784.644) [-786.182] -- 0:00:44
278500 -- [-784.725] (-783.855) (-789.154) (-787.941) * [-785.065] (-787.030) (-783.646) (-784.288) -- 0:00:44
279000 -- (-784.030) [-783.762] (-784.823) (-785.276) * [-786.949] (-786.846) (-786.017) (-785.020) -- 0:00:43
279500 -- (-786.689) (-787.806) [-787.303] (-783.155) * (-786.178) (-786.748) [-786.149] (-785.758) -- 0:00:43
280000 -- (-786.523) [-784.959] (-793.336) (-783.990) * [-784.925] (-785.189) (-786.887) (-785.747) -- 0:00:43
Average standard deviation of split frequencies: 0.011570
280500 -- (-784.506) (-783.967) (-785.020) [-783.743] * (-784.346) [-785.252] (-784.225) (-783.522) -- 0:00:43
281000 -- (-785.721) (-786.234) (-783.893) [-783.649] * (-785.454) (-785.803) [-785.107] (-785.891) -- 0:00:43
281500 -- (-789.770) [-784.206] (-787.071) (-786.891) * [-784.657] (-785.492) (-786.280) (-791.757) -- 0:00:43
282000 -- (-788.428) (-784.258) (-785.941) [-787.309] * (-784.220) (-784.282) [-789.479] (-792.531) -- 0:00:43
282500 -- (-785.543) (-787.265) [-784.405] (-786.985) * (-787.955) (-786.304) (-789.711) [-788.698] -- 0:00:43
283000 -- (-784.133) [-786.129] (-787.954) (-787.382) * [-785.278] (-784.119) (-786.914) (-783.399) -- 0:00:43
283500 -- [-784.056] (-784.607) (-789.459) (-788.014) * (-787.165) (-784.615) [-785.039] (-788.178) -- 0:00:42
284000 -- (-786.197) [-784.806] (-791.666) (-787.771) * (-784.086) [-784.475] (-784.162) (-786.080) -- 0:00:42
284500 -- (-785.105) [-785.553] (-788.228) (-783.925) * [-785.383] (-785.298) (-783.553) (-785.999) -- 0:00:42
285000 -- (-789.044) (-787.021) [-785.147] (-784.574) * (-786.740) (-789.177) [-783.775] (-785.181) -- 0:00:42
Average standard deviation of split frequencies: 0.011355
285500 -- (-790.160) [-787.191] (-784.924) (-785.191) * (-787.824) (-785.569) (-783.481) [-784.364] -- 0:00:42
286000 -- (-788.961) (-789.750) [-786.868] (-785.562) * (-788.128) (-786.492) [-784.704] (-786.629) -- 0:00:42
286500 -- (-784.314) (-788.036) [-784.895] (-783.199) * (-784.999) [-785.147] (-785.956) (-788.340) -- 0:00:42
287000 -- (-784.529) [-786.228] (-789.396) (-784.369) * (-787.625) (-783.618) (-783.493) [-784.830] -- 0:00:42
287500 -- (-785.021) [-787.810] (-784.015) (-786.535) * (-786.412) (-784.765) (-783.723) [-785.241] -- 0:00:42
288000 -- (-785.404) [-786.811] (-784.032) (-787.560) * (-783.984) [-786.716] (-783.846) (-785.958) -- 0:00:44
288500 -- (-784.583) (-786.967) (-786.889) [-783.077] * [-783.350] (-785.155) (-786.243) (-788.616) -- 0:00:44
289000 -- (-783.524) (-784.740) (-785.962) [-786.309] * (-788.061) (-783.874) (-785.891) [-786.057] -- 0:00:44
289500 -- (-786.365) [-784.324] (-785.529) (-783.827) * (-786.407) (-784.539) (-787.573) [-786.772] -- 0:00:44
290000 -- [-785.012] (-783.988) (-784.986) (-785.107) * (-789.014) (-786.655) [-787.985] (-784.869) -- 0:00:44
Average standard deviation of split frequencies: 0.012704
290500 -- (-792.205) (-786.943) [-784.117] (-786.172) * (-785.330) (-784.659) (-787.283) [-785.345] -- 0:00:43
291000 -- [-785.472] (-784.628) (-783.865) (-787.406) * (-784.563) (-783.831) (-784.452) [-786.956] -- 0:00:43
291500 -- (-784.948) (-784.793) (-784.188) [-784.817] * (-786.579) (-783.390) [-784.966] (-784.749) -- 0:00:43
292000 -- (-785.253) (-783.916) (-784.775) [-786.264] * (-786.487) (-783.255) [-785.875] (-785.954) -- 0:00:43
292500 -- (-789.533) (-785.930) (-785.608) [-783.464] * (-786.246) (-783.477) (-787.054) [-786.458] -- 0:00:43
293000 -- (-784.904) (-785.907) (-787.498) [-783.573] * (-785.511) (-783.454) (-785.465) [-785.424] -- 0:00:43
293500 -- (-786.904) (-785.600) [-785.319] (-783.350) * (-786.614) (-784.730) [-785.604] (-784.855) -- 0:00:43
294000 -- (-787.428) (-787.413) (-788.463) [-784.697] * (-788.917) (-785.801) (-787.949) [-786.070] -- 0:00:43
294500 -- (-787.257) [-786.114] (-783.767) (-783.694) * [-785.428] (-786.281) (-788.586) (-785.526) -- 0:00:43
295000 -- (-786.314) [-783.731] (-784.901) (-785.709) * (-786.665) [-784.005] (-785.402) (-785.584) -- 0:00:43
Average standard deviation of split frequencies: 0.013448
295500 -- (-785.097) (-785.161) (-784.395) [-784.077] * (-786.084) (-784.959) [-785.448] (-785.984) -- 0:00:42
296000 -- (-786.006) [-784.786] (-783.747) (-783.313) * (-784.947) (-783.388) (-784.302) [-785.780] -- 0:00:42
296500 -- (-786.925) (-784.919) (-784.348) [-784.410] * (-788.326) (-784.911) [-785.704] (-788.276) -- 0:00:42
297000 -- [-785.791] (-786.791) (-784.358) (-784.737) * (-786.377) (-784.482) (-784.656) [-785.316] -- 0:00:42
297500 -- [-786.193] (-786.932) (-783.387) (-789.293) * (-784.102) [-784.431] (-783.174) (-785.295) -- 0:00:42
298000 -- (-783.957) (-786.721) [-783.832] (-790.930) * (-784.913) [-785.347] (-784.704) (-784.237) -- 0:00:42
298500 -- [-785.505] (-786.870) (-784.219) (-785.390) * [-784.408] (-789.321) (-790.063) (-785.643) -- 0:00:42
299000 -- (-787.173) (-787.729) (-786.235) [-787.826] * (-784.291) (-787.761) (-783.864) [-787.487] -- 0:00:42
299500 -- (-787.275) [-784.721] (-786.433) (-786.476) * [-783.777] (-787.862) (-784.510) (-784.330) -- 0:00:42
300000 -- (-788.963) (-784.140) [-783.762] (-785.661) * (-786.063) (-786.700) (-784.114) [-785.289] -- 0:00:42
Average standard deviation of split frequencies: 0.013240
300500 -- (-783.765) (-783.328) [-783.398] (-788.467) * (-788.397) (-786.616) (-784.179) [-786.344] -- 0:00:41
301000 -- (-786.037) (-785.856) (-784.374) [-783.617] * (-785.619) (-787.718) (-784.894) [-783.813] -- 0:00:41
301500 -- (-785.010) (-785.894) [-784.145] (-783.275) * (-789.608) (-787.015) (-785.643) [-785.253] -- 0:00:41
302000 -- (-785.493) (-783.826) (-784.603) [-784.262] * [-786.414] (-790.538) (-785.042) (-784.830) -- 0:00:41
302500 -- (-785.324) (-784.019) [-785.109] (-785.389) * [-785.751] (-789.516) (-785.973) (-787.371) -- 0:00:41
303000 -- (-785.499) (-788.897) (-788.426) [-785.251] * (-784.239) (-786.290) [-783.602] (-786.164) -- 0:00:41
303500 -- [-787.631] (-784.649) (-784.994) (-783.366) * [-791.252] (-785.186) (-786.800) (-784.730) -- 0:00:41
304000 -- [-785.526] (-788.919) (-787.017) (-785.395) * (-786.974) (-784.745) (-786.830) [-785.031] -- 0:00:41
304500 -- (-784.666) (-789.913) (-785.091) [-783.610] * (-785.523) (-786.082) (-785.321) [-783.366] -- 0:00:43
305000 -- (-784.838) (-787.868) (-784.566) [-783.817] * [-785.267] (-785.277) (-790.012) (-786.678) -- 0:00:43
Average standard deviation of split frequencies: 0.012923
305500 -- (-784.733) [-785.242] (-788.616) (-787.931) * (-783.820) [-783.699] (-787.120) (-788.347) -- 0:00:43
306000 -- (-784.344) (-784.949) (-790.517) [-786.768] * (-784.392) (-784.252) (-786.867) [-784.642] -- 0:00:43
306500 -- [-784.210] (-785.643) (-790.800) (-785.024) * (-784.827) (-787.673) (-784.963) [-784.541] -- 0:00:42
307000 -- [-786.123] (-788.172) (-787.251) (-784.844) * (-786.794) (-786.919) (-786.165) [-783.355] -- 0:00:42
307500 -- (-784.331) (-786.013) (-786.436) [-785.690] * [-784.714] (-783.760) (-785.464) (-788.162) -- 0:00:42
308000 -- (-783.624) (-784.667) [-786.852] (-784.771) * [-785.073] (-785.366) (-784.717) (-785.634) -- 0:00:42
308500 -- (-787.334) (-784.437) [-784.814] (-784.771) * [-785.488] (-786.159) (-784.971) (-785.056) -- 0:00:42
309000 -- (-787.171) (-786.728) [-784.571] (-783.228) * (-784.904) [-785.000] (-783.882) (-784.657) -- 0:00:42
309500 -- [-783.695] (-786.052) (-784.700) (-785.011) * (-783.679) (-785.407) (-785.371) [-783.042] -- 0:00:42
310000 -- (-784.763) (-788.079) [-785.136] (-784.687) * (-783.811) (-784.761) [-784.677] (-784.279) -- 0:00:42
Average standard deviation of split frequencies: 0.013235
310500 -- (-791.295) (-785.039) [-785.094] (-785.356) * (-784.807) (-785.600) (-785.966) [-784.364] -- 0:00:42
311000 -- (-784.278) (-786.478) (-785.599) [-786.700] * (-784.787) (-788.490) [-784.445] (-784.055) -- 0:00:42
311500 -- (-788.704) (-787.044) [-784.603] (-786.340) * (-783.901) (-784.627) [-784.626] (-784.720) -- 0:00:41
312000 -- (-785.634) (-786.586) (-783.303) [-784.734] * (-786.328) (-786.203) [-783.171] (-786.969) -- 0:00:41
312500 -- (-787.595) (-785.094) (-789.933) [-785.360] * (-787.355) (-785.758) (-783.224) [-787.288] -- 0:00:41
313000 -- (-784.433) (-787.787) (-784.739) [-783.849] * (-785.060) (-784.577) (-784.087) [-788.770] -- 0:00:41
313500 -- (-784.934) (-785.155) [-783.471] (-783.692) * [-785.740] (-784.135) (-784.549) (-784.045) -- 0:00:41
314000 -- (-783.897) (-786.477) (-785.709) [-783.613] * (-783.719) (-784.700) (-785.349) [-785.023] -- 0:00:41
314500 -- [-783.909] (-786.084) (-785.380) (-785.620) * (-783.448) [-786.298] (-786.827) (-787.106) -- 0:00:41
315000 -- (-783.712) (-784.800) (-785.446) [-785.091] * (-784.074) [-786.338] (-784.517) (-784.763) -- 0:00:41
Average standard deviation of split frequencies: 0.013343
315500 -- (-785.854) (-785.872) [-784.943] (-785.416) * (-783.926) (-786.493) [-784.545] (-787.109) -- 0:00:41
316000 -- (-784.792) [-785.900] (-788.379) (-785.298) * (-786.964) (-784.431) (-784.838) [-784.452] -- 0:00:41
316500 -- (-784.043) (-785.672) [-783.625] (-784.387) * (-784.311) (-784.003) [-784.293] (-784.436) -- 0:00:41
317000 -- (-793.423) [-784.237] (-785.567) (-787.425) * (-785.172) (-784.743) [-782.947] (-784.202) -- 0:00:40
317500 -- [-787.017] (-784.036) (-783.898) (-786.894) * [-788.153] (-785.321) (-784.080) (-786.819) -- 0:00:40
318000 -- (-788.473) (-786.143) (-785.389) [-784.554] * (-786.129) (-784.014) (-785.579) [-786.344] -- 0:00:40
318500 -- (-783.517) (-787.911) [-783.466] (-785.107) * (-784.728) (-784.531) [-784.759] (-784.424) -- 0:00:40
319000 -- (-784.336) (-788.321) [-786.694] (-786.491) * (-787.250) (-785.428) [-787.118] (-784.486) -- 0:00:40
319500 -- (-783.902) [-784.647] (-786.298) (-784.153) * (-783.160) (-786.166) [-785.576] (-783.581) -- 0:00:40
320000 -- (-783.828) (-783.313) (-784.036) [-783.807] * [-783.763] (-784.511) (-784.587) (-784.673) -- 0:00:40
Average standard deviation of split frequencies: 0.012577
320500 -- (-783.765) [-785.094] (-788.216) (-783.382) * (-788.765) (-785.804) [-785.004] (-785.985) -- 0:00:40
321000 -- (-784.006) (-785.501) [-785.558] (-789.071) * (-785.454) (-784.993) (-785.389) [-783.382] -- 0:00:42
321500 -- (-785.115) [-787.012] (-793.073) (-783.899) * (-784.138) (-784.228) (-793.117) [-783.461] -- 0:00:42
322000 -- (-785.000) (-786.690) (-783.640) [-787.339] * (-784.918) (-784.126) (-784.200) [-782.926] -- 0:00:42
322500 -- [-785.217] (-786.151) (-792.575) (-792.128) * (-785.806) [-789.611] (-783.786) (-785.010) -- 0:00:42
323000 -- (-784.064) (-785.712) [-786.978] (-785.420) * (-785.967) [-785.900] (-783.611) (-785.562) -- 0:00:41
323500 -- [-783.812] (-784.762) (-788.513) (-784.315) * (-787.452) (-788.106) (-787.200) [-784.914] -- 0:00:41
324000 -- (-784.779) [-784.260] (-784.898) (-785.757) * (-789.846) (-787.760) [-785.039] (-789.385) -- 0:00:41
324500 -- (-789.501) [-784.344] (-787.101) (-786.368) * [-784.660] (-788.214) (-792.638) (-788.028) -- 0:00:41
325000 -- [-785.751] (-785.214) (-791.215) (-790.377) * (-786.963) [-784.473] (-788.782) (-788.891) -- 0:00:41
Average standard deviation of split frequencies: 0.013014
325500 -- (-785.804) [-787.274] (-787.198) (-785.086) * (-785.684) (-784.573) [-786.605] (-789.217) -- 0:00:41
326000 -- (-785.154) (-786.760) (-787.212) [-783.919] * (-786.048) (-787.074) (-784.332) [-784.888] -- 0:00:41
326500 -- (-785.798) (-785.956) [-786.507] (-783.801) * (-785.883) (-784.839) (-785.416) [-787.241] -- 0:00:41
327000 -- (-784.027) [-784.530] (-786.949) (-784.296) * [-784.638] (-783.619) (-792.203) (-791.299) -- 0:00:41
327500 -- (-785.582) [-784.171] (-787.056) (-783.972) * [-787.079] (-789.796) (-786.954) (-784.035) -- 0:00:41
328000 -- (-786.454) [-784.775] (-783.358) (-785.515) * (-783.173) [-785.208] (-783.357) (-785.169) -- 0:00:40
328500 -- [-785.993] (-783.685) (-786.125) (-788.586) * (-785.552) (-786.179) [-784.450] (-784.942) -- 0:00:40
329000 -- (-789.811) (-785.153) (-783.640) [-788.194] * [-783.286] (-783.445) (-789.251) (-783.469) -- 0:00:40
329500 -- (-784.654) [-783.853] (-785.422) (-785.327) * (-785.667) (-786.780) [-787.411] (-785.085) -- 0:00:40
330000 -- (-788.213) (-785.765) [-783.997] (-784.438) * (-789.125) [-785.321] (-786.379) (-783.906) -- 0:00:40
Average standard deviation of split frequencies: 0.013431
330500 -- (-788.867) [-784.416] (-784.282) (-786.189) * (-786.851) (-786.605) (-788.572) [-784.064] -- 0:00:40
331000 -- (-785.995) [-783.468] (-788.038) (-787.313) * (-784.969) (-785.069) (-785.507) [-784.300] -- 0:00:40
331500 -- [-783.764] (-788.062) (-788.336) (-786.586) * [-783.545] (-784.045) (-788.357) (-786.782) -- 0:00:40
332000 -- (-786.651) (-784.559) [-785.227] (-784.602) * (-783.819) [-786.891] (-788.635) (-787.951) -- 0:00:40
332500 -- (-784.679) (-784.124) (-783.256) [-783.426] * (-784.415) (-786.595) [-786.530] (-783.719) -- 0:00:40
333000 -- (-783.843) [-787.834] (-784.762) (-785.557) * (-786.685) [-785.592] (-783.498) (-785.863) -- 0:00:40
333500 -- [-784.335] (-786.987) (-785.337) (-785.563) * (-785.751) (-786.601) [-786.506] (-783.690) -- 0:00:39
334000 -- (-790.906) (-784.581) (-785.434) [-784.050] * (-786.771) (-785.995) (-785.395) [-783.347] -- 0:00:39
334500 -- (-789.426) (-785.630) (-785.367) [-783.935] * (-787.146) (-786.072) (-787.528) [-786.427] -- 0:00:39
335000 -- (-789.822) [-784.248] (-787.111) (-786.394) * (-792.052) [-783.111] (-787.746) (-786.678) -- 0:00:39
Average standard deviation of split frequencies: 0.012258
335500 -- (-786.802) [-791.511] (-783.907) (-785.558) * (-785.690) (-783.399) [-789.074] (-788.571) -- 0:00:39
336000 -- (-787.105) (-784.166) [-784.173] (-786.284) * (-787.322) (-783.365) [-784.220] (-789.821) -- 0:00:39
336500 -- (-786.660) (-788.452) [-784.243] (-785.402) * [-785.348] (-785.512) (-784.071) (-792.858) -- 0:00:39
337000 -- [-784.496] (-784.484) (-789.539) (-785.877) * (-784.798) (-783.358) (-786.877) [-786.451] -- 0:00:39
337500 -- (-785.190) [-784.932] (-783.654) (-783.978) * [-788.406] (-784.225) (-786.136) (-785.083) -- 0:00:41
338000 -- (-782.906) [-784.910] (-785.823) (-784.049) * (-784.502) [-783.946] (-783.334) (-786.613) -- 0:00:41
338500 -- (-783.925) (-786.661) [-785.984] (-788.925) * (-784.733) (-785.575) [-783.542] (-785.327) -- 0:00:41
339000 -- (-788.020) (-784.593) [-784.825] (-791.585) * [-785.353] (-784.565) (-784.253) (-783.939) -- 0:00:40
339500 -- (-786.721) (-788.017) (-785.487) [-784.047] * (-786.257) [-783.644] (-784.854) (-784.255) -- 0:00:40
340000 -- (-786.651) (-787.209) (-785.150) [-785.813] * (-785.318) (-783.501) [-787.450] (-785.725) -- 0:00:40
Average standard deviation of split frequencies: 0.010745
340500 -- [-783.762] (-792.171) (-785.214) (-783.252) * (-783.431) (-783.919) [-783.008] (-784.274) -- 0:00:40
341000 -- (-784.992) (-786.971) [-784.128] (-783.742) * (-785.298) (-791.391) [-784.725] (-785.303) -- 0:00:40
341500 -- [-783.520] (-786.579) (-785.401) (-784.051) * (-787.936) (-785.765) [-786.804] (-783.512) -- 0:00:40
342000 -- (-788.042) (-785.634) [-785.029] (-785.174) * [-787.690] (-785.951) (-786.209) (-786.599) -- 0:00:40
342500 -- (-787.148) [-783.185] (-784.467) (-785.582) * (-785.178) [-787.173] (-787.374) (-784.452) -- 0:00:40
343000 -- (-788.123) (-785.543) (-786.196) [-784.970] * [-787.242] (-785.576) (-787.868) (-783.389) -- 0:00:40
343500 -- (-785.558) (-786.146) (-784.718) [-784.447] * [-789.285] (-784.052) (-784.683) (-786.117) -- 0:00:40
344000 -- (-793.859) (-786.685) (-785.055) [-783.580] * (-784.824) (-785.136) [-786.415] (-788.444) -- 0:00:40
344500 -- (-787.208) (-783.000) (-784.830) [-784.358] * (-787.916) (-785.162) [-785.832] (-789.296) -- 0:00:39
345000 -- (-785.052) [-784.478] (-786.725) (-785.701) * [-787.013] (-786.291) (-784.901) (-786.451) -- 0:00:39
Average standard deviation of split frequencies: 0.011354
345500 -- [-783.894] (-784.757) (-786.117) (-789.510) * [-785.827] (-787.178) (-786.773) (-785.235) -- 0:00:39
346000 -- (-785.134) (-784.912) (-786.168) [-789.003] * (-787.303) (-785.673) [-784.484] (-784.652) -- 0:00:39
346500 -- (-784.728) (-786.242) (-785.080) [-786.501] * (-784.085) [-783.077] (-784.133) (-783.180) -- 0:00:39
347000 -- (-787.665) (-783.270) [-783.333] (-784.365) * (-787.413) (-785.083) (-784.447) [-786.725] -- 0:00:39
347500 -- (-785.837) [-783.805] (-785.287) (-784.540) * (-790.078) [-785.305] (-783.373) (-784.615) -- 0:00:39
348000 -- [-784.290] (-783.135) (-787.637) (-785.424) * (-787.120) (-783.554) [-786.245] (-786.336) -- 0:00:39
348500 -- (-784.647) [-784.275] (-784.032) (-785.264) * (-784.081) (-788.280) [-788.306] (-784.417) -- 0:00:39
349000 -- (-785.415) [-783.335] (-786.370) (-785.828) * (-783.788) [-783.191] (-784.851) (-784.656) -- 0:00:39
349500 -- (-785.577) (-784.289) (-784.262) [-783.909] * (-783.993) [-784.500] (-786.653) (-784.944) -- 0:00:39
350000 -- [-786.503] (-784.943) (-786.022) (-783.649) * (-783.995) (-783.175) [-785.411] (-784.537) -- 0:00:39
Average standard deviation of split frequencies: 0.011053
350500 -- (-785.342) [-789.779] (-785.387) (-789.980) * [-784.285] (-783.277) (-784.798) (-790.595) -- 0:00:38
351000 -- [-785.429] (-787.491) (-785.922) (-783.363) * (-784.199) [-788.270] (-787.697) (-784.785) -- 0:00:38
351500 -- (-784.991) [-785.633] (-786.918) (-785.537) * (-788.709) (-788.591) (-783.939) [-787.446] -- 0:00:38
352000 -- (-785.395) [-784.222] (-789.241) (-785.111) * (-788.471) [-787.968] (-785.210) (-786.768) -- 0:00:38
352500 -- (-785.612) (-783.774) (-786.009) [-786.786] * [-789.969] (-788.972) (-783.674) (-784.150) -- 0:00:38
353000 -- (-786.912) (-784.920) [-786.272] (-786.014) * (-785.773) (-784.822) (-789.723) [-783.427] -- 0:00:38
353500 -- (-784.911) [-784.996] (-783.277) (-787.387) * (-787.947) (-786.797) (-787.314) [-784.861] -- 0:00:38
354000 -- [-788.840] (-785.389) (-787.872) (-785.351) * (-784.466) [-789.053] (-784.462) (-784.790) -- 0:00:40
354500 -- (-790.741) (-785.275) (-786.572) [-787.177] * [-783.377] (-791.124) (-785.771) (-784.354) -- 0:00:40
355000 -- (-788.026) (-786.201) (-790.303) [-785.831] * (-784.252) [-786.047] (-788.205) (-784.993) -- 0:00:39
Average standard deviation of split frequencies: 0.011403
355500 -- (-787.132) [-786.616] (-789.008) (-783.872) * (-783.797) [-783.806] (-785.675) (-786.362) -- 0:00:39
356000 -- [-784.844] (-785.928) (-785.647) (-787.764) * (-785.520) [-784.982] (-784.786) (-783.720) -- 0:00:39
356500 -- (-789.869) (-784.601) (-784.284) [-783.036] * (-790.593) [-785.486] (-784.630) (-783.736) -- 0:00:39
357000 -- (-784.476) (-784.267) (-785.912) [-784.173] * [-785.732] (-789.583) (-782.946) (-784.520) -- 0:00:39
357500 -- (-785.186) (-783.961) (-786.959) [-785.091] * (-786.729) (-790.208) (-783.260) [-783.797] -- 0:00:39
358000 -- [-785.097] (-784.603) (-785.090) (-784.425) * (-787.388) [-787.055] (-790.969) (-787.115) -- 0:00:39
358500 -- (-785.564) (-784.560) [-785.038] (-787.756) * (-788.592) (-787.937) [-786.925] (-787.797) -- 0:00:39
359000 -- (-786.074) (-783.478) (-786.447) [-784.102] * (-784.137) (-786.415) [-787.981] (-786.908) -- 0:00:39
359500 -- (-783.562) (-785.398) [-785.791] (-790.653) * (-785.038) [-787.366] (-789.185) (-787.827) -- 0:00:39
360000 -- [-783.159] (-785.273) (-785.653) (-785.411) * (-784.461) (-786.214) [-784.613] (-785.867) -- 0:00:39
Average standard deviation of split frequencies: 0.011836
360500 -- (-784.884) (-786.836) [-786.295] (-785.440) * (-783.470) [-784.047] (-783.778) (-786.473) -- 0:00:39
361000 -- [-784.976] (-784.867) (-784.682) (-784.331) * (-786.726) [-784.583] (-785.240) (-784.985) -- 0:00:38
361500 -- [-793.776] (-789.049) (-783.578) (-785.428) * [-784.987] (-783.832) (-788.391) (-785.077) -- 0:00:38
362000 -- [-783.698] (-785.599) (-788.674) (-787.205) * (-787.024) [-784.881] (-784.892) (-788.643) -- 0:00:38
362500 -- (-783.770) (-785.333) [-785.932] (-787.107) * [-787.023] (-789.150) (-784.943) (-785.850) -- 0:00:38
363000 -- [-783.981] (-787.451) (-784.656) (-786.457) * (-786.145) [-785.987] (-785.137) (-786.451) -- 0:00:38
363500 -- (-785.085) (-783.862) [-787.433] (-787.902) * (-789.216) (-786.270) [-783.669] (-785.829) -- 0:00:38
364000 -- (-785.426) [-789.834] (-783.739) (-785.449) * (-784.383) (-784.682) (-785.966) [-783.952] -- 0:00:38
364500 -- (-785.286) [-790.030] (-785.744) (-784.730) * [-784.440] (-787.490) (-783.512) (-783.684) -- 0:00:38
365000 -- (-784.514) (-785.398) [-788.123] (-786.563) * (-784.932) (-790.104) (-784.696) [-784.212] -- 0:00:38
Average standard deviation of split frequencies: 0.012948
365500 -- (-784.602) (-784.699) (-785.769) [-786.170] * (-784.869) [-788.450] (-784.355) (-784.227) -- 0:00:38
366000 -- (-783.793) (-784.046) (-784.668) [-784.552] * [-783.759] (-788.649) (-784.578) (-783.695) -- 0:00:38
366500 -- (-785.574) (-785.450) (-784.352) [-783.043] * (-786.536) [-787.205] (-784.549) (-783.850) -- 0:00:38
367000 -- (-790.120) (-785.226) [-784.931] (-783.406) * (-786.280) (-783.525) [-788.886] (-784.775) -- 0:00:37
367500 -- (-784.643) (-783.798) [-784.062] (-783.379) * (-787.625) (-784.771) [-787.870] (-785.532) -- 0:00:37
368000 -- [-786.118] (-784.280) (-783.971) (-786.221) * [-792.346] (-783.706) (-785.953) (-784.326) -- 0:00:37
368500 -- (-785.591) (-783.922) (-786.108) [-785.723] * (-789.090) [-784.881] (-783.931) (-786.166) -- 0:00:37
369000 -- (-785.427) [-789.209] (-783.395) (-786.990) * (-786.993) (-784.306) [-783.615] (-785.436) -- 0:00:37
369500 -- [-785.486] (-787.366) (-785.088) (-783.209) * (-788.222) (-786.996) [-788.839] (-784.328) -- 0:00:37
370000 -- [-784.757] (-783.958) (-783.314) (-788.252) * (-785.325) (-785.663) (-786.348) [-786.226] -- 0:00:37
Average standard deviation of split frequencies: 0.012435
370500 -- (-783.499) [-787.702] (-785.740) (-786.742) * [-785.586] (-785.155) (-786.414) (-787.169) -- 0:00:39
371000 -- (-783.614) [-785.869] (-786.671) (-785.260) * (-784.178) (-785.870) [-785.133] (-784.500) -- 0:00:38
371500 -- (-785.300) (-785.210) [-785.664] (-784.789) * (-786.982) (-785.816) (-785.985) [-786.272] -- 0:00:38
372000 -- (-786.848) (-787.066) [-784.656] (-784.836) * (-785.518) [-783.762] (-783.601) (-787.109) -- 0:00:38
372500 -- (-785.528) (-784.393) [-783.067] (-784.498) * [-783.835] (-783.519) (-787.171) (-789.455) -- 0:00:38
373000 -- (-787.675) (-784.487) (-794.462) [-784.970] * (-787.246) [-784.576] (-784.131) (-788.386) -- 0:00:38
373500 -- [-783.382] (-786.521) (-790.608) (-784.794) * [-786.467] (-786.317) (-784.384) (-788.492) -- 0:00:38
374000 -- (-785.239) (-786.915) (-786.392) [-785.293] * (-787.592) (-787.135) [-784.680] (-785.572) -- 0:00:38
374500 -- (-783.471) [-784.469] (-785.854) (-783.356) * (-783.899) (-787.517) [-786.227] (-787.607) -- 0:00:38
375000 -- [-786.210] (-785.293) (-785.053) (-786.382) * (-789.311) (-787.623) [-786.924] (-785.898) -- 0:00:38
Average standard deviation of split frequencies: 0.011210
375500 -- (-784.601) (-786.472) [-783.867] (-784.336) * (-784.708) (-786.104) [-785.136] (-785.993) -- 0:00:38
376000 -- (-785.839) [-787.069] (-785.588) (-784.033) * (-793.028) (-785.286) [-785.757] (-784.064) -- 0:00:38
376500 -- (-785.512) [-783.943] (-786.842) (-784.005) * (-785.661) (-784.846) [-786.631] (-784.638) -- 0:00:38
377000 -- (-784.448) [-786.813] (-783.903) (-788.619) * (-784.107) [-787.149] (-786.552) (-783.633) -- 0:00:38
377500 -- (-783.605) (-785.201) (-784.890) [-785.196] * (-784.163) (-785.637) (-788.017) [-784.098] -- 0:00:37
378000 -- (-783.896) [-785.344] (-784.071) (-784.154) * (-787.509) (-785.258) (-784.192) [-783.952] -- 0:00:37
378500 -- (-787.770) (-785.253) (-784.434) [-784.152] * (-784.646) (-784.459) [-783.232] (-784.924) -- 0:00:37
379000 -- (-786.529) (-785.501) (-783.745) [-785.252] * (-784.677) (-786.748) (-784.032) [-786.519] -- 0:00:37
379500 -- (-784.803) (-784.908) [-787.638] (-785.886) * (-786.309) (-785.561) [-783.672] (-785.209) -- 0:00:37
380000 -- (-786.210) (-784.997) (-784.880) [-787.339] * (-789.237) (-787.518) (-790.239) [-785.687] -- 0:00:37
Average standard deviation of split frequencies: 0.011764
380500 -- [-786.441] (-785.682) (-786.937) (-788.168) * (-786.980) (-789.661) [-785.298] (-784.449) -- 0:00:37
381000 -- [-785.293] (-789.371) (-786.095) (-787.966) * (-784.409) [-786.323] (-787.405) (-784.296) -- 0:00:37
381500 -- (-787.905) [-794.261] (-785.779) (-786.620) * [-784.264] (-783.863) (-782.876) (-785.189) -- 0:00:37
382000 -- (-788.815) (-791.935) (-784.513) [-785.083] * (-784.733) (-782.977) (-783.494) [-783.907] -- 0:00:37
382500 -- [-786.906] (-786.637) (-784.864) (-785.795) * [-784.447] (-785.445) (-784.020) (-783.589) -- 0:00:37
383000 -- (-785.279) (-786.685) [-785.260] (-785.742) * (-783.672) (-785.931) [-785.406] (-784.615) -- 0:00:37
383500 -- (-782.981) (-784.168) [-785.404] (-785.303) * [-783.491] (-785.948) (-784.845) (-784.766) -- 0:00:36
384000 -- (-783.271) (-783.945) [-783.809] (-784.772) * (-784.093) [-783.205] (-783.808) (-783.883) -- 0:00:36
384500 -- (-783.436) [-783.994] (-784.443) (-785.026) * (-784.865) (-787.366) [-783.905] (-787.591) -- 0:00:36
385000 -- (-783.705) (-788.396) (-786.374) [-785.065] * [-784.371] (-784.675) (-784.467) (-789.206) -- 0:00:36
Average standard deviation of split frequencies: 0.011763
385500 -- (-784.277) (-788.372) (-784.835) [-785.644] * (-785.190) (-786.112) [-784.586] (-785.157) -- 0:00:36
386000 -- (-785.030) [-788.946] (-784.105) (-784.174) * (-785.255) [-785.967] (-786.547) (-786.879) -- 0:00:38
386500 -- [-785.998] (-784.591) (-787.365) (-784.789) * (-787.528) (-784.643) (-787.321) [-785.365] -- 0:00:38
387000 -- (-786.174) [-785.630] (-788.996) (-783.515) * (-786.851) [-783.961] (-787.426) (-785.561) -- 0:00:38
387500 -- [-784.754] (-786.120) (-783.678) (-786.103) * (-786.736) (-784.661) (-784.422) [-783.550] -- 0:00:37
388000 -- (-787.292) [-784.374] (-783.976) (-790.493) * (-785.426) (-783.136) (-783.310) [-784.025] -- 0:00:37
388500 -- [-786.458] (-784.331) (-787.990) (-785.488) * (-787.947) (-784.426) (-784.782) [-784.588] -- 0:00:37
389000 -- [-785.529] (-783.798) (-786.602) (-784.052) * (-786.892) (-783.429) [-783.541] (-787.091) -- 0:00:37
389500 -- (-787.196) [-784.413] (-787.621) (-784.440) * (-786.808) [-783.999] (-787.684) (-786.582) -- 0:00:37
390000 -- (-784.064) (-784.918) [-785.628] (-784.315) * (-784.382) (-787.412) [-785.245] (-786.871) -- 0:00:37
Average standard deviation of split frequencies: 0.011396
390500 -- (-786.900) (-785.927) [-788.008] (-784.870) * (-786.767) (-784.044) [-785.300] (-784.359) -- 0:00:37
391000 -- (-783.719) (-786.008) (-785.153) [-784.726] * [-784.805] (-783.740) (-785.340) (-786.136) -- 0:00:37
391500 -- [-783.645] (-785.909) (-784.510) (-786.855) * (-786.402) (-784.150) (-785.655) [-787.747] -- 0:00:37
392000 -- (-785.552) (-785.765) (-788.259) [-784.218] * (-788.864) (-783.803) (-788.721) [-784.640] -- 0:00:37
392500 -- [-784.193] (-784.476) (-788.489) (-788.584) * [-787.663] (-785.541) (-784.758) (-783.220) -- 0:00:37
393000 -- (-784.420) [-784.771] (-784.397) (-788.845) * (-783.864) (-785.994) [-787.534] (-783.835) -- 0:00:37
393500 -- (-787.195) [-785.090] (-784.369) (-788.418) * (-786.941) (-785.757) [-785.892] (-785.469) -- 0:00:36
394000 -- [-785.271] (-784.956) (-784.063) (-787.259) * [-785.552] (-789.426) (-785.100) (-784.905) -- 0:00:36
394500 -- [-787.404] (-785.264) (-786.068) (-786.521) * [-784.702] (-785.510) (-785.550) (-783.875) -- 0:00:36
395000 -- (-784.125) (-787.582) (-788.429) [-786.273] * (-784.492) (-783.199) (-785.837) [-783.228] -- 0:00:36
Average standard deviation of split frequencies: 0.012103
395500 -- (-783.764) (-787.078) (-788.265) [-789.306] * (-783.810) (-788.179) (-785.893) [-784.265] -- 0:00:36
396000 -- (-783.619) (-786.385) [-785.486] (-788.259) * (-787.244) (-784.973) [-783.652] (-783.632) -- 0:00:36
396500 -- (-786.788) (-784.816) [-790.172] (-786.659) * (-786.559) (-783.564) (-783.758) [-784.303] -- 0:00:36
397000 -- (-784.578) (-784.664) [-788.628] (-783.695) * (-785.430) [-785.654] (-783.851) (-785.713) -- 0:00:36
397500 -- (-787.350) (-784.483) [-785.510] (-787.216) * [-785.798] (-785.246) (-783.303) (-784.889) -- 0:00:36
398000 -- (-789.763) [-783.335] (-784.674) (-784.632) * (-784.128) (-791.033) [-785.329] (-784.513) -- 0:00:36
398500 -- (-785.979) (-788.073) (-785.096) [-784.901] * [-783.489] (-787.229) (-785.312) (-784.544) -- 0:00:36
399000 -- [-784.069] (-783.079) (-786.056) (-785.053) * (-787.522) (-784.751) [-787.004] (-783.984) -- 0:00:36
399500 -- (-784.207) (-788.302) (-785.551) [-785.691] * [-785.373] (-784.438) (-787.391) (-785.236) -- 0:00:36
400000 -- (-788.622) (-784.865) (-788.663) [-786.318] * (-787.513) (-784.887) [-783.896] (-783.263) -- 0:00:36
Average standard deviation of split frequencies: 0.012092
400500 -- (-787.722) (-783.297) (-787.502) [-782.956] * (-787.977) (-786.562) (-784.766) [-784.122] -- 0:00:35
401000 -- (-784.813) (-788.872) [-784.927] (-783.291) * (-785.614) (-784.217) (-785.672) [-784.373] -- 0:00:35
401500 -- (-787.489) [-785.953] (-787.824) (-784.011) * (-784.942) (-786.985) [-784.911] (-784.681) -- 0:00:35
402000 -- (-784.467) (-784.383) [-785.028] (-783.766) * (-787.621) [-788.060] (-786.161) (-783.717) -- 0:00:35
402500 -- [-785.587] (-784.148) (-783.150) (-787.314) * (-788.266) [-786.559] (-785.542) (-785.420) -- 0:00:37
403000 -- (-788.192) (-783.780) (-783.068) [-783.695] * (-785.585) (-786.065) [-785.178] (-785.022) -- 0:00:37
403500 -- (-784.075) (-785.738) (-784.182) [-786.523] * (-784.901) (-785.069) (-786.284) [-784.509] -- 0:00:36
404000 -- (-784.869) (-787.224) [-783.286] (-785.803) * (-787.652) (-785.255) (-784.533) [-783.386] -- 0:00:36
404500 -- (-786.097) (-787.024) (-783.955) [-786.575] * (-789.897) (-784.746) (-785.008) [-784.387] -- 0:00:36
405000 -- [-784.306] (-791.424) (-783.978) (-788.972) * (-785.730) (-784.306) [-790.380] (-784.179) -- 0:00:36
Average standard deviation of split frequencies: 0.011740
405500 -- [-784.783] (-784.884) (-784.836) (-785.589) * (-786.327) [-785.754] (-788.082) (-784.234) -- 0:00:36
406000 -- (-788.145) [-784.063] (-785.262) (-785.522) * [-786.401] (-785.403) (-786.207) (-782.898) -- 0:00:36
406500 -- (-784.665) (-784.725) [-786.648] (-786.234) * (-785.486) (-785.018) [-786.801] (-785.545) -- 0:00:36
407000 -- (-783.376) (-784.675) (-785.141) [-783.856] * (-787.977) [-789.351] (-784.930) (-787.396) -- 0:00:36
407500 -- [-787.005] (-785.278) (-785.209) (-783.264) * (-786.805) [-785.010] (-788.313) (-785.545) -- 0:00:36
408000 -- [-785.016] (-784.048) (-783.874) (-785.144) * (-784.689) (-786.087) [-786.225] (-784.292) -- 0:00:36
408500 -- (-784.665) [-784.438] (-785.896) (-784.493) * (-785.063) (-784.472) (-784.296) [-786.202] -- 0:00:36
409000 -- [-783.750] (-783.743) (-783.688) (-783.948) * (-784.756) [-783.176] (-785.919) (-784.844) -- 0:00:36
409500 -- [-784.216] (-786.366) (-784.510) (-784.266) * (-785.734) (-783.955) (-785.885) [-783.510] -- 0:00:36
410000 -- [-784.566] (-784.975) (-784.115) (-784.049) * (-786.031) [-784.036] (-789.764) (-783.547) -- 0:00:35
Average standard deviation of split frequencies: 0.012244
410500 -- (-786.622) (-789.672) (-786.861) [-783.351] * (-786.005) (-783.467) [-785.984] (-785.297) -- 0:00:35
411000 -- [-783.369] (-787.903) (-784.563) (-784.613) * (-784.979) [-783.552] (-785.049) (-786.548) -- 0:00:35
411500 -- (-783.291) (-785.934) (-785.219) [-783.885] * (-787.454) (-783.608) (-785.248) [-783.808] -- 0:00:35
412000 -- (-786.949) (-785.987) (-783.938) [-784.990] * (-786.634) (-787.683) [-783.661] (-790.598) -- 0:00:35
412500 -- (-787.278) [-783.362] (-786.541) (-784.956) * [-783.336] (-785.767) (-785.091) (-783.804) -- 0:00:35
413000 -- (-783.673) (-783.798) (-788.386) [-784.960] * (-785.212) (-785.148) [-784.966] (-784.393) -- 0:00:35
413500 -- [-784.371] (-785.843) (-786.196) (-788.951) * [-785.010] (-790.801) (-786.597) (-786.949) -- 0:00:35
414000 -- (-786.161) [-786.021] (-783.744) (-784.182) * [-783.507] (-786.457) (-784.020) (-784.513) -- 0:00:35
414500 -- (-785.525) (-785.783) [-783.847] (-785.418) * (-784.526) [-784.178] (-785.447) (-784.479) -- 0:00:35
415000 -- [-786.412] (-790.866) (-784.208) (-786.349) * (-785.379) (-785.079) (-784.222) [-783.695] -- 0:00:35
Average standard deviation of split frequencies: 0.012402
415500 -- (-785.155) [-785.689] (-785.825) (-783.884) * [-785.476] (-784.460) (-784.798) (-783.301) -- 0:00:35
416000 -- (-784.102) (-786.026) [-784.114] (-790.133) * (-784.213) [-784.347] (-783.535) (-784.933) -- 0:00:35
416500 -- [-786.048] (-785.018) (-784.572) (-786.221) * (-785.714) (-786.724) (-786.192) [-784.393] -- 0:00:35
417000 -- (-786.292) (-783.911) (-784.758) [-785.294] * (-783.365) [-783.637] (-784.742) (-785.266) -- 0:00:34
417500 -- (-784.233) [-783.733] (-784.675) (-784.552) * (-789.619) (-784.853) [-784.433] (-785.578) -- 0:00:34
418000 -- (-785.694) [-785.686] (-785.387) (-784.589) * (-793.568) (-785.207) [-784.153] (-785.964) -- 0:00:34
418500 -- (-784.529) [-783.412] (-785.109) (-787.265) * [-788.098] (-786.128) (-784.839) (-786.496) -- 0:00:36
419000 -- (-789.378) (-785.514) [-786.652] (-786.532) * (-784.353) [-790.187] (-787.436) (-784.747) -- 0:00:36
419500 -- (-784.311) (-786.634) [-788.361] (-790.710) * (-784.376) (-786.306) [-786.155] (-783.454) -- 0:00:35
420000 -- [-783.172] (-784.292) (-784.852) (-785.098) * (-784.513) (-786.727) [-784.368] (-793.228) -- 0:00:35
Average standard deviation of split frequencies: 0.012264
420500 -- (-783.172) (-785.864) [-786.542] (-783.959) * [-783.593] (-785.611) (-786.234) (-795.019) -- 0:00:35
421000 -- [-786.609] (-787.363) (-784.268) (-783.169) * (-787.093) (-786.309) [-784.548] (-784.483) -- 0:00:35
421500 -- (-785.513) [-785.531] (-784.097) (-790.177) * (-789.402) (-784.219) [-783.255] (-784.680) -- 0:00:35
422000 -- (-784.531) (-786.255) [-785.437] (-784.385) * [-785.391] (-784.508) (-783.453) (-785.434) -- 0:00:35
422500 -- (-786.107) (-785.935) (-783.845) [-784.044] * (-787.701) (-783.560) [-784.048] (-784.278) -- 0:00:35
423000 -- (-789.524) (-786.461) [-783.701] (-784.405) * (-791.946) [-785.910] (-787.167) (-785.496) -- 0:00:35
423500 -- (-787.338) (-784.544) [-784.007] (-786.256) * [-786.553] (-789.783) (-787.958) (-783.530) -- 0:00:35
424000 -- (-784.863) (-784.416) [-786.054] (-783.957) * [-784.319] (-786.834) (-784.859) (-785.353) -- 0:00:35
424500 -- (-785.138) (-783.617) [-783.079] (-788.403) * (-783.636) (-784.156) (-787.389) [-785.710] -- 0:00:35
425000 -- (-784.603) (-786.473) [-789.468] (-786.821) * (-782.997) [-786.067] (-785.716) (-783.567) -- 0:00:35
Average standard deviation of split frequencies: 0.011742
425500 -- (-784.272) (-783.597) (-788.526) [-787.817] * (-784.541) (-786.352) [-787.970] (-783.619) -- 0:00:35
426000 -- (-785.784) (-785.431) [-788.393] (-785.782) * (-787.971) (-789.243) [-788.108] (-786.092) -- 0:00:35
426500 -- (-783.274) (-785.883) (-789.091) [-787.236] * (-784.774) (-788.035) [-785.409] (-786.040) -- 0:00:34
427000 -- (-790.490) (-787.132) [-783.469] (-783.445) * (-784.015) [-785.431] (-782.978) (-785.779) -- 0:00:34
427500 -- (-784.697) (-785.084) (-785.432) [-783.315] * [-783.792] (-785.596) (-784.721) (-786.987) -- 0:00:34
428000 -- [-787.628] (-787.861) (-784.268) (-785.708) * (-787.255) (-788.075) [-784.599] (-784.884) -- 0:00:34
428500 -- [-784.506] (-786.588) (-785.795) (-784.179) * (-788.529) [-784.143] (-784.946) (-783.756) -- 0:00:34
429000 -- (-783.799) [-784.450] (-783.849) (-785.589) * [-787.006] (-787.368) (-784.831) (-785.069) -- 0:00:34
429500 -- (-787.187) [-786.582] (-783.627) (-784.503) * (-788.663) (-787.978) [-783.576] (-791.448) -- 0:00:34
430000 -- (-785.021) (-783.875) (-786.640) [-784.296] * (-785.734) (-786.856) [-783.695] (-786.881) -- 0:00:34
Average standard deviation of split frequencies: 0.011128
430500 -- (-784.892) (-786.019) [-784.931] (-789.039) * (-787.538) (-784.517) (-784.165) [-783.310] -- 0:00:34
431000 -- (-786.221) (-789.060) [-785.758] (-784.488) * [-786.884] (-786.018) (-785.408) (-785.445) -- 0:00:34
431500 -- [-784.684] (-786.519) (-785.809) (-784.484) * (-784.832) (-787.389) (-783.942) [-784.116] -- 0:00:34
432000 -- [-784.011] (-785.174) (-785.879) (-784.334) * (-785.010) (-785.562) (-783.380) [-786.507] -- 0:00:34
432500 -- [-784.502] (-784.786) (-783.711) (-786.210) * (-784.839) (-788.438) (-788.718) [-786.153] -- 0:00:34
433000 -- [-786.293] (-785.289) (-787.436) (-786.465) * (-786.421) (-785.687) [-782.986] (-786.016) -- 0:00:34
433500 -- (-784.654) (-785.463) [-785.837] (-785.197) * (-786.972) (-788.489) [-785.033] (-787.149) -- 0:00:33
434000 -- (-783.773) (-789.653) [-785.586] (-784.396) * (-785.149) (-784.704) [-785.978] (-784.617) -- 0:00:33
434500 -- (-783.853) (-784.249) (-785.385) [-784.485] * [-785.429] (-783.883) (-785.623) (-786.058) -- 0:00:33
435000 -- [-785.601] (-783.879) (-785.963) (-785.135) * (-784.655) (-783.637) (-784.019) [-786.709] -- 0:00:35
Average standard deviation of split frequencies: 0.010939
435500 -- (-783.843) [-785.022] (-784.197) (-785.264) * [-785.128] (-785.776) (-783.460) (-784.296) -- 0:00:34
436000 -- [-786.192] (-786.357) (-784.309) (-785.434) * (-786.371) (-785.492) (-784.293) [-785.006] -- 0:00:34
436500 -- (-785.859) [-785.490] (-784.636) (-785.401) * [-783.980] (-785.866) (-785.637) (-786.260) -- 0:00:34
437000 -- [-786.755] (-785.801) (-784.080) (-785.108) * [-785.446] (-784.901) (-785.415) (-784.799) -- 0:00:34
437500 -- [-786.948] (-785.591) (-786.473) (-786.115) * (-785.308) (-787.508) [-786.234] (-786.011) -- 0:00:34
438000 -- (-783.454) [-785.858] (-786.237) (-786.288) * (-784.529) [-783.855] (-783.631) (-786.323) -- 0:00:34
438500 -- (-784.382) (-783.908) (-784.607) [-785.452] * (-783.765) (-783.742) (-783.623) [-788.655] -- 0:00:34
439000 -- (-785.366) (-783.324) (-786.822) [-786.738] * (-785.080) (-786.025) [-783.617] (-784.456) -- 0:00:34
439500 -- [-784.311] (-785.069) (-791.448) (-788.927) * (-787.181) [-786.322] (-783.124) (-786.064) -- 0:00:34
440000 -- [-783.036] (-785.026) (-785.067) (-785.083) * [-785.901] (-784.438) (-785.654) (-787.880) -- 0:00:34
Average standard deviation of split frequencies: 0.010757
440500 -- (-784.090) [-785.483] (-784.224) (-786.078) * (-785.500) (-784.597) [-786.021] (-785.241) -- 0:00:34
441000 -- (-783.383) [-783.936] (-783.396) (-786.337) * (-786.557) (-786.466) [-783.689] (-784.772) -- 0:00:34
441500 -- [-785.809] (-788.004) (-784.734) (-784.896) * (-786.225) (-788.396) (-784.715) [-785.621] -- 0:00:34
442000 -- [-783.686] (-784.960) (-784.945) (-786.355) * (-787.139) (-787.431) (-784.198) [-783.443] -- 0:00:34
442500 -- (-783.349) [-784.238] (-784.395) (-784.055) * [-783.138] (-786.028) (-785.339) (-783.674) -- 0:00:34
443000 -- (-786.919) (-786.759) (-784.703) [-785.797] * (-784.373) [-785.856] (-785.484) (-785.393) -- 0:00:33
443500 -- (-784.289) (-784.890) [-783.950] (-787.802) * (-784.308) [-784.417] (-785.352) (-784.652) -- 0:00:33
444000 -- (-785.807) (-789.943) (-783.206) [-783.237] * (-786.895) (-788.483) (-787.215) [-783.422] -- 0:00:33
444500 -- (-783.786) (-787.398) (-784.992) [-783.843] * (-789.886) (-785.553) [-785.738] (-784.671) -- 0:00:33
445000 -- (-787.478) (-784.743) (-785.067) [-783.366] * (-786.713) [-783.574] (-784.145) (-783.497) -- 0:00:33
Average standard deviation of split frequencies: 0.011157
445500 -- (-785.044) [-785.008] (-783.483) (-784.401) * [-785.009] (-787.439) (-784.834) (-783.755) -- 0:00:33
446000 -- (-786.936) [-784.157] (-785.098) (-785.319) * [-783.059] (-789.196) (-783.991) (-784.734) -- 0:00:33
446500 -- [-785.752] (-784.861) (-784.093) (-784.767) * [-783.790] (-791.893) (-784.192) (-783.839) -- 0:00:33
447000 -- (-788.452) (-784.807) [-787.048] (-785.921) * (-786.968) [-784.408] (-782.955) (-783.667) -- 0:00:33
447500 -- (-790.258) [-784.440] (-782.908) (-786.368) * [-784.136] (-787.122) (-783.611) (-787.036) -- 0:00:33
448000 -- (-789.458) (-785.118) [-785.332] (-784.843) * (-786.433) (-785.841) [-786.391] (-785.759) -- 0:00:33
448500 -- [-786.887] (-784.149) (-784.293) (-784.716) * (-784.356) [-789.427] (-787.812) (-784.217) -- 0:00:33
449000 -- (-785.553) (-788.269) [-785.098] (-785.406) * [-788.373] (-792.338) (-786.883) (-783.613) -- 0:00:33
449500 -- (-786.596) (-783.081) [-785.022] (-787.710) * (-786.908) (-785.111) (-787.474) [-784.455] -- 0:00:33
450000 -- [-785.196] (-784.082) (-787.397) (-785.921) * [-783.944] (-785.179) (-784.643) (-784.421) -- 0:00:33
Average standard deviation of split frequencies: 0.010399
450500 -- (-787.103) (-787.697) (-789.670) [-788.122] * [-783.280] (-787.715) (-783.304) (-788.818) -- 0:00:32
451000 -- (-785.597) (-785.451) [-783.446] (-786.271) * (-784.080) (-784.005) [-784.392] (-792.047) -- 0:00:32
451500 -- [-785.807] (-785.125) (-784.354) (-785.896) * (-785.561) [-785.497] (-785.048) (-784.338) -- 0:00:34
452000 -- [-784.682] (-785.007) (-784.729) (-787.581) * [-784.625] (-786.273) (-783.672) (-786.900) -- 0:00:33
452500 -- (-786.275) (-784.539) (-787.337) [-784.894] * [-784.359] (-783.876) (-784.580) (-791.414) -- 0:00:33
453000 -- (-785.496) [-784.643] (-784.962) (-785.549) * (-783.653) [-786.422] (-789.504) (-789.692) -- 0:00:33
453500 -- (-784.121) [-784.289] (-787.076) (-784.716) * (-783.794) [-784.567] (-787.584) (-787.087) -- 0:00:33
454000 -- (-783.679) (-785.824) (-787.579) [-787.187] * (-788.170) (-784.292) (-789.552) [-785.185] -- 0:00:33
454500 -- (-785.630) [-783.466] (-784.623) (-787.764) * (-784.921) [-785.649] (-783.598) (-787.153) -- 0:00:33
455000 -- [-784.093] (-784.881) (-784.348) (-784.528) * (-789.845) (-785.458) [-783.410] (-783.775) -- 0:00:33
Average standard deviation of split frequencies: 0.009433
455500 -- (-786.420) (-784.482) (-785.825) [-783.608] * (-786.387) (-784.912) (-783.142) [-784.847] -- 0:00:33
456000 -- (-783.572) (-785.232) [-784.309] (-784.871) * [-785.336] (-788.127) (-784.372) (-783.615) -- 0:00:33
456500 -- [-785.546] (-785.049) (-785.053) (-788.325) * (-785.007) (-787.061) (-784.902) [-785.036] -- 0:00:33
457000 -- (-786.829) (-786.500) [-784.332] (-786.651) * [-784.565] (-787.450) (-786.222) (-786.620) -- 0:00:33
457500 -- (-785.264) [-786.277] (-784.302) (-786.400) * (-785.774) (-786.932) [-783.585] (-786.436) -- 0:00:33
458000 -- (-787.286) [-785.094] (-784.035) (-784.253) * (-783.434) (-787.010) [-785.512] (-783.194) -- 0:00:33
458500 -- (-784.884) [-785.377] (-789.172) (-784.962) * (-783.941) (-785.038) (-784.885) [-785.340] -- 0:00:33
459000 -- [-783.834] (-783.173) (-785.515) (-786.683) * (-784.976) (-785.052) (-785.797) [-785.400] -- 0:00:33
459500 -- (-784.374) (-786.890) (-786.304) [-784.756] * (-786.060) (-787.001) (-788.006) [-783.361] -- 0:00:32
460000 -- (-786.686) [-789.461] (-784.911) (-783.599) * (-787.508) (-787.259) (-783.460) [-784.469] -- 0:00:32
Average standard deviation of split frequencies: 0.010041
460500 -- (-783.225) (-784.388) [-784.839] (-783.648) * (-786.466) (-786.849) (-784.491) [-784.369] -- 0:00:32
461000 -- [-783.544] (-783.521) (-784.593) (-784.858) * (-784.651) (-786.145) [-783.851] (-784.388) -- 0:00:32
461500 -- (-789.520) [-785.235] (-783.880) (-786.275) * [-783.995] (-785.088) (-787.652) (-785.577) -- 0:00:32
462000 -- (-785.510) (-788.608) (-783.139) [-785.194] * (-786.351) (-785.077) (-784.991) [-785.054] -- 0:00:32
462500 -- (-789.359) [-786.846] (-783.880) (-782.976) * [-786.141] (-784.311) (-785.341) (-783.664) -- 0:00:32
463000 -- (-786.796) (-787.903) [-783.855] (-788.890) * (-785.658) (-786.924) [-784.621] (-783.184) -- 0:00:32
463500 -- (-785.011) [-783.940] (-785.210) (-783.393) * (-786.796) [-785.992] (-784.446) (-783.970) -- 0:00:32
464000 -- (-785.529) [-786.541] (-784.161) (-785.223) * [-784.730] (-788.660) (-784.846) (-786.240) -- 0:00:32
464500 -- [-785.938] (-789.429) (-789.504) (-787.067) * (-786.457) (-784.333) (-784.775) [-789.312] -- 0:00:32
465000 -- [-785.130] (-785.755) (-785.134) (-783.515) * [-783.957] (-783.375) (-785.394) (-790.221) -- 0:00:32
Average standard deviation of split frequencies: 0.009547
465500 -- (-786.848) (-786.234) [-788.818] (-783.422) * [-785.717] (-785.758) (-785.152) (-787.526) -- 0:00:32
466000 -- (-785.548) (-784.922) (-786.361) [-785.294] * (-784.834) [-783.294] (-784.863) (-783.262) -- 0:00:32
466500 -- (-784.959) (-783.589) (-785.591) [-786.400] * (-786.627) (-784.233) (-785.613) [-787.994] -- 0:00:32
467000 -- (-785.447) (-784.463) [-784.907] (-784.444) * (-783.383) (-785.655) [-783.621] (-784.112) -- 0:00:31
467500 -- [-785.447] (-788.156) (-785.008) (-784.068) * (-784.079) (-786.541) [-783.571] (-783.875) -- 0:00:31
468000 -- (-782.969) (-788.553) [-783.142] (-784.662) * (-785.911) [-784.176] (-788.348) (-788.319) -- 0:00:32
468500 -- (-785.521) (-783.751) [-783.555] (-787.115) * [-785.175] (-784.051) (-784.817) (-785.957) -- 0:00:32
469000 -- [-784.306] (-785.623) (-788.170) (-783.778) * [-785.898] (-784.147) (-783.757) (-785.331) -- 0:00:32
469500 -- (-785.561) [-786.752] (-785.191) (-787.352) * (-783.545) [-784.099] (-785.917) (-787.231) -- 0:00:32
470000 -- (-785.251) [-784.648] (-784.897) (-783.767) * (-783.595) [-784.797] (-783.493) (-783.984) -- 0:00:32
Average standard deviation of split frequencies: 0.009452
470500 -- [-784.359] (-787.348) (-784.226) (-784.479) * (-783.368) (-784.991) (-783.381) [-785.711] -- 0:00:32
471000 -- (-784.487) (-787.116) (-785.549) [-783.773] * [-784.094] (-786.530) (-784.608) (-787.174) -- 0:00:32
471500 -- (-783.970) (-786.243) [-784.610] (-784.634) * (-783.208) (-785.098) [-782.866] (-785.942) -- 0:00:32
472000 -- (-784.047) (-784.495) [-784.661] (-783.474) * (-787.194) [-784.709] (-783.122) (-792.384) -- 0:00:32
472500 -- (-784.045) (-786.815) [-783.340] (-783.069) * (-783.475) [-785.604] (-786.560) (-786.680) -- 0:00:32
473000 -- (-786.936) [-789.740] (-784.066) (-785.270) * (-785.055) (-786.295) [-786.874] (-793.250) -- 0:00:32
473500 -- [-783.933] (-785.937) (-784.446) (-784.242) * (-784.532) (-784.361) [-786.140] (-791.525) -- 0:00:32
474000 -- (-783.835) (-784.858) (-786.417) [-784.314] * (-784.277) [-784.665] (-784.874) (-785.525) -- 0:00:32
474500 -- [-785.401] (-784.926) (-784.738) (-787.945) * (-783.626) (-786.778) (-784.587) [-787.544] -- 0:00:32
475000 -- [-784.957] (-784.671) (-789.444) (-786.844) * (-784.979) (-790.993) (-785.142) [-785.633] -- 0:00:32
Average standard deviation of split frequencies: 0.008851
475500 -- [-785.477] (-784.895) (-787.717) (-784.477) * (-784.587) (-787.083) [-785.157] (-787.405) -- 0:00:31
476000 -- (-785.616) [-783.695] (-792.572) (-788.318) * (-784.230) (-783.271) [-790.671] (-785.573) -- 0:00:31
476500 -- (-786.057) (-784.715) [-784.939] (-787.284) * [-784.104] (-786.078) (-790.494) (-785.010) -- 0:00:31
477000 -- (-784.168) (-784.391) [-787.572] (-783.303) * (-784.370) (-787.873) [-784.943] (-783.930) -- 0:00:31
477500 -- [-783.973] (-783.838) (-788.266) (-783.788) * [-784.821] (-784.946) (-788.581) (-785.984) -- 0:00:31
478000 -- (-785.039) (-786.929) (-785.258) [-783.547] * (-785.763) (-784.328) [-788.229] (-786.200) -- 0:00:31
478500 -- [-783.305] (-784.233) (-784.309) (-784.135) * (-786.957) [-784.516] (-787.219) (-783.284) -- 0:00:31
479000 -- (-784.937) [-786.334] (-783.396) (-785.399) * (-784.720) (-786.240) (-785.550) [-783.477] -- 0:00:31
479500 -- (-784.305) (-785.620) (-786.266) [-786.605] * (-783.697) (-786.805) (-785.336) [-785.103] -- 0:00:31
480000 -- (-785.219) [-786.451] (-785.469) (-786.507) * (-788.209) (-784.484) (-783.500) [-783.697] -- 0:00:31
Average standard deviation of split frequencies: 0.008888
480500 -- [-786.210] (-785.201) (-787.782) (-791.870) * (-784.588) (-784.484) [-788.716] (-783.774) -- 0:00:31
481000 -- (-784.211) (-783.740) [-783.291] (-786.098) * (-785.611) (-787.567) (-788.155) [-783.389] -- 0:00:31
481500 -- (-784.979) [-784.170] (-783.664) (-785.924) * [-787.252] (-785.050) (-786.607) (-785.323) -- 0:00:31
482000 -- [-784.945] (-785.848) (-783.540) (-786.343) * (-784.506) (-783.770) (-783.928) [-784.258] -- 0:00:31
482500 -- [-784.912] (-787.812) (-785.401) (-787.066) * (-784.165) [-783.244] (-784.315) (-788.350) -- 0:00:31
483000 -- (-785.400) (-787.651) (-784.618) [-784.454] * (-784.302) (-783.955) [-783.135] (-784.106) -- 0:00:31
483500 -- (-789.057) (-787.731) (-784.015) [-783.880] * [-784.039] (-783.508) (-785.907) (-785.511) -- 0:00:30
484000 -- (-785.134) (-784.627) (-783.698) [-784.704] * [-783.315] (-783.553) (-789.158) (-782.912) -- 0:00:30
484500 -- (-783.679) (-785.372) [-786.744] (-788.498) * (-783.895) (-783.535) [-784.958] (-783.034) -- 0:00:30
485000 -- [-783.629] (-786.108) (-786.472) (-784.391) * (-784.104) [-785.860] (-784.174) (-783.649) -- 0:00:31
Average standard deviation of split frequencies: 0.009518
485500 -- (-785.554) (-789.184) (-784.174) [-784.178] * (-785.206) (-788.395) [-784.174] (-785.309) -- 0:00:31
486000 -- [-785.592] (-785.805) (-784.222) (-784.755) * (-784.210) [-784.891] (-784.689) (-786.740) -- 0:00:31
486500 -- (-784.550) (-784.372) [-788.177] (-790.690) * (-784.087) [-783.558] (-788.453) (-786.740) -- 0:00:31
487000 -- (-784.682) [-785.116] (-785.696) (-785.363) * [-785.384] (-783.167) (-785.307) (-786.314) -- 0:00:31
487500 -- [-783.673] (-789.630) (-793.193) (-784.651) * (-785.510) [-783.871] (-787.783) (-787.286) -- 0:00:31
488000 -- (-787.466) (-786.414) (-785.209) [-784.168] * (-785.238) (-783.656) [-783.161] (-786.407) -- 0:00:31
488500 -- (-783.846) (-786.063) [-784.471] (-789.475) * (-787.629) (-785.438) [-785.127] (-785.145) -- 0:00:31
489000 -- (-785.706) (-785.051) (-783.426) [-784.846] * (-785.090) [-783.815] (-785.640) (-783.602) -- 0:00:31
489500 -- [-788.138] (-784.681) (-785.578) (-786.108) * (-784.932) [-784.045] (-785.695) (-784.492) -- 0:00:31
490000 -- (-788.399) [-785.331] (-785.539) (-782.987) * (-783.301) [-784.394] (-786.024) (-785.950) -- 0:00:31
Average standard deviation of split frequencies: 0.009307
490500 -- [-788.306] (-788.090) (-784.297) (-785.245) * (-783.334) [-786.587] (-786.994) (-784.499) -- 0:00:31
491000 -- [-784.027] (-786.226) (-786.266) (-783.995) * (-784.799) (-784.995) (-786.160) [-783.808] -- 0:00:31
491500 -- [-784.894] (-785.027) (-785.275) (-786.701) * (-783.634) (-784.211) [-784.413] (-783.556) -- 0:00:31
492000 -- (-784.999) [-785.091] (-785.163) (-784.002) * (-787.452) [-784.093] (-786.977) (-785.156) -- 0:00:30
492500 -- (-784.169) (-785.623) (-787.071) [-783.591] * (-788.209) [-786.842] (-786.783) (-783.148) -- 0:00:30
493000 -- (-790.335) (-784.810) [-784.741] (-783.396) * (-786.736) (-784.952) [-784.288] (-785.203) -- 0:00:30
493500 -- (-786.664) (-783.268) (-787.605) [-783.978] * [-787.589] (-787.139) (-784.901) (-783.941) -- 0:00:30
494000 -- (-785.213) (-788.112) (-782.985) [-786.555] * (-788.799) (-783.346) (-784.822) [-784.678] -- 0:00:30
494500 -- (-785.233) (-789.164) [-786.046] (-785.146) * (-784.632) [-784.485] (-792.532) (-786.656) -- 0:00:30
495000 -- (-785.885) [-785.156] (-786.089) (-787.465) * (-792.546) (-785.206) (-786.654) [-783.919] -- 0:00:30
Average standard deviation of split frequencies: 0.009385
495500 -- (-783.085) [-783.988] (-784.537) (-786.439) * [-783.706] (-787.849) (-787.625) (-784.222) -- 0:00:30
496000 -- (-784.460) (-784.879) [-783.626] (-787.778) * (-783.605) (-786.200) [-784.696] (-783.596) -- 0:00:30
496500 -- [-785.452] (-784.041) (-784.453) (-792.282) * [-784.149] (-786.117) (-786.162) (-783.999) -- 0:00:30
497000 -- (-784.361) [-784.345] (-784.026) (-788.339) * (-785.760) [-783.347] (-783.431) (-785.236) -- 0:00:30
497500 -- [-785.107] (-784.698) (-788.854) (-784.763) * (-784.698) (-785.597) [-783.646] (-784.179) -- 0:00:30
498000 -- (-785.520) [-785.070] (-784.069) (-783.376) * [-786.536] (-785.137) (-785.515) (-784.706) -- 0:00:30
498500 -- (-784.981) [-787.827] (-786.464) (-783.532) * [-785.391] (-785.758) (-786.501) (-786.190) -- 0:00:30
499000 -- [-784.683] (-787.116) (-787.946) (-784.582) * [-785.229] (-784.284) (-787.188) (-787.238) -- 0:00:30
499500 -- (-785.330) [-785.587] (-786.032) (-785.631) * (-785.769) (-784.232) [-784.429] (-785.667) -- 0:00:30
500000 -- (-787.502) (-785.523) (-784.798) [-784.459] * (-786.036) (-784.490) [-784.200] (-785.989) -- 0:00:30
Average standard deviation of split frequencies: 0.009121
500500 -- (-785.906) (-786.119) (-785.569) [-783.619] * (-785.794) [-785.030] (-785.584) (-783.725) -- 0:00:29
501000 -- (-787.398) (-783.051) [-783.386] (-783.557) * (-785.022) (-786.773) (-784.636) [-783.544] -- 0:00:29
501500 -- (-785.775) [-783.453] (-785.621) (-787.304) * [-784.647] (-783.470) (-787.858) (-783.064) -- 0:00:30
502000 -- (-787.477) (-788.836) [-785.524] (-787.815) * [-784.530] (-784.864) (-784.359) (-788.523) -- 0:00:30
502500 -- (-786.129) (-786.383) [-785.784] (-786.087) * (-784.530) (-785.965) [-782.945] (-785.038) -- 0:00:30
503000 -- (-784.503) (-785.636) (-786.709) [-783.428] * (-788.850) [-784.786] (-785.063) (-784.507) -- 0:00:30
503500 -- (-784.095) (-785.525) [-784.862] (-783.430) * (-793.104) [-788.179] (-784.377) (-785.954) -- 0:00:30
504000 -- (-784.623) (-786.002) [-784.106] (-785.932) * (-785.244) (-788.653) (-783.651) [-786.165] -- 0:00:30
504500 -- [-787.042] (-784.015) (-783.785) (-788.798) * (-786.482) (-787.168) (-783.589) [-786.264] -- 0:00:30
505000 -- (-786.278) [-784.055] (-784.208) (-785.888) * [-786.779] (-790.132) (-785.484) (-783.277) -- 0:00:30
Average standard deviation of split frequencies: 0.009097
505500 -- [-784.301] (-787.442) (-785.658) (-784.992) * (-785.512) (-785.741) [-786.600] (-790.130) -- 0:00:30
506000 -- (-788.230) [-785.648] (-783.861) (-787.929) * (-786.169) (-785.480) (-783.776) [-784.118] -- 0:00:30
506500 -- (-785.050) [-788.947] (-784.288) (-787.959) * [-785.738] (-783.593) (-783.726) (-785.720) -- 0:00:30
507000 -- (-783.356) (-783.144) [-790.886] (-785.637) * (-785.955) [-783.833] (-790.025) (-788.003) -- 0:00:30
507500 -- (-783.299) [-784.340] (-790.653) (-786.950) * (-783.442) (-784.963) (-784.192) [-783.186] -- 0:00:30
508000 -- (-784.728) [-784.387] (-783.864) (-786.545) * [-782.998] (-783.832) (-789.640) (-783.444) -- 0:00:30
508500 -- (-785.956) (-789.010) [-785.970] (-787.024) * [-785.509] (-785.349) (-784.718) (-788.699) -- 0:00:29
509000 -- [-786.553] (-784.618) (-786.578) (-785.586) * (-784.283) (-783.482) [-784.728] (-785.306) -- 0:00:29
509500 -- [-783.846] (-786.489) (-784.669) (-787.098) * [-784.261] (-784.023) (-784.633) (-785.131) -- 0:00:29
510000 -- (-783.916) [-789.389] (-784.269) (-783.414) * (-784.695) (-784.159) [-783.100] (-783.847) -- 0:00:29
Average standard deviation of split frequencies: 0.009635
510500 -- (-785.780) (-788.235) [-783.331] (-787.008) * (-784.506) (-786.691) [-783.817] (-790.076) -- 0:00:29
511000 -- [-784.208] (-788.426) (-784.195) (-783.819) * (-784.260) (-786.501) [-785.683] (-788.732) -- 0:00:29
511500 -- (-783.630) (-788.279) (-791.588) [-783.558] * (-784.400) (-785.557) [-785.487] (-788.407) -- 0:00:29
512000 -- [-784.801] (-787.447) (-785.064) (-785.851) * [-784.244] (-784.463) (-789.251) (-788.141) -- 0:00:29
512500 -- [-783.485] (-783.283) (-785.897) (-785.036) * (-783.818) [-785.470] (-786.110) (-783.957) -- 0:00:29
513000 -- (-786.196) [-783.815] (-784.478) (-784.067) * [-783.744] (-782.976) (-786.429) (-790.206) -- 0:00:29
513500 -- (-785.762) (-784.136) (-784.988) [-783.854] * (-785.075) (-786.161) [-783.406] (-784.551) -- 0:00:29
514000 -- (-783.953) [-786.394] (-784.232) (-783.827) * (-785.732) (-787.790) (-788.845) [-784.530] -- 0:00:29
514500 -- (-792.736) (-787.817) (-785.829) [-783.974] * [-785.061] (-792.032) (-788.633) (-790.027) -- 0:00:29
515000 -- (-785.751) (-786.423) [-783.611] (-785.099) * [-784.620] (-788.366) (-785.191) (-784.061) -- 0:00:29
Average standard deviation of split frequencies: 0.009421
515500 -- (-786.752) (-789.643) [-783.883] (-783.487) * (-788.732) (-786.948) [-783.274] (-786.301) -- 0:00:29
516000 -- (-792.538) (-786.159) [-783.141] (-785.001) * (-785.073) (-783.724) [-783.406] (-787.473) -- 0:00:29
516500 -- (-787.375) (-785.244) (-783.349) [-783.029] * (-785.107) (-788.156) [-783.776] (-789.322) -- 0:00:29
517000 -- (-789.116) [-784.967] (-783.079) (-785.047) * (-784.110) [-784.644] (-783.608) (-792.249) -- 0:00:28
517500 -- (-785.714) (-785.700) (-785.978) [-787.237] * [-783.001] (-783.826) (-786.535) (-786.402) -- 0:00:28
518000 -- (-792.231) [-783.480] (-786.500) (-784.749) * (-784.530) [-786.244] (-784.796) (-786.312) -- 0:00:28
518500 -- (-785.332) [-787.138] (-785.930) (-785.653) * (-782.892) (-784.052) [-785.435] (-784.587) -- 0:00:29
519000 -- (-784.533) (-784.486) (-785.202) [-787.053] * (-784.827) [-785.615] (-784.060) (-783.888) -- 0:00:29
519500 -- (-785.679) (-785.149) [-786.534] (-786.526) * (-783.310) [-783.516] (-785.780) (-787.775) -- 0:00:29
520000 -- (-784.996) (-786.920) [-786.315] (-785.189) * (-784.693) (-783.354) [-783.620] (-785.562) -- 0:00:29
Average standard deviation of split frequencies: 0.009167
520500 -- (-787.330) (-786.116) [-785.562] (-783.670) * (-785.634) (-785.113) (-786.140) [-786.620] -- 0:00:29
521000 -- (-787.292) (-784.077) [-785.044] (-783.773) * (-785.627) (-783.922) (-786.003) [-785.209] -- 0:00:29
521500 -- (-784.687) [-785.597] (-785.417) (-783.688) * (-789.229) (-784.184) [-785.362] (-786.220) -- 0:00:29
522000 -- [-785.077] (-784.127) (-783.323) (-784.096) * (-784.459) (-785.129) [-784.523] (-790.366) -- 0:00:29
522500 -- (-785.907) (-791.944) [-783.669] (-783.919) * (-784.672) [-784.671] (-785.950) (-785.395) -- 0:00:29
523000 -- (-785.773) [-785.686] (-784.831) (-784.503) * (-784.343) (-784.730) (-785.310) [-785.210] -- 0:00:29
523500 -- [-783.358] (-784.664) (-783.442) (-785.924) * (-787.012) (-786.254) (-787.489) [-785.743] -- 0:00:29
524000 -- (-784.226) (-783.653) (-787.389) [-785.466] * (-786.123) [-786.692] (-785.175) (-784.323) -- 0:00:29
524500 -- (-785.191) (-784.329) [-783.922] (-785.732) * [-784.518] (-787.970) (-783.824) (-785.414) -- 0:00:29
525000 -- (-784.514) (-785.509) [-785.780] (-785.973) * [-783.394] (-783.312) (-784.190) (-785.562) -- 0:00:28
Average standard deviation of split frequencies: 0.009410
525500 -- (-788.058) (-785.661) (-785.612) [-783.742] * [-783.678] (-785.676) (-785.627) (-785.831) -- 0:00:28
526000 -- (-785.535) (-786.733) [-783.898] (-786.125) * (-784.743) [-783.623] (-784.569) (-786.489) -- 0:00:28
526500 -- [-783.744] (-785.208) (-784.796) (-785.703) * (-788.751) [-784.492] (-784.476) (-783.468) -- 0:00:28
527000 -- (-788.146) [-787.465] (-783.911) (-786.092) * (-783.495) (-788.800) [-784.402] (-784.828) -- 0:00:28
527500 -- (-784.942) (-786.199) (-785.421) [-783.465] * (-786.184) (-786.997) [-787.468] (-784.617) -- 0:00:28
528000 -- (-785.418) (-785.994) [-787.479] (-783.469) * (-784.520) (-784.026) [-784.264] (-786.234) -- 0:00:28
528500 -- (-785.921) (-785.386) [-785.071] (-783.716) * [-783.812] (-784.136) (-784.569) (-785.884) -- 0:00:28
529000 -- [-785.827] (-786.094) (-785.323) (-785.968) * [-783.865] (-784.677) (-786.253) (-785.507) -- 0:00:28
529500 -- (-785.284) (-789.113) (-784.578) [-783.620] * [-783.637] (-787.462) (-784.426) (-784.714) -- 0:00:28
530000 -- (-787.758) [-783.417] (-785.268) (-786.475) * (-784.010) (-785.679) (-787.029) [-786.332] -- 0:00:28
Average standard deviation of split frequencies: 0.008772
530500 -- [-783.852] (-784.420) (-789.106) (-784.514) * [-784.097] (-784.653) (-785.290) (-785.472) -- 0:00:28
531000 -- (-786.681) (-785.778) (-786.853) [-784.891] * [-784.259] (-783.249) (-784.788) (-784.816) -- 0:00:28
531500 -- (-787.556) (-787.632) (-787.085) [-783.860] * (-785.447) [-784.088] (-786.587) (-784.512) -- 0:00:28
532000 -- (-789.381) [-783.135] (-785.265) (-785.785) * (-783.264) (-788.445) (-784.598) [-785.923] -- 0:00:28
532500 -- [-788.751] (-784.677) (-786.547) (-784.485) * [-783.591] (-786.278) (-787.764) (-784.877) -- 0:00:28
533000 -- (-787.540) [-783.261] (-786.932) (-784.069) * (-783.370) (-789.746) (-785.111) [-784.848] -- 0:00:28
533500 -- (-787.333) [-783.346] (-786.386) (-783.345) * (-784.690) (-784.994) [-785.030] (-787.543) -- 0:00:27
534000 -- [-783.953] (-783.758) (-784.611) (-786.381) * (-784.263) (-785.431) [-785.418] (-787.910) -- 0:00:27
534500 -- [-785.608] (-785.900) (-783.806) (-788.277) * [-783.876] (-787.236) (-792.076) (-787.030) -- 0:00:27
535000 -- (-783.674) (-784.993) (-786.742) [-787.678] * (-786.186) (-785.388) (-787.471) [-783.479] -- 0:00:28
Average standard deviation of split frequencies: 0.008740
535500 -- (-786.714) (-783.177) (-785.820) [-785.436] * [-783.788] (-785.735) (-789.439) (-785.753) -- 0:00:28
536000 -- (-784.323) (-785.137) (-786.264) [-786.452] * (-784.134) [-784.829] (-784.617) (-783.707) -- 0:00:28
536500 -- (-784.626) [-790.162] (-785.944) (-785.798) * (-785.073) [-784.741] (-783.102) (-788.061) -- 0:00:28
537000 -- (-783.768) (-785.892) (-784.254) [-784.630] * (-786.289) (-783.893) [-783.325] (-784.468) -- 0:00:28
537500 -- (-785.856) (-785.391) (-787.446) [-786.104] * (-787.836) [-783.729] (-785.423) (-787.094) -- 0:00:28
538000 -- (-786.408) [-785.264] (-784.880) (-783.185) * [-784.779] (-785.275) (-784.866) (-785.634) -- 0:00:28
538500 -- (-787.020) (-788.848) [-783.307] (-784.006) * (-783.730) (-786.665) [-784.213] (-784.847) -- 0:00:28
539000 -- (-786.789) (-785.447) (-783.090) [-785.717] * (-784.525) (-784.976) [-789.088] (-783.715) -- 0:00:28
539500 -- (-787.256) [-784.648] (-784.667) (-783.329) * (-784.724) (-783.486) (-785.696) [-785.476] -- 0:00:28
540000 -- (-784.595) (-783.936) (-785.610) [-783.432] * [-784.118] (-783.537) (-784.412) (-786.497) -- 0:00:28
Average standard deviation of split frequencies: 0.009209
540500 -- (-784.511) (-784.159) (-783.985) [-785.028] * (-784.609) (-783.345) (-784.785) [-783.564] -- 0:00:28
541000 -- (-784.205) [-785.771] (-783.497) (-786.705) * [-784.350] (-787.032) (-785.465) (-784.310) -- 0:00:27
541500 -- [-788.132] (-786.716) (-783.826) (-788.209) * (-783.727) (-784.890) (-785.708) [-783.898] -- 0:00:27
542000 -- (-788.794) [-787.770] (-784.258) (-785.622) * [-783.798] (-784.533) (-784.604) (-783.740) -- 0:00:27
542500 -- (-786.804) (-787.290) (-784.258) [-786.077] * [-786.083] (-786.736) (-786.732) (-784.674) -- 0:00:27
543000 -- (-783.032) (-785.443) (-784.379) [-784.961] * [-783.206] (-786.839) (-785.123) (-788.693) -- 0:00:27
543500 -- (-786.216) (-784.140) [-783.484] (-784.223) * (-783.444) (-787.052) [-784.729] (-786.656) -- 0:00:27
544000 -- (-785.275) [-784.086] (-786.419) (-787.474) * (-785.521) (-783.518) (-783.860) [-783.695] -- 0:00:27
544500 -- (-786.221) (-784.964) (-786.221) [-787.403] * [-787.304] (-783.741) (-784.368) (-786.037) -- 0:00:27
545000 -- (-783.245) [-784.296] (-783.176) (-784.189) * (-786.250) (-785.698) [-785.334] (-783.792) -- 0:00:27
Average standard deviation of split frequencies: 0.009853
545500 -- (-783.405) (-785.134) [-783.301] (-786.144) * (-787.052) (-785.049) (-784.442) [-783.248] -- 0:00:27
546000 -- (-783.758) [-784.522] (-786.230) (-784.199) * (-785.327) [-785.505] (-784.999) (-787.333) -- 0:00:27
546500 -- (-784.423) (-788.443) [-784.913] (-786.973) * (-786.519) [-784.163] (-788.154) (-785.248) -- 0:00:27
547000 -- [-786.128] (-784.504) (-784.608) (-788.677) * (-786.953) [-784.458] (-786.597) (-785.594) -- 0:00:27
547500 -- (-786.043) [-786.785] (-785.189) (-786.003) * (-789.133) [-784.245] (-783.891) (-787.371) -- 0:00:27
548000 -- (-785.960) (-783.480) (-785.270) [-785.487] * [-783.512] (-784.234) (-784.798) (-787.063) -- 0:00:27
548500 -- (-787.448) [-784.253] (-784.384) (-785.513) * (-785.938) (-784.521) [-784.995] (-783.633) -- 0:00:27
549000 -- (-785.926) (-784.458) [-785.429] (-785.757) * [-785.478] (-786.183) (-788.736) (-783.764) -- 0:00:27
549500 -- (-784.800) (-783.761) [-786.446] (-786.252) * [-786.556] (-784.619) (-785.765) (-784.857) -- 0:00:27
550000 -- (-784.416) (-784.175) (-785.408) [-785.774] * (-785.898) [-785.425] (-786.407) (-784.844) -- 0:00:27
Average standard deviation of split frequencies: 0.009719
550500 -- (-786.719) [-785.526] (-787.278) (-785.165) * (-785.329) (-787.186) [-785.868] (-785.150) -- 0:00:26
551000 -- (-786.624) (-785.191) (-786.979) [-783.368] * (-787.909) (-785.068) [-784.376] (-785.887) -- 0:00:26
551500 -- [-785.176] (-784.985) (-784.763) (-783.761) * (-785.775) [-786.609] (-785.538) (-787.439) -- 0:00:26
552000 -- (-784.674) (-784.363) [-785.450] (-783.994) * [-786.513] (-786.709) (-784.003) (-786.084) -- 0:00:27
552500 -- (-783.981) (-789.041) [-783.382] (-784.367) * [-785.298] (-785.893) (-785.523) (-786.044) -- 0:00:27
553000 -- (-783.694) (-787.161) (-784.225) [-787.142] * [-784.181] (-784.475) (-784.333) (-785.448) -- 0:00:27
553500 -- [-783.782] (-785.799) (-785.838) (-784.735) * (-785.707) (-783.959) (-783.787) [-785.531] -- 0:00:27
554000 -- (-784.991) (-786.149) [-786.295] (-783.643) * [-782.989] (-785.346) (-784.918) (-785.438) -- 0:00:27
554500 -- [-784.548] (-784.643) (-786.063) (-785.216) * (-785.342) (-783.568) [-784.613] (-786.367) -- 0:00:27
555000 -- (-785.442) (-784.563) (-786.935) [-784.943] * (-786.899) (-783.523) (-787.296) [-784.868] -- 0:00:27
Average standard deviation of split frequencies: 0.009576
555500 -- (-785.863) (-786.750) (-784.146) [-784.644] * (-787.016) [-783.857] (-785.422) (-785.208) -- 0:00:27
556000 -- (-784.213) (-784.556) (-783.920) [-785.542] * [-784.363] (-784.995) (-787.239) (-784.325) -- 0:00:27
556500 -- (-787.334) (-786.362) (-785.709) [-783.128] * (-783.962) (-783.162) (-786.901) [-783.271] -- 0:00:27
557000 -- (-789.576) (-787.948) [-786.761] (-784.120) * (-784.584) [-785.690] (-789.304) (-784.132) -- 0:00:27
557500 -- [-783.896] (-786.308) (-784.528) (-786.521) * [-784.768] (-788.931) (-786.442) (-783.577) -- 0:00:26
558000 -- (-786.539) (-791.209) (-787.787) [-784.417] * (-787.740) (-791.201) [-784.904] (-784.137) -- 0:00:26
558500 -- [-784.125] (-788.727) (-791.440) (-784.081) * (-784.625) (-787.316) [-786.103] (-786.907) -- 0:00:26
559000 -- (-786.385) (-789.131) (-784.503) [-784.642] * (-786.451) (-786.918) [-785.397] (-784.675) -- 0:00:26
559500 -- (-788.343) (-784.567) [-787.888] (-784.037) * (-785.785) (-784.181) (-784.835) [-784.060] -- 0:00:26
560000 -- (-785.392) (-785.432) [-786.241] (-784.854) * (-786.057) (-783.743) [-783.916] (-786.264) -- 0:00:26
Average standard deviation of split frequencies: 0.010040
560500 -- (-790.233) (-784.261) (-785.623) [-785.253] * (-785.267) [-784.395] (-783.940) (-789.393) -- 0:00:26
561000 -- (-785.850) (-784.669) (-790.903) [-784.063] * (-785.817) (-788.109) [-786.987] (-793.272) -- 0:00:26
561500 -- (-784.343) [-786.529] (-787.082) (-784.061) * (-784.431) (-788.411) (-783.835) [-785.420] -- 0:00:26
562000 -- (-789.225) (-786.529) (-785.916) [-783.086] * (-785.585) [-783.410] (-782.893) (-785.128) -- 0:00:26
562500 -- (-784.395) (-787.812) (-783.355) [-785.676] * (-784.461) (-783.410) [-784.419] (-783.697) -- 0:00:26
563000 -- (-784.077) [-786.135] (-786.367) (-786.210) * (-784.761) [-784.601] (-789.457) (-785.185) -- 0:00:26
563500 -- (-785.420) [-784.455] (-783.899) (-785.844) * (-785.192) (-786.380) [-783.605] (-784.110) -- 0:00:26
564000 -- (-783.537) [-785.821] (-789.078) (-785.328) * (-786.315) [-786.395] (-784.213) (-785.204) -- 0:00:26
564500 -- (-784.765) (-789.895) (-790.486) [-785.676] * [-786.948] (-784.292) (-786.809) (-784.412) -- 0:00:26
565000 -- (-784.532) (-784.138) [-788.889] (-789.112) * (-785.263) (-784.843) [-785.066] (-787.576) -- 0:00:26
Average standard deviation of split frequencies: 0.010239
565500 -- [-784.859] (-790.014) (-788.595) (-788.981) * [-784.351] (-786.045) (-785.378) (-784.283) -- 0:00:26
566000 -- (-785.556) (-785.162) [-785.591] (-784.693) * (-783.781) (-785.099) (-784.655) [-786.359] -- 0:00:26
566500 -- (-789.504) [-787.531] (-784.904) (-784.224) * (-785.640) (-783.311) [-783.673] (-785.604) -- 0:00:26
567000 -- (-787.310) [-789.198] (-784.816) (-785.733) * (-785.524) (-783.333) [-784.287] (-784.926) -- 0:00:25
567500 -- (-785.817) [-783.686] (-785.588) (-784.922) * (-784.227) (-783.441) [-785.154] (-784.993) -- 0:00:25
568000 -- (-785.051) (-785.208) [-788.052] (-784.510) * (-788.754) (-786.780) [-786.842] (-785.332) -- 0:00:25
568500 -- (-786.858) (-783.668) [-785.454] (-787.109) * (-788.670) [-790.562] (-787.527) (-787.450) -- 0:00:25
569000 -- (-787.693) [-783.257] (-785.096) (-786.433) * (-784.478) (-783.666) [-790.459] (-785.135) -- 0:00:26
569500 -- (-784.789) [-783.254] (-784.254) (-786.647) * (-785.136) (-783.581) [-785.493] (-785.230) -- 0:00:26
570000 -- (-783.670) [-783.894] (-785.172) (-786.230) * (-786.010) (-786.584) (-784.662) [-784.747] -- 0:00:26
Average standard deviation of split frequencies: 0.009913
570500 -- (-788.323) [-784.564] (-783.935) (-785.567) * (-788.850) (-785.878) [-784.125] (-784.036) -- 0:00:26
571000 -- (-786.942) (-783.605) [-783.558] (-785.314) * (-786.584) (-784.822) (-786.807) [-783.731] -- 0:00:26
571500 -- (-786.075) (-784.517) (-783.571) [-786.465] * (-785.205) [-783.498] (-784.304) (-786.066) -- 0:00:26
572000 -- (-784.510) (-784.780) (-784.179) [-785.364] * [-785.653] (-790.346) (-785.033) (-785.787) -- 0:00:26
572500 -- (-785.497) (-786.257) (-784.625) [-792.204] * (-785.394) [-785.175] (-788.501) (-784.568) -- 0:00:26
573000 -- (-785.681) [-784.221] (-785.155) (-785.941) * (-788.827) [-785.798] (-786.638) (-784.495) -- 0:00:26
573500 -- (-785.262) (-785.509) (-788.542) [-785.094] * (-787.492) (-788.698) (-785.980) [-785.310] -- 0:00:26
574000 -- (-788.985) (-785.291) (-783.960) [-785.679] * (-786.591) (-787.006) (-784.426) [-784.642] -- 0:00:25
574500 -- [-787.268] (-785.180) (-783.855) (-787.613) * (-783.455) (-786.360) [-784.289] (-788.134) -- 0:00:25
575000 -- (-784.887) [-784.650] (-787.749) (-786.975) * (-784.569) (-785.314) [-783.909] (-787.560) -- 0:00:25
Average standard deviation of split frequencies: 0.010302
575500 -- (-784.980) [-783.963] (-785.130) (-786.459) * (-784.172) (-785.959) [-782.877] (-786.996) -- 0:00:25
576000 -- (-784.494) (-788.153) [-784.454] (-784.164) * (-788.805) [-785.434] (-784.823) (-785.005) -- 0:00:25
576500 -- (-785.083) [-784.668] (-787.189) (-784.960) * [-787.142] (-784.852) (-785.237) (-785.016) -- 0:00:25
577000 -- (-783.640) [-784.010] (-785.729) (-792.798) * (-785.214) (-787.403) (-785.941) [-784.186] -- 0:00:25
577500 -- [-783.665] (-783.983) (-786.156) (-790.345) * (-786.662) (-784.197) [-783.803] (-783.946) -- 0:00:25
578000 -- (-784.819) [-783.426] (-787.095) (-784.447) * (-785.700) [-785.723] (-785.492) (-782.984) -- 0:00:25
578500 -- (-786.222) [-785.350] (-786.775) (-783.069) * [-784.692] (-787.379) (-785.813) (-785.766) -- 0:00:25
579000 -- (-788.602) (-785.556) [-788.404] (-787.228) * (-788.775) [-789.608] (-783.390) (-785.534) -- 0:00:25
579500 -- [-786.330] (-784.855) (-786.293) (-787.310) * (-791.499) (-788.998) [-784.421] (-785.004) -- 0:00:25
580000 -- [-784.795] (-783.173) (-789.315) (-786.071) * [-785.253] (-784.333) (-786.134) (-785.645) -- 0:00:25
Average standard deviation of split frequencies: 0.009694
580500 -- [-785.207] (-783.480) (-784.719) (-788.116) * (-784.793) (-787.254) [-786.535] (-784.182) -- 0:00:25
581000 -- (-784.567) (-783.412) [-790.288] (-789.322) * (-792.001) (-785.330) [-783.905] (-789.041) -- 0:00:25
581500 -- (-786.876) (-786.066) [-790.186] (-783.787) * (-787.383) (-786.722) [-786.352] (-792.505) -- 0:00:25
582000 -- [-787.906] (-785.083) (-786.702) (-792.806) * (-784.514) (-787.189) (-786.630) [-784.761] -- 0:00:25
582500 -- [-784.447] (-784.345) (-790.040) (-786.004) * [-784.924] (-784.597) (-784.829) (-786.839) -- 0:00:25
583000 -- (-785.375) (-785.691) [-783.321] (-783.155) * (-783.526) [-786.990] (-787.382) (-792.440) -- 0:00:25
583500 -- [-785.188] (-784.991) (-783.374) (-784.367) * [-784.958] (-783.803) (-789.722) (-786.398) -- 0:00:24
584000 -- [-787.070] (-785.422) (-783.556) (-785.972) * (-787.054) [-783.213] (-789.783) (-786.258) -- 0:00:24
584500 -- (-784.180) (-788.352) [-785.619] (-786.042) * (-784.166) (-789.098) (-785.953) [-787.242] -- 0:00:24
585000 -- (-783.846) [-787.075] (-785.491) (-788.270) * [-786.587] (-790.601) (-784.135) (-793.897) -- 0:00:24
Average standard deviation of split frequencies: 0.009701
585500 -- (-783.607) (-783.972) [-785.388] (-788.164) * (-785.330) [-786.093] (-783.412) (-793.417) -- 0:00:25
586000 -- (-783.829) (-785.423) [-782.907] (-793.090) * (-783.531) (-786.805) (-787.987) [-784.569] -- 0:00:25
586500 -- (-783.887) (-783.939) (-784.326) [-785.457] * (-783.408) [-784.366] (-784.633) (-787.838) -- 0:00:25
587000 -- (-784.018) (-783.326) [-786.078] (-783.913) * [-786.248] (-787.662) (-784.219) (-785.849) -- 0:00:25
587500 -- (-784.038) [-783.482] (-783.311) (-785.107) * (-786.065) [-784.152] (-786.086) (-788.193) -- 0:00:25
588000 -- [-784.135] (-783.749) (-783.311) (-785.582) * [-784.408] (-784.313) (-787.725) (-786.091) -- 0:00:25
588500 -- (-784.268) (-785.730) [-785.255] (-786.039) * (-784.668) (-785.107) [-785.614] (-783.998) -- 0:00:25
589000 -- (-789.560) [-784.238] (-787.559) (-784.755) * (-784.747) (-783.898) (-786.186) [-789.035] -- 0:00:25
589500 -- (-783.839) [-785.794] (-790.348) (-789.259) * (-784.777) [-783.267] (-787.554) (-785.266) -- 0:00:25
590000 -- (-784.693) [-785.751] (-786.783) (-786.573) * (-788.958) (-784.175) (-784.034) [-784.797] -- 0:00:25
Average standard deviation of split frequencies: 0.009976
590500 -- (-786.548) (-783.865) [-784.423] (-786.432) * (-784.691) [-783.790] (-787.681) (-787.797) -- 0:00:24
591000 -- (-783.802) (-785.933) (-785.062) [-785.968] * (-784.094) (-784.005) [-789.791] (-783.044) -- 0:00:24
591500 -- (-783.799) (-785.499) [-783.476] (-788.490) * (-788.953) (-783.496) (-788.138) [-785.674] -- 0:00:24
592000 -- [-788.331] (-787.097) (-784.184) (-785.042) * (-789.664) (-787.736) (-786.686) [-783.249] -- 0:00:24
592500 -- (-785.013) (-787.949) (-785.800) [-783.657] * (-786.358) (-786.300) (-784.919) [-784.939] -- 0:00:24
593000 -- (-784.329) (-784.448) (-786.530) [-784.730] * (-786.649) [-783.193] (-785.204) (-784.676) -- 0:00:24
593500 -- [-785.692] (-787.506) (-789.579) (-785.748) * (-786.878) (-783.021) (-789.108) [-784.722] -- 0:00:24
594000 -- (-784.744) (-784.227) (-789.939) [-784.698] * (-786.450) (-783.973) (-783.993) [-783.344] -- 0:00:24
594500 -- (-787.812) (-783.865) [-785.792] (-786.784) * (-783.919) (-785.224) [-785.226] (-783.701) -- 0:00:24
595000 -- [-784.901] (-785.535) (-783.848) (-784.485) * (-783.430) (-788.392) (-785.429) [-786.585] -- 0:00:24
Average standard deviation of split frequencies: 0.009579
595500 -- (-785.372) (-786.466) (-783.717) [-784.650] * (-784.564) [-783.910] (-784.312) (-786.204) -- 0:00:24
596000 -- (-784.941) [-785.105] (-783.770) (-784.126) * (-785.701) (-786.775) [-784.106] (-784.467) -- 0:00:24
596500 -- (-785.201) [-785.454] (-786.645) (-783.969) * [-784.799] (-784.636) (-785.989) (-783.446) -- 0:00:24
597000 -- (-785.708) (-786.202) [-783.758] (-786.575) * (-786.748) (-783.783) (-787.890) [-783.541] -- 0:00:24
597500 -- (-788.148) (-784.525) (-783.437) [-788.205] * [-785.557] (-783.199) (-784.650) (-785.132) -- 0:00:24
598000 -- (-783.271) [-784.440] (-783.485) (-784.725) * [-785.964] (-783.683) (-785.707) (-784.151) -- 0:00:24
598500 -- (-783.380) (-783.468) [-785.173] (-787.241) * [-785.732] (-783.635) (-787.194) (-790.893) -- 0:00:24
599000 -- (-783.701) [-783.585] (-786.247) (-784.355) * (-790.128) (-788.966) [-784.493] (-784.715) -- 0:00:24
599500 -- (-783.798) (-788.139) (-786.288) [-783.403] * (-790.838) (-789.546) [-783.990] (-787.340) -- 0:00:24
600000 -- [-785.976] (-784.730) (-788.992) (-783.518) * (-785.173) [-787.716] (-786.476) (-783.442) -- 0:00:24
Average standard deviation of split frequencies: 0.008402
600500 -- [-789.789] (-787.652) (-785.532) (-785.499) * (-786.186) (-786.432) (-785.866) [-785.173] -- 0:00:23
601000 -- (-787.100) (-787.365) (-787.067) [-785.013] * (-785.997) [-786.017] (-783.845) (-786.850) -- 0:00:23
601500 -- (-783.169) (-787.065) (-784.405) [-784.347] * (-784.960) (-786.698) [-784.707] (-787.314) -- 0:00:23
602000 -- (-789.758) [-789.628] (-784.658) (-785.267) * (-787.388) [-784.726] (-789.710) (-784.685) -- 0:00:24
602500 -- [-787.411] (-786.424) (-783.576) (-784.463) * (-788.271) (-784.048) [-783.027] (-790.816) -- 0:00:24
603000 -- (-786.419) (-783.854) [-786.257] (-784.209) * (-787.925) (-786.069) (-785.431) [-791.692] -- 0:00:24
603500 -- (-788.882) (-785.959) (-785.644) [-785.216] * (-785.118) [-785.149] (-784.886) (-787.572) -- 0:00:24
604000 -- (-786.899) [-788.397] (-787.565) (-783.966) * [-784.589] (-787.364) (-784.658) (-785.277) -- 0:00:24
604500 -- [-787.922] (-784.710) (-785.780) (-785.543) * [-784.276] (-786.667) (-787.724) (-785.278) -- 0:00:24
605000 -- (-790.868) (-785.315) [-783.904] (-784.352) * (-782.893) [-784.907] (-785.856) (-783.999) -- 0:00:24
Average standard deviation of split frequencies: 0.008969
605500 -- (-788.993) (-785.858) (-783.891) [-784.539] * (-785.530) (-784.369) [-784.156] (-785.411) -- 0:00:24
606000 -- [-784.888] (-784.506) (-785.226) (-784.658) * (-787.163) [-784.633] (-788.663) (-785.200) -- 0:00:24
606500 -- [-790.904] (-783.562) (-788.466) (-786.041) * (-784.054) [-783.424] (-783.209) (-784.123) -- 0:00:24
607000 -- (-787.143) [-785.725] (-789.184) (-784.992) * (-784.786) [-783.308] (-784.344) (-785.155) -- 0:00:23
607500 -- (-784.007) (-791.050) (-784.270) [-785.625] * (-785.921) [-784.421] (-784.314) (-783.730) -- 0:00:23
608000 -- (-785.646) (-788.101) (-784.700) [-786.270] * (-787.970) (-785.893) (-784.573) [-783.076] -- 0:00:23
608500 -- [-785.535] (-784.596) (-786.848) (-785.186) * (-786.483) (-791.819) [-785.050] (-784.171) -- 0:00:23
609000 -- (-787.628) (-786.584) (-784.220) [-790.096] * (-785.852) [-787.303] (-784.052) (-786.076) -- 0:00:23
609500 -- (-785.245) (-788.349) (-783.913) [-787.872] * [-783.422] (-789.145) (-788.656) (-786.516) -- 0:00:23
610000 -- (-783.732) (-783.575) [-787.053] (-790.112) * (-784.628) (-784.186) [-783.470] (-785.436) -- 0:00:23
Average standard deviation of split frequencies: 0.010081
610500 -- [-785.878] (-785.704) (-787.151) (-784.441) * (-783.678) (-783.807) [-783.817] (-784.834) -- 0:00:23
611000 -- (-784.478) [-784.422] (-785.288) (-783.937) * (-786.751) [-784.607] (-783.483) (-786.000) -- 0:00:23
611500 -- (-784.552) (-783.964) [-783.069] (-786.031) * (-788.116) (-784.354) (-784.766) [-784.554] -- 0:00:23
612000 -- (-787.243) [-785.299] (-783.519) (-788.700) * (-783.720) (-785.225) [-785.095] (-782.848) -- 0:00:23
612500 -- (-785.132) (-785.645) [-783.872] (-786.201) * (-786.877) (-785.084) [-785.338] (-784.097) -- 0:00:23
613000 -- [-783.616] (-788.836) (-784.634) (-783.150) * (-784.451) (-784.784) [-786.765] (-786.027) -- 0:00:23
613500 -- (-783.906) [-785.217] (-792.078) (-784.038) * [-783.650] (-784.491) (-785.762) (-783.362) -- 0:00:23
614000 -- (-784.383) [-785.147] (-787.338) (-787.172) * (-786.329) [-785.713] (-785.355) (-783.887) -- 0:00:23
614500 -- (-785.248) (-785.689) [-783.997] (-787.207) * [-783.534] (-785.290) (-786.334) (-785.093) -- 0:00:23
615000 -- [-783.373] (-785.785) (-785.077) (-787.244) * (-783.445) (-784.607) (-788.889) [-785.054] -- 0:00:23
Average standard deviation of split frequencies: 0.009651
615500 -- (-784.300) (-784.748) (-784.995) [-784.567] * (-784.381) (-787.875) (-785.088) [-785.620] -- 0:00:23
616000 -- [-784.154] (-787.358) (-788.288) (-785.124) * (-783.750) (-784.199) [-784.444] (-787.832) -- 0:00:23
616500 -- (-784.100) (-786.187) (-786.221) [-790.936] * (-787.923) (-784.461) [-783.601] (-786.486) -- 0:00:23
617000 -- [-783.189] (-787.686) (-788.120) (-784.570) * (-785.286) [-783.990] (-784.257) (-785.728) -- 0:00:22
617500 -- (-786.140) (-784.739) (-786.301) [-783.037] * (-784.873) (-785.129) (-785.992) [-783.773] -- 0:00:22
618000 -- [-787.469] (-784.008) (-785.560) (-783.767) * (-784.632) [-783.391] (-784.550) (-785.665) -- 0:00:22
618500 -- (-785.755) (-784.660) [-786.380] (-784.701) * (-784.043) (-783.905) (-784.392) [-787.552] -- 0:00:23
619000 -- [-786.201] (-785.111) (-784.754) (-787.488) * [-785.529] (-785.196) (-784.028) (-785.739) -- 0:00:23
619500 -- (-785.091) [-784.248] (-786.878) (-785.701) * [-785.683] (-784.332) (-785.478) (-786.608) -- 0:00:23
620000 -- (-785.670) [-783.921] (-785.351) (-784.954) * (-784.796) (-783.405) (-787.973) [-786.299] -- 0:00:23
Average standard deviation of split frequencies: 0.009494
620500 -- (-784.449) (-785.802) [-784.258] (-784.422) * (-787.620) [-783.675] (-784.061) (-784.204) -- 0:00:23
621000 -- [-783.968] (-783.842) (-784.478) (-785.529) * (-786.338) (-785.809) (-783.938) [-786.667] -- 0:00:23
621500 -- [-785.257] (-793.332) (-785.498) (-786.650) * [-786.759] (-784.235) (-787.187) (-785.587) -- 0:00:23
622000 -- (-785.978) (-792.129) (-784.778) [-785.305] * (-786.673) (-788.421) (-786.083) [-785.609] -- 0:00:23
622500 -- [-787.474] (-791.451) (-784.109) (-784.932) * (-785.352) (-783.348) (-784.887) [-784.693] -- 0:00:23
623000 -- (-787.706) (-784.751) (-784.328) [-786.314] * (-784.880) (-786.578) [-787.537] (-786.534) -- 0:00:22
623500 -- [-783.290] (-784.826) (-786.249) (-784.519) * [-783.452] (-785.003) (-783.840) (-785.718) -- 0:00:22
624000 -- (-786.241) (-784.527) [-784.075] (-785.483) * [-783.123] (-783.799) (-788.880) (-786.135) -- 0:00:22
624500 -- [-783.715] (-784.623) (-788.424) (-785.736) * (-785.590) (-784.250) (-787.486) [-787.302] -- 0:00:22
625000 -- [-783.864] (-787.297) (-784.625) (-785.942) * (-791.151) (-785.931) [-787.662] (-789.017) -- 0:00:22
Average standard deviation of split frequencies: 0.009790
625500 -- (-785.501) (-785.600) [-785.058] (-784.416) * (-790.117) [-786.829] (-786.775) (-787.519) -- 0:00:22
626000 -- (-784.074) [-784.684] (-784.692) (-785.462) * [-784.583] (-788.414) (-787.393) (-783.243) -- 0:00:22
626500 -- (-787.583) [-783.265] (-784.715) (-784.847) * [-785.173] (-783.273) (-783.601) (-785.212) -- 0:00:22
627000 -- (-786.579) [-786.048] (-789.950) (-787.419) * (-787.075) (-783.860) [-783.750] (-785.088) -- 0:00:22
627500 -- (-786.050) (-785.057) [-783.813] (-785.998) * (-785.002) [-785.219] (-785.948) (-784.295) -- 0:00:22
628000 -- (-784.534) (-785.572) [-785.535] (-783.915) * (-782.900) (-784.553) [-783.052] (-784.144) -- 0:00:22
628500 -- (-787.004) [-784.434] (-785.098) (-786.158) * (-784.631) (-784.508) (-785.293) [-786.834] -- 0:00:22
629000 -- (-783.337) [-790.087] (-786.219) (-785.297) * [-785.977] (-788.168) (-787.577) (-786.409) -- 0:00:22
629500 -- [-785.147] (-785.764) (-785.960) (-786.406) * (-783.076) (-784.231) [-783.913] (-784.415) -- 0:00:22
630000 -- (-784.242) (-785.320) [-785.232] (-783.735) * (-790.276) (-783.256) [-785.655] (-786.566) -- 0:00:22
Average standard deviation of split frequencies: 0.009321
630500 -- (-784.715) [-786.289] (-788.060) (-785.619) * (-784.340) (-786.858) (-787.879) [-785.821] -- 0:00:22
631000 -- (-783.453) [-783.185] (-790.674) (-783.710) * [-785.906] (-784.352) (-785.307) (-783.983) -- 0:00:22
631500 -- (-786.071) (-784.691) (-789.776) [-785.485] * (-785.220) (-789.519) (-785.590) [-783.566] -- 0:00:22
632000 -- [-785.392] (-785.036) (-784.638) (-785.696) * (-783.585) (-787.343) [-785.343] (-785.826) -- 0:00:22
632500 -- (-789.560) (-785.303) [-783.100] (-784.436) * (-784.362) [-783.563] (-784.218) (-785.020) -- 0:00:22
633000 -- (-784.992) [-784.090] (-788.295) (-785.756) * (-784.390) [-783.691] (-783.597) (-784.346) -- 0:00:22
633500 -- [-784.274] (-785.790) (-786.457) (-784.092) * (-783.882) (-784.446) [-783.666] (-784.945) -- 0:00:21
634000 -- [-785.532] (-791.071) (-786.319) (-784.466) * (-785.700) [-787.338] (-787.920) (-787.516) -- 0:00:21
634500 -- (-785.169) (-785.077) (-788.317) [-786.588] * (-785.664) (-784.570) [-783.627] (-785.119) -- 0:00:21
635000 -- (-787.929) [-782.960] (-783.245) (-789.766) * (-788.017) (-785.337) (-785.219) [-784.455] -- 0:00:21
Average standard deviation of split frequencies: 0.009505
635500 -- (-788.032) (-783.603) (-783.976) [-784.041] * [-788.117] (-785.586) (-783.869) (-783.483) -- 0:00:22
636000 -- [-784.783] (-784.422) (-784.263) (-783.836) * (-784.897) [-783.143] (-783.682) (-784.335) -- 0:00:22
636500 -- [-783.625] (-784.768) (-786.926) (-784.847) * (-783.425) (-788.451) (-783.915) [-784.367] -- 0:00:22
637000 -- (-786.077) (-785.085) [-785.020] (-786.388) * (-784.426) (-784.335) (-784.763) [-784.930] -- 0:00:22
637500 -- (-787.953) (-789.196) [-783.842] (-784.673) * [-787.503] (-783.210) (-785.210) (-785.829) -- 0:00:22
638000 -- [-784.938] (-789.578) (-783.663) (-790.810) * (-786.966) [-786.463] (-790.270) (-786.319) -- 0:00:22
638500 -- [-783.539] (-784.259) (-784.666) (-783.303) * (-791.953) (-783.415) [-784.658] (-784.640) -- 0:00:22
639000 -- (-784.149) (-788.242) [-784.802] (-785.032) * [-783.377] (-785.202) (-783.763) (-785.512) -- 0:00:22
639500 -- (-784.889) [-791.316] (-784.557) (-784.046) * [-783.949] (-787.572) (-784.625) (-785.709) -- 0:00:21
640000 -- (-785.688) (-785.674) (-784.556) [-786.495] * (-783.612) (-785.877) [-783.475] (-785.393) -- 0:00:21
Average standard deviation of split frequencies: 0.008786
640500 -- (-784.503) (-785.809) [-785.027] (-787.500) * (-783.583) [-785.574] (-783.765) (-785.311) -- 0:00:21
641000 -- (-784.666) (-784.618) (-785.621) [-784.379] * (-783.446) (-787.944) [-784.347] (-789.306) -- 0:00:21
641500 -- (-786.307) [-784.158] (-789.732) (-790.295) * (-786.575) [-784.892] (-787.438) (-787.015) -- 0:00:21
642000 -- (-786.453) [-785.113] (-783.734) (-787.445) * (-784.160) (-784.593) (-784.276) [-783.669] -- 0:00:21
642500 -- (-783.961) [-784.035] (-786.086) (-797.283) * (-786.607) [-783.813] (-785.977) (-786.910) -- 0:00:21
643000 -- [-784.758] (-785.593) (-786.436) (-788.034) * [-790.826] (-783.803) (-784.159) (-789.104) -- 0:00:21
643500 -- [-783.732] (-785.618) (-787.455) (-788.065) * (-788.073) (-785.334) (-783.972) [-786.343] -- 0:00:21
644000 -- (-785.609) (-783.976) [-787.538] (-785.295) * (-788.342) (-785.316) (-784.669) [-784.229] -- 0:00:21
644500 -- (-783.530) (-786.852) (-786.485) [-784.922] * (-784.278) (-785.603) [-785.556] (-784.866) -- 0:00:21
645000 -- [-784.901] (-786.289) (-783.925) (-784.600) * (-785.335) (-785.455) (-786.148) [-788.617] -- 0:00:21
Average standard deviation of split frequencies: 0.009143
645500 -- (-784.355) (-787.466) [-784.541] (-784.898) * (-785.316) (-783.021) [-784.048] (-785.976) -- 0:00:21
646000 -- (-786.303) [-784.685] (-783.553) (-784.920) * [-785.862] (-784.214) (-788.729) (-785.137) -- 0:00:21
646500 -- (-787.172) (-785.491) (-791.516) [-787.143] * (-790.094) [-783.182] (-784.392) (-783.024) -- 0:00:21
647000 -- (-785.738) [-785.993] (-787.380) (-787.677) * (-784.563) (-784.938) [-783.950] (-785.264) -- 0:00:21
647500 -- (-786.368) (-783.971) (-784.314) [-783.726] * [-784.557] (-787.192) (-786.457) (-785.238) -- 0:00:21
648000 -- (-786.581) [-783.267] (-785.106) (-787.363) * (-785.538) [-790.957] (-787.479) (-783.963) -- 0:00:21
648500 -- (-786.615) (-783.699) (-784.792) [-786.275] * [-784.103] (-789.991) (-786.508) (-784.039) -- 0:00:21
649000 -- (-784.569) [-783.664] (-788.912) (-784.283) * (-783.512) (-789.928) [-784.386] (-784.094) -- 0:00:21
649500 -- (-787.470) [-783.661] (-788.158) (-784.047) * (-784.619) (-786.465) (-784.066) [-789.168] -- 0:00:21
650000 -- [-785.002] (-785.454) (-786.743) (-784.294) * (-785.996) (-786.640) [-784.554] (-784.559) -- 0:00:21
Average standard deviation of split frequencies: 0.009589
650500 -- (-784.712) [-783.461] (-786.890) (-785.876) * (-786.236) [-786.501] (-785.802) (-784.644) -- 0:00:20
651000 -- (-785.179) (-786.898) (-784.324) [-787.466] * (-785.745) [-784.228] (-784.792) (-785.149) -- 0:00:20
651500 -- (-784.288) [-785.165] (-785.635) (-784.926) * (-786.993) (-786.303) (-785.995) [-783.775] -- 0:00:20
652000 -- (-784.699) (-786.094) [-785.171] (-786.338) * (-785.367) [-784.374] (-783.812) (-789.013) -- 0:00:21
652500 -- (-793.385) (-784.166) [-787.571] (-783.440) * (-786.323) [-786.586] (-783.479) (-785.495) -- 0:00:21
653000 -- (-784.427) [-784.108] (-786.582) (-784.021) * (-787.955) (-784.248) (-783.916) [-784.999] -- 0:00:21
653500 -- (-790.902) [-784.721] (-784.565) (-784.764) * (-787.958) [-784.206] (-784.495) (-784.353) -- 0:00:21
654000 -- (-785.287) (-790.737) [-787.119] (-784.629) * (-790.183) (-784.171) [-785.931] (-783.691) -- 0:00:21
654500 -- (-786.664) (-785.162) (-784.763) [-785.393] * (-786.624) (-785.963) [-784.471] (-787.853) -- 0:00:21
655000 -- (-791.759) [-790.491] (-783.926) (-786.679) * (-784.002) [-783.376] (-783.963) (-783.060) -- 0:00:21
Average standard deviation of split frequencies: 0.010272
655500 -- (-784.919) (-784.912) (-787.451) [-783.720] * (-785.767) [-784.075] (-783.827) (-784.135) -- 0:00:21
656000 -- (-784.548) [-785.475] (-787.057) (-786.945) * (-788.739) (-791.724) [-784.056] (-784.489) -- 0:00:20
656500 -- (-786.323) (-784.586) (-784.358) [-786.004] * (-785.615) (-786.725) (-787.032) [-786.797] -- 0:00:20
657000 -- [-787.357] (-788.420) (-784.021) (-789.139) * (-785.137) [-785.007] (-786.504) (-786.814) -- 0:00:20
657500 -- (-786.735) [-784.766] (-784.648) (-789.152) * [-785.138] (-784.050) (-784.690) (-784.587) -- 0:00:20
658000 -- (-785.041) (-784.655) (-787.250) [-785.013] * (-784.238) (-785.416) (-785.516) [-785.556] -- 0:00:20
658500 -- (-791.093) (-785.065) [-785.831] (-785.409) * (-788.540) (-785.869) [-785.490] (-784.338) -- 0:00:20
659000 -- (-787.228) (-783.199) [-786.544] (-785.357) * (-785.383) (-787.300) [-786.944] (-784.614) -- 0:00:20
659500 -- (-786.215) (-784.205) (-789.947) [-786.332] * (-784.382) (-783.609) [-789.103] (-786.372) -- 0:00:20
660000 -- (-787.357) (-784.906) [-786.525] (-787.764) * (-784.634) (-783.723) [-784.432] (-788.879) -- 0:00:20
Average standard deviation of split frequencies: 0.010787
660500 -- (-784.422) (-785.853) [-787.154] (-785.704) * (-785.964) [-785.602] (-784.262) (-784.936) -- 0:00:20
661000 -- (-788.825) (-784.059) (-785.845) [-787.937] * (-785.882) (-783.928) (-784.425) [-787.657] -- 0:00:20
661500 -- (-789.135) [-785.385] (-785.780) (-784.219) * (-785.651) [-785.109] (-784.129) (-785.600) -- 0:00:20
662000 -- (-784.847) [-784.202] (-784.195) (-785.186) * (-786.113) [-783.222] (-789.586) (-785.587) -- 0:00:20
662500 -- [-786.519] (-786.880) (-785.578) (-784.402) * (-785.950) (-786.449) (-786.075) [-785.131] -- 0:00:20
663000 -- (-785.811) (-786.654) [-784.731] (-785.949) * (-784.057) (-786.813) [-785.527] (-785.342) -- 0:00:20
663500 -- (-785.656) (-784.452) (-787.697) [-784.970] * (-785.259) (-787.741) (-786.984) [-784.070] -- 0:00:20
664000 -- (-785.943) (-788.537) [-783.679] (-787.321) * (-785.258) (-791.214) [-784.124] (-783.386) -- 0:00:20
664500 -- [-785.319] (-789.640) (-791.257) (-783.347) * (-784.489) (-786.286) (-784.791) [-783.113] -- 0:00:20
665000 -- (-786.570) (-788.077) (-783.431) [-784.410] * [-784.364] (-787.787) (-784.235) (-782.903) -- 0:00:20
Average standard deviation of split frequencies: 0.010825
665500 -- (-786.024) [-785.214] (-786.364) (-785.323) * (-786.265) (-783.646) [-784.334] (-783.256) -- 0:00:20
666000 -- [-791.087] (-784.362) (-788.569) (-785.545) * (-787.616) (-785.531) [-784.198] (-783.647) -- 0:00:20
666500 -- (-784.949) (-787.904) (-786.542) [-785.152] * (-785.764) (-785.205) [-787.603] (-784.504) -- 0:00:20
667000 -- [-787.811] (-788.985) (-787.707) (-786.878) * (-791.439) [-786.989] (-786.836) (-787.404) -- 0:00:19
667500 -- (-784.617) [-789.128] (-784.289) (-786.685) * (-785.790) (-786.329) (-785.606) [-784.361] -- 0:00:19
668000 -- (-785.380) (-790.041) (-783.619) [-788.491] * (-787.102) (-785.331) [-786.666] (-788.303) -- 0:00:19
668500 -- [-784.393] (-785.391) (-788.464) (-786.383) * (-784.776) (-783.776) [-785.953] (-783.433) -- 0:00:19
669000 -- [-785.223] (-787.544) (-786.365) (-784.895) * (-790.021) [-786.920] (-785.436) (-785.700) -- 0:00:20
669500 -- [-783.824] (-786.411) (-784.394) (-785.381) * (-785.504) (-787.172) [-784.579] (-784.169) -- 0:00:20
670000 -- [-784.038] (-784.828) (-784.517) (-784.434) * [-784.914] (-793.054) (-786.214) (-784.279) -- 0:00:20
Average standard deviation of split frequencies: 0.010709
670500 -- (-784.417) [-785.229] (-785.839) (-787.085) * [-783.767] (-786.792) (-786.388) (-784.227) -- 0:00:20
671000 -- (-785.614) (-784.916) (-787.878) [-788.710] * [-788.964] (-786.560) (-784.791) (-784.442) -- 0:00:20
671500 -- (-784.314) (-783.976) (-784.992) [-785.814] * [-783.342] (-784.058) (-783.580) (-787.486) -- 0:00:20
672000 -- (-784.414) (-786.530) [-784.390] (-788.882) * (-787.164) [-783.782] (-783.367) (-785.826) -- 0:00:20
672500 -- (-790.346) [-786.350] (-786.926) (-784.885) * (-784.983) (-785.214) [-783.671] (-788.486) -- 0:00:19
673000 -- (-791.873) [-786.661] (-784.777) (-785.551) * (-789.372) (-785.802) [-784.233] (-786.143) -- 0:00:19
673500 -- (-794.057) [-783.677] (-786.473) (-784.309) * (-787.530) [-785.947] (-785.101) (-786.068) -- 0:00:19
674000 -- (-789.623) (-787.337) (-785.636) [-786.698] * [-785.748] (-786.171) (-785.288) (-783.638) -- 0:00:19
674500 -- (-791.597) (-784.349) (-786.532) [-783.668] * (-785.148) (-783.592) [-784.024] (-785.021) -- 0:00:19
675000 -- (-787.944) (-783.099) (-785.964) [-783.748] * (-784.997) [-784.062] (-787.147) (-786.677) -- 0:00:19
Average standard deviation of split frequencies: 0.010583
675500 -- [-784.354] (-786.488) (-789.199) (-783.613) * (-783.344) (-785.837) (-786.276) [-787.596] -- 0:00:19
676000 -- (-784.861) [-784.202] (-787.308) (-783.291) * [-783.729] (-785.064) (-785.869) (-786.266) -- 0:00:19
676500 -- (-787.085) (-783.340) (-788.983) [-783.377] * (-783.635) [-785.977] (-791.829) (-786.697) -- 0:00:19
677000 -- (-785.307) (-784.498) (-789.064) [-785.141] * (-784.118) (-785.835) (-785.667) [-786.674] -- 0:00:19
677500 -- (-783.173) [-783.446] (-785.473) (-785.789) * (-784.578) (-784.632) (-787.362) [-787.017] -- 0:00:19
678000 -- (-785.423) [-784.413] (-787.043) (-784.916) * (-786.614) (-786.185) [-783.402] (-792.659) -- 0:00:19
678500 -- (-784.874) (-783.364) [-783.221] (-788.648) * (-788.270) [-782.890] (-787.287) (-783.799) -- 0:00:19
679000 -- (-786.130) (-785.481) (-783.548) [-788.233] * (-787.249) (-786.122) (-783.944) [-783.646] -- 0:00:19
679500 -- (-787.675) (-784.506) [-787.900] (-785.063) * [-783.622] (-783.875) (-789.404) (-783.296) -- 0:00:19
680000 -- (-785.467) (-783.509) [-786.349] (-783.584) * (-785.261) (-783.295) (-783.625) [-783.048] -- 0:00:19
Average standard deviation of split frequencies: 0.010063
680500 -- (-784.891) (-786.186) (-784.391) [-783.736] * [-784.025] (-786.504) (-785.667) (-785.557) -- 0:00:19
681000 -- (-783.823) [-788.616] (-787.665) (-786.574) * (-786.491) (-785.847) (-784.813) [-785.491] -- 0:00:19
681500 -- (-783.888) (-785.695) [-783.774] (-787.344) * (-786.728) (-784.809) [-786.548] (-785.024) -- 0:00:19
682000 -- (-785.600) (-788.601) [-789.863] (-784.958) * (-785.944) [-785.520] (-786.078) (-785.206) -- 0:00:19
682500 -- (-784.340) (-785.313) [-784.143] (-783.989) * (-785.114) (-791.283) (-784.246) [-785.609] -- 0:00:19
683000 -- (-786.295) (-783.391) (-784.354) [-783.406] * (-783.819) (-783.002) [-784.238] (-784.868) -- 0:00:19
683500 -- (-783.583) [-785.305] (-784.585) (-783.481) * (-785.391) (-784.582) [-784.619] (-786.077) -- 0:00:18
684000 -- (-784.306) [-784.117] (-787.523) (-786.362) * (-788.527) (-786.816) (-785.082) [-784.181] -- 0:00:18
684500 -- (-784.743) [-786.406] (-785.527) (-785.293) * (-786.514) [-784.826] (-783.328) (-783.487) -- 0:00:18
685000 -- (-783.217) (-788.116) [-784.118] (-785.724) * (-785.716) (-788.135) [-783.244] (-783.439) -- 0:00:18
Average standard deviation of split frequencies: 0.009863
685500 -- (-787.102) (-787.168) [-783.194] (-785.781) * (-785.715) [-785.190] (-783.489) (-783.818) -- 0:00:19
686000 -- (-785.540) (-785.569) (-783.479) [-784.803] * (-783.868) (-785.368) [-784.492] (-785.524) -- 0:00:19
686500 -- (-786.908) [-785.260] (-786.010) (-788.828) * (-784.319) (-785.585) [-784.122] (-785.979) -- 0:00:19
687000 -- (-792.112) (-783.748) (-785.245) [-783.166] * (-785.466) [-784.525] (-784.501) (-784.933) -- 0:00:19
687500 -- [-788.538] (-786.484) (-789.554) (-784.163) * (-786.703) (-785.991) [-784.638] (-785.659) -- 0:00:19
688000 -- (-787.318) [-783.843] (-785.899) (-785.137) * (-784.565) (-786.854) (-785.233) [-783.807] -- 0:00:19
688500 -- (-789.251) (-783.942) (-787.584) [-784.896] * [-788.710] (-785.866) (-783.686) (-786.023) -- 0:00:19
689000 -- (-786.880) [-784.527] (-783.988) (-786.196) * (-789.152) [-783.756] (-785.489) (-783.261) -- 0:00:18
689500 -- (-786.398) (-786.845) (-785.200) [-788.287] * (-785.557) [-784.950] (-783.687) (-785.095) -- 0:00:18
690000 -- (-785.016) (-784.037) [-785.313] (-788.229) * (-785.633) (-787.551) (-784.513) [-783.133] -- 0:00:18
Average standard deviation of split frequencies: 0.009114
690500 -- (-788.143) [-788.577] (-785.285) (-787.264) * [-788.297] (-787.891) (-785.619) (-783.450) -- 0:00:18
691000 -- (-786.981) [-783.896] (-784.029) (-783.372) * (-783.862) (-786.045) [-784.632] (-787.895) -- 0:00:18
691500 -- (-786.571) (-783.276) [-787.831] (-785.282) * [-784.187] (-783.447) (-785.262) (-784.654) -- 0:00:18
692000 -- (-784.926) [-784.655] (-783.387) (-789.445) * (-787.840) [-784.399] (-788.283) (-784.888) -- 0:00:18
692500 -- (-786.050) (-784.692) (-783.299) [-783.189] * (-787.871) [-783.017] (-784.550) (-785.768) -- 0:00:18
693000 -- (-785.755) (-784.019) (-783.286) [-783.893] * (-785.719) (-784.502) (-784.458) [-783.413] -- 0:00:18
693500 -- (-783.980) (-784.410) [-783.213] (-787.967) * [-790.335] (-783.579) (-787.601) (-784.617) -- 0:00:18
694000 -- [-784.522] (-783.214) (-784.430) (-786.162) * (-786.246) [-787.755] (-785.992) (-786.935) -- 0:00:18
694500 -- [-784.681] (-787.701) (-784.767) (-787.338) * [-785.156] (-791.317) (-786.264) (-784.190) -- 0:00:18
695000 -- (-784.990) (-783.410) [-786.939] (-787.386) * [-785.256] (-788.153) (-788.887) (-783.021) -- 0:00:18
Average standard deviation of split frequencies: 0.009243
695500 -- (-785.974) [-783.909] (-783.643) (-784.824) * (-785.379) [-784.475] (-787.065) (-783.591) -- 0:00:18
696000 -- (-785.963) [-784.591] (-783.252) (-784.651) * (-784.226) (-783.648) [-787.678] (-789.024) -- 0:00:18
696500 -- [-783.980] (-785.020) (-783.693) (-784.105) * (-785.643) (-783.119) [-785.981] (-784.893) -- 0:00:18
697000 -- (-783.623) (-783.686) (-785.411) [-785.106] * [-785.286] (-783.268) (-785.313) (-784.445) -- 0:00:18
697500 -- (-784.079) (-785.619) [-784.947] (-784.227) * (-783.719) (-784.682) [-783.439] (-783.782) -- 0:00:18
698000 -- (-783.363) [-784.085] (-788.196) (-788.851) * [-783.986] (-786.585) (-784.904) (-785.860) -- 0:00:18
698500 -- (-786.078) (-784.751) (-785.065) [-784.672] * (-783.552) (-790.705) (-783.900) [-785.342] -- 0:00:18
699000 -- (-786.309) (-783.481) [-783.920] (-785.939) * (-783.524) [-785.374] (-787.926) (-784.487) -- 0:00:18
699500 -- [-786.715] (-784.761) (-787.709) (-788.887) * [-785.940] (-784.479) (-785.667) (-787.364) -- 0:00:18
700000 -- (-784.965) [-783.700] (-789.134) (-785.461) * (-783.467) [-784.065] (-784.788) (-785.907) -- 0:00:18
Average standard deviation of split frequencies: 0.009209
700500 -- (-786.016) (-783.724) (-785.464) [-786.934] * [-783.152] (-786.726) (-791.896) (-784.416) -- 0:00:17
701000 -- (-784.359) (-784.049) (-784.749) [-785.178] * (-785.798) [-786.477] (-785.361) (-784.927) -- 0:00:17
701500 -- (-783.885) (-785.638) [-784.474] (-787.912) * (-785.638) (-790.299) (-786.082) [-784.699] -- 0:00:17
702000 -- [-785.708] (-784.551) (-785.818) (-787.938) * [-785.293] (-791.709) (-786.450) (-784.856) -- 0:00:17
702500 -- (-783.960) [-784.305] (-785.448) (-786.548) * (-789.504) [-788.797] (-786.594) (-785.552) -- 0:00:18
703000 -- (-785.692) [-785.483] (-785.394) (-786.864) * (-785.246) [-783.990] (-784.503) (-786.408) -- 0:00:18
703500 -- (-784.332) [-785.764] (-786.069) (-784.393) * (-784.058) (-784.151) [-784.646] (-784.565) -- 0:00:18
704000 -- [-785.263] (-788.896) (-785.785) (-786.895) * (-783.260) (-783.944) [-785.266] (-783.590) -- 0:00:18
704500 -- [-784.697] (-786.448) (-788.174) (-784.517) * (-783.441) [-786.420] (-786.106) (-785.045) -- 0:00:18
705000 -- [-783.434] (-787.912) (-784.725) (-783.663) * (-785.973) (-784.687) (-786.886) [-785.070] -- 0:00:17
Average standard deviation of split frequencies: 0.009390
705500 -- [-788.586] (-783.659) (-789.826) (-787.160) * [-785.044] (-783.905) (-786.456) (-785.084) -- 0:00:17
706000 -- [-785.944] (-787.847) (-786.567) (-788.069) * (-786.488) [-784.301] (-789.332) (-785.668) -- 0:00:17
706500 -- (-785.633) (-784.360) [-786.862] (-790.678) * (-784.074) (-785.058) [-783.406] (-787.920) -- 0:00:17
707000 -- [-788.351] (-785.505) (-785.121) (-788.663) * (-787.309) [-793.055] (-787.100) (-786.854) -- 0:00:17
707500 -- (-785.993) (-786.994) (-785.412) [-785.217] * (-783.052) [-784.349] (-796.594) (-786.265) -- 0:00:17
708000 -- (-784.807) (-785.074) (-784.243) [-785.253] * (-783.621) (-785.929) [-785.708] (-786.351) -- 0:00:17
708500 -- [-784.270] (-785.471) (-785.457) (-783.724) * (-785.120) (-784.760) [-783.612] (-791.356) -- 0:00:17
709000 -- [-783.807] (-786.507) (-783.826) (-787.124) * [-785.477] (-788.049) (-785.033) (-783.377) -- 0:00:17
709500 -- (-785.316) (-790.993) [-785.124] (-785.937) * (-788.449) (-783.869) (-785.479) [-783.818] -- 0:00:17
710000 -- (-787.853) [-786.117] (-785.170) (-786.053) * [-786.829] (-784.183) (-785.940) (-787.828) -- 0:00:17
Average standard deviation of split frequencies: 0.009535
710500 -- (-788.161) (-786.233) (-786.587) [-785.242] * [-784.918] (-784.350) (-785.369) (-785.506) -- 0:00:17
711000 -- (-787.025) (-784.610) [-785.727] (-786.014) * (-784.539) [-785.622] (-785.618) (-784.877) -- 0:00:17
711500 -- (-786.384) (-784.428) [-785.567] (-787.887) * [-783.854] (-784.871) (-786.559) (-784.603) -- 0:00:17
712000 -- (-783.089) (-784.020) (-785.830) [-786.513] * (-787.549) [-785.013] (-784.097) (-785.152) -- 0:00:17
712500 -- (-783.052) [-783.833] (-783.719) (-784.588) * [-786.008] (-789.110) (-784.741) (-786.522) -- 0:00:17
713000 -- (-786.186) (-788.421) (-787.131) [-784.294] * (-783.447) [-783.656] (-783.471) (-788.547) -- 0:00:17
713500 -- (-788.195) (-786.673) [-784.947] (-785.605) * (-784.461) [-786.513] (-784.951) (-785.711) -- 0:00:17
714000 -- (-786.625) (-790.567) (-785.645) [-784.250] * [-786.517] (-788.758) (-785.500) (-785.778) -- 0:00:17
714500 -- [-784.536] (-786.298) (-785.048) (-783.164) * (-784.563) (-785.666) [-785.068] (-787.117) -- 0:00:17
715000 -- (-783.932) (-784.440) (-785.136) [-784.208] * (-786.843) (-785.716) [-783.489] (-784.557) -- 0:00:17
Average standard deviation of split frequencies: 0.009135
715500 -- (-784.659) (-783.404) (-785.960) [-785.720] * (-790.141) [-784.650] (-784.049) (-783.957) -- 0:00:17
716000 -- (-785.515) [-784.475] (-787.775) (-784.488) * (-787.725) (-784.263) (-785.068) [-784.669] -- 0:00:17
716500 -- (-785.144) (-784.216) [-785.231] (-783.824) * (-792.391) [-785.349] (-787.242) (-785.893) -- 0:00:17
717000 -- (-784.555) (-785.144) [-784.567] (-784.612) * [-784.970] (-785.312) (-788.881) (-784.675) -- 0:00:16
717500 -- [-784.056] (-784.436) (-785.528) (-785.764) * (-785.045) [-792.617] (-787.456) (-785.912) -- 0:00:16
718000 -- (-783.203) [-785.224] (-784.622) (-783.514) * (-792.034) (-790.414) [-785.207] (-787.109) -- 0:00:16
718500 -- (-787.447) (-785.700) (-786.055) [-783.383] * (-787.316) (-787.140) (-786.528) [-787.139] -- 0:00:16
719000 -- (-788.842) (-785.389) (-784.363) [-786.436] * [-783.707] (-784.699) (-784.683) (-785.883) -- 0:00:16
719500 -- (-791.605) [-785.159] (-784.055) (-786.876) * [-785.483] (-786.919) (-785.670) (-787.709) -- 0:00:17
720000 -- (-787.290) [-783.313] (-791.923) (-788.967) * (-783.137) (-785.272) (-786.237) [-787.316] -- 0:00:17
Average standard deviation of split frequencies: 0.009117
720500 -- (-783.878) (-788.507) [-784.231] (-785.595) * (-783.234) (-784.092) (-786.924) [-785.221] -- 0:00:17
721000 -- (-783.840) [-783.662] (-784.468) (-784.699) * (-783.551) [-785.621] (-785.527) (-785.638) -- 0:00:17
721500 -- (-784.104) (-785.741) [-785.940] (-785.342) * (-782.993) (-784.911) [-785.801] (-785.154) -- 0:00:16
722000 -- [-788.681] (-784.243) (-783.987) (-789.613) * (-784.278) (-786.868) (-787.660) [-790.088] -- 0:00:16
722500 -- (-787.179) (-787.480) (-784.556) [-785.180] * (-783.476) (-786.928) (-785.614) [-783.549] -- 0:00:16
723000 -- (-785.270) (-784.383) [-787.898] (-785.139) * [-783.094] (-786.045) (-783.232) (-784.832) -- 0:00:16
723500 -- (-786.078) (-791.612) (-783.434) [-785.520] * (-787.470) (-784.931) (-783.969) [-785.498] -- 0:00:16
724000 -- (-786.399) (-785.643) [-783.825] (-784.436) * (-784.724) (-783.998) [-785.741] (-785.888) -- 0:00:16
724500 -- (-783.916) (-786.448) (-785.917) [-784.984] * (-784.260) (-785.103) (-786.706) [-785.045] -- 0:00:16
725000 -- (-786.979) (-785.229) [-783.564] (-784.216) * [-785.226] (-786.830) (-785.169) (-785.502) -- 0:00:16
Average standard deviation of split frequencies: 0.009334
725500 -- (-787.538) (-787.647) (-788.768) [-786.797] * [-784.930] (-784.037) (-789.228) (-788.239) -- 0:00:16
726000 -- (-784.932) (-783.543) [-785.946] (-783.525) * (-785.220) (-784.426) [-783.556] (-786.757) -- 0:00:16
726500 -- [-786.320] (-786.799) (-784.037) (-788.604) * (-787.004) (-785.034) (-788.178) [-787.233] -- 0:00:16
727000 -- (-786.747) (-786.793) [-784.833] (-785.953) * (-785.589) [-786.538] (-783.559) (-784.392) -- 0:00:16
727500 -- (-783.847) (-784.455) (-789.229) [-785.453] * (-784.038) [-785.518] (-783.502) (-785.194) -- 0:00:16
728000 -- (-785.856) (-784.820) (-785.297) [-785.892] * [-787.936] (-784.259) (-784.095) (-784.644) -- 0:00:16
728500 -- (-784.130) (-785.210) (-787.318) [-783.687] * [-784.435] (-784.477) (-784.546) (-789.082) -- 0:00:16
729000 -- (-784.251) (-785.067) [-784.862] (-784.711) * [-784.180] (-783.629) (-783.691) (-793.427) -- 0:00:16
729500 -- (-784.399) (-784.395) (-786.694) [-786.085] * [-784.660] (-783.527) (-786.494) (-785.050) -- 0:00:16
730000 -- (-790.413) (-785.873) [-788.161] (-785.677) * (-786.471) (-787.726) (-783.944) [-784.812] -- 0:00:16
Average standard deviation of split frequencies: 0.008952
730500 -- (-783.159) [-784.452] (-784.698) (-786.208) * [-784.728] (-785.476) (-784.550) (-784.979) -- 0:00:16
731000 -- (-783.334) (-784.017) [-784.727] (-783.700) * (-785.881) (-783.625) (-784.276) [-783.824] -- 0:00:16
731500 -- [-786.005] (-783.741) (-785.290) (-784.376) * (-784.492) [-786.163] (-787.304) (-783.746) -- 0:00:16
732000 -- (-784.614) (-783.581) [-785.477] (-783.513) * [-784.864] (-784.507) (-787.071) (-786.044) -- 0:00:16
732500 -- [-787.038] (-783.467) (-784.370) (-789.727) * (-785.974) [-785.649] (-791.971) (-783.541) -- 0:00:16
733000 -- (-783.632) (-784.229) [-784.021] (-793.589) * (-783.743) (-784.647) [-786.832] (-785.883) -- 0:00:16
733500 -- (-788.823) (-784.552) [-792.395] (-785.152) * [-784.094] (-786.115) (-786.652) (-785.497) -- 0:00:15
734000 -- (-785.310) [-785.418] (-790.950) (-783.584) * [-783.710] (-784.520) (-785.978) (-786.144) -- 0:00:15
734500 -- (-784.356) (-786.226) [-785.642] (-784.172) * (-783.831) [-783.869] (-784.398) (-784.880) -- 0:00:15
735000 -- (-783.987) [-783.013] (-784.618) (-783.914) * (-784.375) (-784.791) (-785.887) [-785.931] -- 0:00:15
Average standard deviation of split frequencies: 0.009287
735500 -- (-786.350) (-784.373) (-784.942) [-784.489] * [-784.482] (-784.018) (-786.509) (-789.003) -- 0:00:15
736000 -- (-784.234) (-783.910) [-783.959] (-783.678) * [-783.344] (-784.224) (-785.811) (-786.132) -- 0:00:16
736500 -- [-783.976] (-784.391) (-784.427) (-784.982) * [-783.804] (-786.810) (-785.981) (-785.589) -- 0:00:16
737000 -- (-784.686) (-784.647) [-784.582] (-786.887) * (-786.717) (-784.551) [-786.419] (-784.902) -- 0:00:16
737500 -- [-790.119] (-785.185) (-792.550) (-788.862) * (-783.853) [-785.086] (-784.058) (-785.162) -- 0:00:16
738000 -- (-788.520) (-783.685) (-787.402) [-784.201] * [-783.196] (-783.823) (-785.072) (-786.340) -- 0:00:15
738500 -- (-784.032) [-786.392] (-786.750) (-783.527) * (-785.299) (-786.714) (-785.836) [-785.343] -- 0:00:15
739000 -- (-785.893) [-786.042] (-788.505) (-784.954) * (-785.237) [-785.028] (-787.003) (-783.929) -- 0:00:15
739500 -- (-790.708) (-785.299) [-789.370] (-787.065) * (-783.392) (-785.895) [-787.317] (-786.173) -- 0:00:15
740000 -- (-786.490) (-784.604) (-787.414) [-785.403] * [-785.627] (-787.073) (-785.187) (-785.496) -- 0:00:15
Average standard deviation of split frequencies: 0.009308
740500 -- (-785.165) (-785.069) (-785.850) [-783.509] * [-787.482] (-786.093) (-785.852) (-785.277) -- 0:00:15
741000 -- [-786.463] (-785.803) (-786.022) (-783.814) * (-788.153) [-784.226] (-785.354) (-784.187) -- 0:00:15
741500 -- (-784.382) [-782.922] (-787.326) (-784.450) * [-788.244] (-786.683) (-784.217) (-784.547) -- 0:00:15
742000 -- [-784.016] (-787.725) (-784.690) (-783.803) * (-785.609) (-784.399) (-784.779) [-784.048] -- 0:00:15
742500 -- [-785.307] (-785.856) (-783.970) (-786.495) * [-787.508] (-786.397) (-783.763) (-787.149) -- 0:00:15
743000 -- [-783.392] (-784.813) (-784.530) (-783.276) * (-786.559) (-787.960) [-784.334] (-785.296) -- 0:00:15
743500 -- [-783.380] (-787.868) (-785.489) (-785.737) * [-785.486] (-784.984) (-784.439) (-784.939) -- 0:00:15
744000 -- (-783.138) (-784.746) [-783.784] (-784.963) * (-785.825) (-788.136) [-783.579] (-786.848) -- 0:00:15
744500 -- (-785.939) (-784.425) (-784.405) [-785.339] * (-784.249) (-783.722) [-784.099] (-788.711) -- 0:00:15
745000 -- (-785.169) [-784.589] (-784.982) (-785.913) * [-784.070] (-785.314) (-786.043) (-784.357) -- 0:00:15
Average standard deviation of split frequencies: 0.009439
745500 -- (-785.318) (-787.003) (-783.711) [-787.501] * (-785.984) [-788.928] (-784.750) (-786.138) -- 0:00:15
746000 -- (-787.697) (-783.549) [-785.049] (-791.094) * (-783.793) (-784.283) [-786.438] (-783.114) -- 0:00:15
746500 -- (-785.454) (-783.266) (-784.052) [-785.719] * (-783.964) (-785.016) (-784.813) [-783.662] -- 0:00:15
747000 -- (-792.028) (-787.090) (-783.688) [-786.624] * (-784.004) [-784.503] (-784.462) (-784.581) -- 0:00:15
747500 -- (-785.655) (-786.052) [-786.408] (-786.590) * (-785.309) (-783.203) (-788.144) [-784.096] -- 0:00:15
748000 -- (-786.062) [-784.435] (-783.444) (-787.151) * (-784.865) [-784.879] (-786.760) (-785.581) -- 0:00:15
748500 -- (-785.042) (-787.973) (-784.962) [-785.957] * (-784.832) (-786.534) (-787.363) [-789.780] -- 0:00:15
749000 -- [-785.715] (-785.997) (-786.270) (-786.604) * (-784.964) (-784.633) [-785.840] (-783.615) -- 0:00:15
749500 -- [-787.005] (-785.205) (-784.819) (-793.292) * (-787.159) [-784.709] (-783.062) (-786.392) -- 0:00:15
750000 -- (-787.196) (-785.780) [-784.463] (-790.732) * (-784.574) (-783.268) (-788.314) [-786.061] -- 0:00:15
Average standard deviation of split frequencies: 0.008831
750500 -- (-786.595) [-784.745] (-784.989) (-784.154) * (-784.481) [-783.601] (-785.973) (-788.330) -- 0:00:14
751000 -- (-788.841) (-783.808) [-784.273] (-785.714) * [-783.656] (-783.366) (-788.261) (-786.745) -- 0:00:14
751500 -- (-789.354) [-784.570] (-785.545) (-788.940) * (-784.857) (-787.526) (-784.542) [-785.947] -- 0:00:14
752000 -- (-787.287) [-788.752] (-789.675) (-785.767) * (-785.206) [-786.442] (-785.761) (-783.312) -- 0:00:14
752500 -- (-783.691) (-784.617) [-787.037] (-785.061) * (-786.317) [-784.709] (-791.148) (-784.624) -- 0:00:14
753000 -- [-787.609] (-783.466) (-788.004) (-784.957) * (-786.821) (-783.852) [-786.034] (-786.326) -- 0:00:15
753500 -- [-783.743] (-786.321) (-783.106) (-783.440) * (-783.695) (-785.237) (-786.714) [-787.561] -- 0:00:15
754000 -- [-784.043] (-788.845) (-785.345) (-785.449) * (-786.714) (-783.325) [-785.941] (-784.808) -- 0:00:15
754500 -- [-784.284] (-784.720) (-784.947) (-783.777) * [-789.664] (-785.317) (-785.050) (-786.889) -- 0:00:14
755000 -- [-785.998] (-786.102) (-785.896) (-784.501) * (-784.624) (-788.688) (-786.074) [-784.062] -- 0:00:14
Average standard deviation of split frequencies: 0.008457
755500 -- (-787.651) (-788.196) [-785.769] (-786.552) * [-783.788] (-785.523) (-783.759) (-787.761) -- 0:00:14
756000 -- [-784.895] (-783.603) (-783.711) (-785.268) * (-783.640) (-784.348) [-783.933] (-785.646) -- 0:00:14
756500 -- (-789.234) [-785.304] (-784.459) (-785.361) * (-786.581) [-783.826] (-785.859) (-784.202) -- 0:00:14
757000 -- (-786.714) [-786.181] (-784.644) (-787.499) * [-786.159] (-783.361) (-784.897) (-787.472) -- 0:00:14
757500 -- (-790.423) [-783.993] (-786.485) (-784.783) * (-785.297) (-783.942) [-785.361] (-787.650) -- 0:00:14
758000 -- [-786.301] (-783.327) (-784.476) (-784.301) * [-783.705] (-788.194) (-787.567) (-786.978) -- 0:00:14
758500 -- (-784.593) (-783.923) [-784.215] (-785.958) * (-785.810) (-787.410) [-784.349] (-786.747) -- 0:00:14
759000 -- (-788.956) (-784.880) [-784.531] (-787.240) * (-787.708) [-787.559] (-789.319) (-784.676) -- 0:00:14
759500 -- (-786.525) [-784.073] (-788.677) (-785.327) * (-784.675) [-784.441] (-787.426) (-783.855) -- 0:00:14
760000 -- (-789.582) [-785.970] (-789.249) (-786.402) * [-783.902] (-787.242) (-784.630) (-784.825) -- 0:00:14
Average standard deviation of split frequencies: 0.008134
760500 -- [-786.657] (-784.242) (-786.069) (-784.340) * [-784.207] (-783.972) (-784.875) (-783.897) -- 0:00:14
761000 -- [-783.615] (-787.867) (-786.916) (-784.002) * (-785.701) [-783.295] (-784.280) (-785.634) -- 0:00:14
761500 -- [-787.322] (-790.138) (-786.441) (-789.281) * (-784.575) (-783.376) (-783.182) [-783.926] -- 0:00:14
762000 -- (-786.205) (-784.042) (-785.741) [-788.081] * (-785.031) [-783.263] (-783.818) (-786.021) -- 0:00:14
762500 -- (-785.222) [-783.221] (-785.013) (-784.517) * (-785.766) (-783.040) (-784.494) [-786.555] -- 0:00:14
763000 -- (-784.884) [-783.415] (-783.730) (-784.769) * (-785.691) (-785.750) (-787.936) [-787.377] -- 0:00:14
763500 -- (-786.041) (-785.145) [-785.006] (-784.134) * (-786.000) (-787.049) (-787.342) [-787.219] -- 0:00:14
764000 -- (-784.973) (-782.991) [-783.907] (-787.194) * (-786.251) (-786.010) (-788.411) [-786.489] -- 0:00:14
764500 -- (-785.963) (-783.369) [-784.775] (-784.794) * (-785.751) (-785.175) [-786.889] (-785.964) -- 0:00:14
765000 -- (-783.247) (-784.142) [-786.852] (-789.440) * (-786.680) [-784.283] (-785.659) (-785.526) -- 0:00:14
Average standard deviation of split frequencies: 0.007808
765500 -- (-785.390) [-784.988] (-784.789) (-792.455) * [-789.973] (-784.748) (-786.277) (-789.269) -- 0:00:14
766000 -- [-784.930] (-784.978) (-785.464) (-784.807) * (-784.740) (-784.510) [-784.598] (-787.522) -- 0:00:14
766500 -- (-785.289) [-783.520] (-784.768) (-788.135) * (-786.291) (-787.421) (-788.707) [-787.873] -- 0:00:14
767000 -- [-785.357] (-783.463) (-785.294) (-789.827) * [-785.914] (-784.452) (-786.300) (-788.231) -- 0:00:13
767500 -- [-788.153] (-783.282) (-786.399) (-784.071) * (-786.064) [-783.173] (-786.589) (-785.433) -- 0:00:13
768000 -- (-784.571) [-783.269] (-789.232) (-787.787) * [-784.606] (-782.926) (-789.707) (-787.155) -- 0:00:13
768500 -- [-783.722] (-783.493) (-788.971) (-785.633) * (-784.477) (-783.862) [-784.980] (-787.636) -- 0:00:13
769000 -- (-783.313) (-784.899) (-785.382) [-784.526] * (-784.738) (-784.195) [-784.636] (-785.246) -- 0:00:13
769500 -- [-785.244] (-784.278) (-783.999) (-783.854) * (-784.630) [-784.073] (-788.537) (-788.900) -- 0:00:14
770000 -- (-785.672) (-784.175) (-783.865) [-785.083] * (-791.237) (-784.916) [-787.111] (-785.660) -- 0:00:14
Average standard deviation of split frequencies: 0.008105
770500 -- (-785.344) (-786.274) [-784.163] (-784.778) * (-787.959) (-787.064) (-787.192) [-785.695] -- 0:00:13
771000 -- (-784.675) [-786.702] (-783.092) (-785.436) * (-788.944) (-784.975) [-789.892] (-783.094) -- 0:00:13
771500 -- [-786.433] (-787.111) (-787.390) (-786.474) * (-786.463) (-784.870) [-785.803] (-784.902) -- 0:00:13
772000 -- (-786.337) (-784.592) [-785.295] (-788.738) * (-786.378) (-784.240) (-787.270) [-783.034] -- 0:00:13
772500 -- (-788.509) [-785.289] (-784.358) (-788.853) * (-784.945) (-783.750) (-785.002) [-783.382] -- 0:00:13
773000 -- (-785.557) (-784.572) (-784.919) [-787.109] * [-784.463] (-783.628) (-785.448) (-789.160) -- 0:00:13
773500 -- (-783.274) (-784.706) (-785.663) [-783.881] * (-786.489) [-785.169] (-783.982) (-785.942) -- 0:00:13
774000 -- (-783.488) [-784.167] (-786.214) (-784.248) * (-788.982) (-786.563) (-784.749) [-785.158] -- 0:00:13
774500 -- (-789.753) (-785.065) [-784.616] (-785.601) * (-790.021) (-786.201) (-785.821) [-784.474] -- 0:00:13
775000 -- (-785.317) [-785.876] (-786.423) (-788.036) * [-786.202] (-783.804) (-782.836) (-785.688) -- 0:00:13
Average standard deviation of split frequencies: 0.007935
775500 -- (-784.192) [-785.640] (-788.304) (-785.731) * (-783.660) (-785.603) [-783.064] (-785.688) -- 0:00:13
776000 -- (-784.414) (-783.969) [-786.035] (-785.692) * (-783.226) (-783.851) [-785.557] (-784.322) -- 0:00:13
776500 -- (-786.131) (-785.627) (-785.778) [-786.768] * (-783.237) (-784.339) (-787.321) [-784.461] -- 0:00:13
777000 -- (-785.573) [-785.787] (-784.959) (-784.978) * (-784.492) [-783.365] (-785.628) (-784.293) -- 0:00:13
777500 -- (-784.365) [-786.786] (-784.361) (-785.325) * [-786.866] (-786.024) (-786.265) (-784.879) -- 0:00:13
778000 -- (-784.696) (-787.216) (-783.836) [-783.406] * (-792.535) [-784.097] (-788.288) (-784.776) -- 0:00:13
778500 -- (-783.860) (-785.470) [-783.841] (-785.919) * (-787.183) (-783.669) (-783.453) [-785.322] -- 0:00:13
779000 -- (-783.658) (-787.113) [-786.343] (-787.760) * (-783.629) [-784.270] (-789.347) (-786.939) -- 0:00:13
779500 -- (-784.398) (-785.469) (-785.680) [-784.753] * (-786.645) (-784.571) (-787.199) [-784.115] -- 0:00:13
780000 -- [-787.150] (-785.309) (-787.076) (-783.644) * (-787.626) (-786.158) (-785.580) [-788.828] -- 0:00:13
Average standard deviation of split frequencies: 0.007812
780500 -- (-787.800) [-786.906] (-784.555) (-786.551) * (-785.909) (-786.185) [-783.741] (-784.681) -- 0:00:13
781000 -- (-785.215) (-786.163) [-786.068] (-786.584) * (-785.198) (-786.468) [-786.861] (-785.272) -- 0:00:13
781500 -- (-785.070) (-788.489) [-783.440] (-784.244) * (-784.803) (-788.868) (-787.342) [-788.083] -- 0:00:13
782000 -- (-785.164) [-784.259] (-784.719) (-786.720) * (-785.281) (-785.904) (-787.047) [-786.381] -- 0:00:13
782500 -- (-783.611) [-783.958] (-786.407) (-783.199) * (-792.814) (-787.570) [-783.789] (-785.565) -- 0:00:13
783000 -- (-782.954) (-783.630) (-786.499) [-784.978] * [-786.314] (-786.045) (-784.404) (-785.022) -- 0:00:13
783500 -- (-783.878) (-784.423) (-790.192) [-783.556] * [-783.481] (-784.854) (-787.240) (-785.516) -- 0:00:12
784000 -- (-783.766) (-785.407) (-787.718) [-788.259] * [-786.204] (-784.504) (-783.768) (-788.166) -- 0:00:12
784500 -- [-783.332] (-787.449) (-784.170) (-787.168) * (-784.033) [-783.169] (-784.423) (-790.260) -- 0:00:12
785000 -- (-785.629) (-788.917) [-786.831] (-783.737) * (-786.687) (-787.053) (-791.365) [-786.547] -- 0:00:12
Average standard deviation of split frequencies: 0.007872
785500 -- (-783.974) (-793.362) (-784.206) [-784.264] * (-783.656) (-785.169) (-785.833) [-786.023] -- 0:00:12
786000 -- (-786.997) (-788.532) (-783.493) [-785.020] * (-783.951) (-786.882) [-784.848] (-790.050) -- 0:00:13
786500 -- (-786.917) (-785.700) [-783.538] (-783.991) * (-785.338) [-783.907] (-786.681) (-786.120) -- 0:00:13
787000 -- (-783.184) (-784.057) (-787.155) [-783.978] * (-784.596) [-785.422] (-784.823) (-783.231) -- 0:00:12
787500 -- [-784.984] (-785.925) (-785.409) (-787.568) * (-785.192) [-785.227] (-789.510) (-786.671) -- 0:00:12
788000 -- [-785.568] (-785.180) (-786.239) (-786.171) * (-783.532) (-784.878) [-788.613] (-783.102) -- 0:00:12
788500 -- [-784.047] (-784.068) (-783.741) (-784.355) * (-783.697) (-783.327) [-783.877] (-784.969) -- 0:00:12
789000 -- (-783.675) (-785.515) [-784.353] (-784.373) * (-785.345) (-783.873) [-786.552] (-784.191) -- 0:00:12
789500 -- [-785.972] (-786.735) (-783.337) (-786.245) * (-785.237) [-783.874] (-783.792) (-786.768) -- 0:00:12
790000 -- (-783.872) (-785.936) (-785.475) [-785.655] * (-785.982) [-786.497] (-783.709) (-785.910) -- 0:00:12
Average standard deviation of split frequencies: 0.007639
790500 -- (-783.315) [-784.824] (-786.872) (-785.139) * (-792.647) (-787.372) (-784.478) [-784.205] -- 0:00:12
791000 -- (-783.958) [-786.314] (-783.326) (-786.822) * (-787.977) [-786.328] (-787.178) (-784.055) -- 0:00:12
791500 -- (-787.076) (-785.960) [-784.289] (-784.225) * (-786.347) (-785.363) [-784.150] (-784.809) -- 0:00:12
792000 -- (-787.585) (-785.530) [-784.414] (-785.399) * (-785.984) (-786.120) (-785.863) [-784.682] -- 0:00:12
792500 -- (-789.219) (-784.182) (-785.185) [-783.543] * [-785.335] (-785.005) (-790.564) (-784.262) -- 0:00:12
793000 -- [-785.161] (-786.534) (-785.527) (-786.173) * (-784.037) (-784.986) (-783.344) [-785.460] -- 0:00:12
793500 -- (-786.202) [-788.251] (-786.742) (-786.120) * (-784.958) [-784.644] (-785.482) (-784.494) -- 0:00:12
794000 -- (-787.785) (-787.207) [-785.229] (-788.326) * [-783.619] (-784.174) (-783.926) (-784.562) -- 0:00:12
794500 -- (-786.860) (-783.647) (-784.380) [-783.649] * (-785.825) [-784.309] (-783.804) (-784.556) -- 0:00:12
795000 -- (-788.812) (-784.358) (-786.045) [-784.403] * [-786.539] (-783.664) (-787.250) (-789.530) -- 0:00:12
Average standard deviation of split frequencies: 0.008012
795500 -- [-786.858] (-783.899) (-785.428) (-785.068) * (-783.504) (-785.157) [-783.861] (-792.399) -- 0:00:12
796000 -- (-785.638) (-783.817) [-785.492] (-787.604) * [-786.499] (-783.141) (-784.473) (-793.076) -- 0:00:12
796500 -- (-785.094) (-785.630) (-786.152) [-787.979] * [-784.096] (-784.267) (-783.595) (-790.703) -- 0:00:12
797000 -- [-783.483] (-785.764) (-785.282) (-784.527) * (-783.459) (-785.095) (-784.511) [-786.832] -- 0:00:12
797500 -- [-784.729] (-785.045) (-783.075) (-788.683) * (-785.366) [-785.610] (-784.008) (-785.571) -- 0:00:12
798000 -- (-786.141) (-785.046) [-785.563] (-789.507) * (-785.592) (-785.902) [-783.799] (-783.907) -- 0:00:12
798500 -- (-785.931) [-784.004] (-783.793) (-788.157) * (-784.452) (-783.840) [-784.285] (-784.346) -- 0:00:12
799000 -- (-785.453) (-785.107) [-786.903] (-783.728) * (-784.217) [-783.971] (-783.175) (-788.070) -- 0:00:12
799500 -- (-787.156) (-784.229) [-785.432] (-784.930) * (-783.856) (-784.151) (-788.090) [-785.023] -- 0:00:12
800000 -- (-790.592) (-785.664) [-783.999] (-785.609) * (-788.377) (-791.045) (-786.334) [-785.619] -- 0:00:12
Average standard deviation of split frequencies: 0.008035
800500 -- (-787.053) [-785.806] (-787.916) (-786.424) * (-787.543) (-783.901) (-788.283) [-783.232] -- 0:00:11
801000 -- [-784.113] (-783.860) (-784.998) (-790.358) * (-784.087) [-784.210] (-785.606) (-783.313) -- 0:00:11
801500 -- (-785.340) (-786.011) (-784.233) [-786.076] * (-788.440) (-785.312) (-785.314) [-783.710] -- 0:00:11
802000 -- (-787.691) (-786.788) [-785.451] (-784.964) * (-786.590) (-784.896) (-788.140) [-787.544] -- 0:00:11
802500 -- (-788.902) (-785.676) [-786.018] (-784.243) * (-786.685) (-783.589) [-785.278] (-788.133) -- 0:00:11
803000 -- (-788.730) (-788.395) (-784.445) [-784.383] * (-785.817) (-783.080) [-784.287] (-783.807) -- 0:00:12
803500 -- (-784.767) [-786.238] (-788.687) (-786.758) * (-785.599) [-783.266] (-787.303) (-784.814) -- 0:00:11
804000 -- (-785.119) (-784.901) (-789.960) [-782.858] * (-791.589) (-785.736) [-790.294] (-785.852) -- 0:00:11
804500 -- (-786.399) (-783.720) (-783.850) [-784.650] * [-786.120] (-785.336) (-784.958) (-787.964) -- 0:00:11
805000 -- (-785.859) (-783.208) [-784.212] (-784.785) * (-791.344) (-784.025) (-785.921) [-788.791] -- 0:00:11
Average standard deviation of split frequencies: 0.007982
805500 -- [-784.535] (-786.093) (-784.719) (-786.756) * (-785.014) (-785.270) (-786.477) [-784.999] -- 0:00:11
806000 -- (-783.259) [-785.190] (-784.989) (-786.665) * [-783.979] (-786.133) (-787.305) (-784.984) -- 0:00:11
806500 -- (-784.512) [-787.394] (-788.159) (-785.713) * (-786.434) (-785.337) [-787.426] (-786.349) -- 0:00:11
807000 -- [-786.424] (-784.073) (-791.656) (-783.652) * [-786.185] (-784.012) (-784.152) (-786.848) -- 0:00:11
807500 -- [-783.938] (-784.220) (-786.392) (-784.737) * (-783.875) [-785.622] (-784.093) (-786.386) -- 0:00:11
808000 -- (-784.503) (-786.017) (-783.404) [-785.023] * (-783.645) (-786.424) [-784.064] (-792.311) -- 0:00:11
808500 -- [-783.954] (-785.272) (-783.415) (-784.804) * [-785.089] (-786.990) (-784.324) (-784.912) -- 0:00:11
809000 -- [-783.906] (-787.489) (-785.688) (-784.427) * (-786.439) (-785.984) (-785.195) [-783.787] -- 0:00:11
809500 -- (-784.002) [-787.165] (-785.331) (-788.068) * (-785.845) (-785.027) (-783.657) [-787.469] -- 0:00:11
810000 -- (-786.693) (-783.941) (-784.445) [-788.502] * [-786.143] (-785.975) (-784.101) (-787.141) -- 0:00:11
Average standard deviation of split frequencies: 0.007799
810500 -- [-785.866] (-785.228) (-790.862) (-786.634) * (-785.207) (-783.296) (-784.064) [-785.928] -- 0:00:11
811000 -- (-784.586) [-783.062] (-786.044) (-783.396) * (-784.017) [-784.025] (-784.553) (-787.980) -- 0:00:11
811500 -- (-784.126) (-784.049) (-784.426) [-783.523] * (-784.633) (-784.486) [-786.065] (-786.138) -- 0:00:11
812000 -- (-788.992) [-786.795] (-787.554) (-783.739) * (-785.827) (-787.955) (-784.442) [-786.478] -- 0:00:11
812500 -- (-788.521) (-783.516) [-783.836] (-785.662) * (-793.489) (-788.453) [-784.232] (-783.720) -- 0:00:11
813000 -- (-784.913) [-785.938] (-783.342) (-785.507) * (-784.997) [-789.314] (-783.893) (-783.721) -- 0:00:11
813500 -- (-784.522) [-787.298] (-784.259) (-785.939) * (-784.548) (-786.899) (-785.707) [-784.197] -- 0:00:11
814000 -- (-785.676) [-783.887] (-785.366) (-786.655) * (-784.659) [-785.471] (-785.746) (-784.254) -- 0:00:11
814500 -- [-787.152] (-785.484) (-785.450) (-786.848) * (-786.657) (-787.599) [-783.556] (-787.723) -- 0:00:11
815000 -- (-784.276) (-785.392) (-784.718) [-784.160] * [-784.662] (-791.162) (-784.211) (-784.489) -- 0:00:11
Average standard deviation of split frequencies: 0.007748
815500 -- (-786.729) [-782.942] (-790.322) (-784.268) * [-783.452] (-785.057) (-784.742) (-785.184) -- 0:00:11
816000 -- (-785.118) (-785.899) (-788.447) [-783.064] * [-785.845] (-783.987) (-785.378) (-785.604) -- 0:00:11
816500 -- (-785.344) (-785.513) (-786.993) [-783.061] * [-784.973] (-784.537) (-787.089) (-785.481) -- 0:00:11
817000 -- (-785.855) (-786.843) [-784.547] (-783.427) * (-784.852) (-783.019) (-787.151) [-784.310] -- 0:00:10
817500 -- [-785.963] (-789.166) (-786.402) (-786.281) * [-785.037] (-787.260) (-786.894) (-784.372) -- 0:00:10
818000 -- (-786.934) (-785.975) [-784.912] (-786.397) * [-785.402] (-784.907) (-786.014) (-785.491) -- 0:00:10
818500 -- (-787.513) [-784.393] (-786.922) (-787.117) * (-785.361) (-784.830) (-785.991) [-783.935] -- 0:00:10
819000 -- (-785.082) (-784.074) [-786.673] (-785.714) * (-785.192) (-786.972) (-787.273) [-783.124] -- 0:00:10
819500 -- (-786.318) [-784.673] (-786.088) (-784.269) * (-784.959) (-788.765) [-783.659] (-787.786) -- 0:00:11
820000 -- (-783.948) [-783.564] (-788.469) (-787.315) * (-785.772) (-785.419) [-789.131] (-786.076) -- 0:00:10
Average standard deviation of split frequencies: 0.007569
820500 -- (-784.967) (-787.979) (-786.845) [-791.130] * (-784.381) [-786.666] (-785.715) (-784.971) -- 0:00:10
821000 -- [-785.443] (-792.146) (-785.678) (-789.061) * (-785.506) [-785.304] (-783.272) (-785.229) -- 0:00:10
821500 -- (-784.685) (-785.515) [-787.113] (-787.370) * (-785.534) (-785.386) (-786.499) [-784.041] -- 0:00:10
822000 -- [-786.083] (-786.085) (-784.352) (-787.792) * (-784.485) [-783.605] (-788.334) (-784.529) -- 0:00:10
822500 -- (-790.930) [-786.188] (-785.161) (-789.019) * (-783.929) (-783.403) (-787.335) [-785.007] -- 0:00:10
823000 -- (-787.041) [-785.241] (-787.398) (-786.082) * (-783.987) (-784.649) (-783.481) [-784.499] -- 0:00:10
823500 -- (-784.769) (-786.842) [-783.825] (-784.344) * (-787.103) [-785.303] (-787.227) (-783.991) -- 0:00:10
824000 -- (-785.493) (-784.381) [-783.590] (-783.980) * (-785.274) [-788.228] (-784.829) (-784.081) -- 0:00:10
824500 -- (-786.683) (-784.936) [-783.592] (-785.641) * (-787.284) (-784.773) (-787.561) [-787.937] -- 0:00:10
825000 -- (-785.797) (-785.170) [-783.912] (-785.633) * (-784.554) (-784.133) [-784.179] (-784.286) -- 0:00:10
Average standard deviation of split frequencies: 0.007386
825500 -- (-784.603) (-784.173) (-787.968) [-785.485] * (-783.716) [-784.896] (-784.663) (-785.032) -- 0:00:10
826000 -- (-785.676) (-783.908) (-791.305) [-786.974] * [-785.199] (-786.235) (-784.390) (-787.741) -- 0:00:10
826500 -- [-784.863] (-783.922) (-786.321) (-785.170) * (-786.251) [-785.726] (-784.452) (-785.052) -- 0:00:10
827000 -- (-787.115) [-785.942] (-784.026) (-785.243) * (-785.630) (-785.317) [-784.301] (-786.982) -- 0:00:10
827500 -- (-785.170) (-785.149) [-784.044] (-784.584) * (-784.799) [-784.145] (-786.773) (-787.522) -- 0:00:10
828000 -- (-785.250) [-784.395] (-784.970) (-784.482) * (-785.492) (-783.851) [-785.649] (-783.432) -- 0:00:10
828500 -- [-787.205] (-786.888) (-783.695) (-793.271) * (-786.475) [-784.650] (-784.268) (-783.684) -- 0:00:10
829000 -- [-784.584] (-785.435) (-783.717) (-788.980) * [-784.982] (-784.639) (-784.799) (-784.480) -- 0:00:10
829500 -- (-785.020) (-786.960) [-783.635] (-787.324) * [-785.247] (-784.495) (-784.417) (-783.724) -- 0:00:10
830000 -- (-785.020) [-785.977] (-785.988) (-784.196) * [-784.610] (-786.237) (-784.909) (-786.698) -- 0:00:10
Average standard deviation of split frequencies: 0.007478
830500 -- (-788.586) (-784.149) (-787.841) [-784.968] * (-788.270) (-789.980) [-786.335] (-786.466) -- 0:00:10
831000 -- (-791.245) (-788.224) (-786.020) [-786.650] * (-783.172) (-789.801) [-785.943] (-785.151) -- 0:00:10
831500 -- (-786.936) (-786.507) [-783.740] (-783.967) * (-784.663) [-787.280] (-787.682) (-785.414) -- 0:00:10
832000 -- [-784.321] (-787.786) (-785.411) (-786.365) * (-784.829) (-789.176) [-786.531] (-784.635) -- 0:00:10
832500 -- (-784.836) (-783.219) (-785.110) [-787.451] * [-784.985] (-783.933) (-785.333) (-785.313) -- 0:00:10
833000 -- (-786.232) [-783.946] (-788.140) (-785.519) * (-786.348) (-788.358) (-787.929) [-784.381] -- 0:00:10
833500 -- (-786.771) [-785.986] (-789.150) (-785.279) * (-786.053) [-786.004] (-784.626) (-785.390) -- 0:00:09
834000 -- (-788.531) [-783.613] (-788.926) (-787.353) * (-784.616) [-785.575] (-786.001) (-785.488) -- 0:00:09
834500 -- (-787.914) (-786.742) [-785.420] (-786.870) * [-783.599] (-784.710) (-787.283) (-783.504) -- 0:00:09
835000 -- (-788.829) [-784.702] (-787.514) (-790.567) * [-783.453] (-787.874) (-785.172) (-784.163) -- 0:00:09
Average standard deviation of split frequencies: 0.007563
835500 -- (-785.618) (-787.603) [-785.951] (-784.525) * (-785.004) (-786.943) (-784.654) [-785.748] -- 0:00:09
836000 -- (-783.835) [-786.837] (-785.967) (-785.696) * (-787.180) (-783.705) (-786.074) [-788.956] -- 0:00:10
836500 -- [-783.436] (-786.390) (-784.651) (-784.378) * (-785.091) (-793.392) (-785.602) [-783.672] -- 0:00:09
837000 -- [-784.475] (-785.680) (-783.575) (-785.328) * (-785.234) (-786.167) (-784.616) [-783.660] -- 0:00:09
837500 -- (-784.796) (-785.365) (-783.228) [-786.604] * (-784.348) (-784.445) (-783.861) [-782.928] -- 0:00:09
838000 -- (-783.352) [-785.603] (-783.659) (-785.868) * [-786.513] (-787.466) (-785.240) (-783.725) -- 0:00:09
838500 -- [-784.878] (-784.231) (-783.454) (-783.957) * [-786.579] (-786.279) (-785.134) (-784.402) -- 0:00:09
839000 -- (-785.640) (-787.242) [-784.279] (-785.830) * (-788.431) [-789.625] (-785.935) (-784.425) -- 0:00:09
839500 -- [-787.203] (-786.895) (-786.081) (-784.500) * (-784.791) [-784.122] (-789.421) (-789.245) -- 0:00:09
840000 -- (-786.774) (-783.622) [-784.910] (-784.838) * (-786.025) (-784.983) (-785.509) [-784.521] -- 0:00:09
Average standard deviation of split frequencies: 0.007356
840500 -- (-787.123) [-783.709] (-787.394) (-783.884) * (-785.141) (-785.013) (-789.691) [-787.942] -- 0:00:09
841000 -- (-783.859) (-784.004) (-784.841) [-788.961] * (-788.726) [-787.148] (-783.226) (-784.819) -- 0:00:09
841500 -- (-783.724) [-783.942] (-790.005) (-785.925) * (-786.262) (-785.854) (-783.437) [-784.408] -- 0:00:09
842000 -- [-785.160] (-783.806) (-787.460) (-783.255) * (-788.297) (-785.515) (-787.308) [-786.161] -- 0:00:09
842500 -- (-784.334) (-783.574) [-785.483] (-788.992) * (-785.349) [-783.576] (-786.355) (-785.634) -- 0:00:09
843000 -- (-785.957) [-783.020] (-785.480) (-784.964) * (-784.864) [-784.309] (-785.963) (-786.677) -- 0:00:09
843500 -- (-786.691) (-783.996) (-785.702) [-783.337] * (-787.305) [-783.741] (-784.213) (-785.268) -- 0:00:09
844000 -- (-786.035) (-783.996) (-787.964) [-788.612] * (-784.979) [-783.601] (-785.837) (-786.515) -- 0:00:09
844500 -- (-786.238) [-784.920] (-786.193) (-792.015) * (-785.517) [-783.741] (-786.681) (-785.460) -- 0:00:09
845000 -- (-783.538) (-784.917) [-786.211] (-787.362) * (-784.305) (-784.430) (-785.465) [-784.678] -- 0:00:09
Average standard deviation of split frequencies: 0.007965
845500 -- (-784.862) [-784.494] (-786.652) (-785.037) * (-784.973) (-783.474) (-785.563) [-787.033] -- 0:00:09
846000 -- (-784.507) (-783.713) [-784.816] (-786.245) * [-789.177] (-784.934) (-783.334) (-786.556) -- 0:00:09
846500 -- (-785.587) (-788.688) [-786.195] (-784.892) * (-790.707) [-783.321] (-784.481) (-789.162) -- 0:00:09
847000 -- (-784.843) (-784.052) (-785.786) [-783.402] * (-785.516) [-783.993] (-785.040) (-784.099) -- 0:00:09
847500 -- (-785.731) [-786.780] (-785.070) (-784.902) * (-784.076) [-784.037] (-785.985) (-784.138) -- 0:00:09
848000 -- [-785.126] (-785.553) (-784.109) (-787.234) * (-786.807) [-783.754] (-784.260) (-784.414) -- 0:00:09
848500 -- (-784.958) (-785.400) [-786.648] (-785.062) * [-786.933] (-786.182) (-785.511) (-785.011) -- 0:00:09
849000 -- (-785.416) (-785.256) [-785.437] (-787.082) * (-785.140) [-787.553] (-785.691) (-784.585) -- 0:00:09
849500 -- [-786.526] (-786.880) (-788.063) (-783.937) * (-783.947) [-786.761] (-785.072) (-784.054) -- 0:00:09
850000 -- [-786.585] (-788.718) (-785.212) (-783.542) * (-785.200) (-784.046) (-788.489) [-784.146] -- 0:00:09
Average standard deviation of split frequencies: 0.007986
850500 -- (-783.868) [-786.374] (-784.580) (-784.855) * (-784.480) [-784.960] (-784.464) (-787.889) -- 0:00:08
851000 -- (-787.117) (-787.668) [-784.528] (-784.719) * (-785.024) (-785.136) [-787.665] (-784.278) -- 0:00:08
851500 -- (-790.157) (-785.222) (-783.946) [-783.569] * (-789.490) (-787.485) [-785.764] (-783.536) -- 0:00:08
852000 -- (-791.463) (-783.535) [-784.168] (-785.416) * [-785.614] (-786.161) (-785.817) (-784.176) -- 0:00:08
852500 -- (-787.357) (-789.765) [-785.058] (-784.903) * (-783.843) [-785.707] (-785.441) (-787.467) -- 0:00:08
853000 -- (-787.986) (-786.387) (-783.733) [-784.131] * (-788.465) (-784.709) (-790.729) [-785.560] -- 0:00:08
853500 -- (-788.047) (-785.184) (-786.849) [-784.929] * (-786.271) (-785.479) (-783.651) [-784.312] -- 0:00:08
854000 -- (-789.468) (-785.111) (-786.884) [-783.991] * (-783.787) [-785.984] (-783.785) (-785.928) -- 0:00:08
854500 -- (-788.984) (-783.588) (-786.149) [-785.185] * (-784.097) (-783.895) [-783.532] (-792.610) -- 0:00:08
855000 -- [-784.716] (-783.710) (-787.979) (-784.661) * (-787.613) (-784.613) [-787.081] (-784.020) -- 0:00:08
Average standard deviation of split frequencies: 0.008001
855500 -- (-788.478) (-783.387) [-785.139] (-787.641) * [-787.950] (-786.263) (-785.907) (-784.357) -- 0:00:08
856000 -- [-783.572] (-785.652) (-785.755) (-786.695) * (-787.386) (-784.558) [-783.591] (-784.029) -- 0:00:08
856500 -- (-787.731) [-788.220] (-784.254) (-785.313) * (-787.856) (-787.956) [-784.930] (-785.889) -- 0:00:08
857000 -- [-785.479] (-786.949) (-786.381) (-785.296) * (-785.277) (-784.644) (-784.801) [-785.188] -- 0:00:08
857500 -- [-784.372] (-784.487) (-785.294) (-783.862) * (-785.985) [-784.121] (-785.925) (-785.310) -- 0:00:08
858000 -- [-784.000] (-784.900) (-784.346) (-786.353) * (-785.340) (-784.197) (-784.804) [-784.113] -- 0:00:08
858500 -- (-785.368) [-788.017] (-784.122) (-786.443) * (-785.934) (-783.633) (-784.942) [-783.915] -- 0:00:08
859000 -- (-785.114) (-786.605) [-786.199] (-789.821) * (-792.307) (-785.231) [-784.647] (-786.099) -- 0:00:08
859500 -- (-784.425) [-793.723] (-785.751) (-783.007) * (-788.976) (-783.341) (-783.894) [-783.001] -- 0:00:08
860000 -- (-783.495) (-788.351) (-784.530) [-783.672] * (-784.248) [-787.025] (-784.597) (-783.894) -- 0:00:08
Average standard deviation of split frequencies: 0.008312
860500 -- (-783.888) (-784.288) (-784.220) [-785.608] * [-784.342] (-786.632) (-784.872) (-784.395) -- 0:00:08
861000 -- [-783.061] (-786.470) (-788.716) (-788.084) * (-786.352) [-785.697] (-784.833) (-783.682) -- 0:00:08
861500 -- (-785.917) (-785.267) (-783.662) [-787.237] * [-784.527] (-783.280) (-784.301) (-785.690) -- 0:00:08
862000 -- (-787.211) (-785.794) [-787.386] (-785.834) * (-784.351) (-786.455) [-784.012] (-786.041) -- 0:00:08
862500 -- [-790.570] (-783.685) (-784.727) (-785.696) * (-784.929) [-784.819] (-784.063) (-783.913) -- 0:00:08
863000 -- (-787.480) (-784.499) (-785.055) [-785.825] * [-787.300] (-787.973) (-784.223) (-785.895) -- 0:00:08
863500 -- [-785.427] (-784.641) (-787.210) (-787.328) * (-785.793) (-784.956) (-784.758) [-787.866] -- 0:00:08
864000 -- (-789.513) [-784.403] (-785.624) (-784.165) * [-788.550] (-784.901) (-784.977) (-783.616) -- 0:00:08
864500 -- (-784.392) [-786.710] (-786.638) (-784.045) * (-785.105) (-787.504) [-784.459] (-786.122) -- 0:00:08
865000 -- (-785.836) (-785.917) (-787.881) [-785.879] * (-783.805) (-788.389) (-784.358) [-785.872] -- 0:00:08
Average standard deviation of split frequencies: 0.008325
865500 -- (-785.764) [-787.120] (-784.095) (-785.752) * (-784.282) (-786.733) [-784.607] (-784.326) -- 0:00:08
866000 -- (-785.877) [-784.632] (-783.314) (-786.701) * (-786.551) [-786.921] (-784.174) (-786.555) -- 0:00:08
866500 -- (-784.189) (-787.769) (-783.725) [-783.271] * (-787.882) (-789.367) (-785.117) [-787.654] -- 0:00:08
867000 -- [-786.065] (-785.772) (-784.478) (-784.268) * (-788.353) (-788.491) (-784.214) [-786.192] -- 0:00:07
867500 -- (-785.426) (-783.865) [-784.004] (-783.560) * (-785.691) (-788.999) (-784.499) [-784.399] -- 0:00:07
868000 -- (-785.882) (-783.780) [-784.524] (-784.324) * [-785.862] (-792.015) (-785.706) (-784.576) -- 0:00:07
868500 -- (-786.533) (-783.745) [-784.502] (-784.163) * (-785.961) (-787.105) (-786.913) [-784.593] -- 0:00:07
869000 -- (-786.555) (-783.887) (-785.428) [-785.590] * (-785.332) [-786.710] (-785.181) (-784.039) -- 0:00:07
869500 -- [-788.880] (-783.881) (-784.407) (-786.338) * (-795.313) (-784.466) (-785.575) [-785.317] -- 0:00:07
870000 -- (-786.859) (-784.913) [-784.368] (-784.048) * [-789.229] (-785.100) (-783.732) (-784.297) -- 0:00:07
Average standard deviation of split frequencies: 0.008535
870500 -- (-783.452) (-784.611) (-785.334) [-784.935] * [-788.369] (-784.279) (-787.946) (-784.428) -- 0:00:07
871000 -- [-784.866] (-789.861) (-788.804) (-784.980) * (-785.254) (-783.281) (-783.785) [-785.235] -- 0:00:07
871500 -- (-784.768) (-785.110) (-788.030) [-783.807] * (-784.745) [-784.350] (-783.092) (-789.201) -- 0:00:07
872000 -- [-783.995] (-786.002) (-786.707) (-782.982) * (-786.250) [-783.219] (-783.786) (-786.781) -- 0:00:07
872500 -- (-791.206) (-783.493) [-784.530] (-785.937) * (-787.267) (-788.141) (-784.813) [-783.715] -- 0:00:07
873000 -- (-790.085) (-785.787) (-785.252) [-783.891] * (-785.777) (-787.830) [-786.583] (-785.387) -- 0:00:07
873500 -- (-783.423) [-783.864] (-787.880) (-784.272) * (-784.715) (-784.767) [-783.428] (-785.665) -- 0:00:07
874000 -- [-783.923] (-784.695) (-786.515) (-790.982) * (-783.563) (-790.390) [-784.466] (-783.540) -- 0:00:07
874500 -- (-784.269) (-787.390) (-787.112) [-784.930] * (-790.578) (-784.143) (-783.610) [-784.163] -- 0:00:07
875000 -- [-784.217] (-784.540) (-783.961) (-783.551) * (-786.905) [-786.614] (-783.589) (-784.024) -- 0:00:07
Average standard deviation of split frequencies: 0.008135
875500 -- [-785.961] (-786.485) (-784.581) (-783.947) * (-788.648) [-785.474] (-783.574) (-784.046) -- 0:00:07
876000 -- (-783.838) (-787.986) (-786.251) [-783.758] * (-786.293) (-790.203) [-783.601] (-783.826) -- 0:00:07
876500 -- (-785.897) (-786.770) [-783.301] (-783.686) * (-785.547) (-784.480) (-785.499) [-783.284] -- 0:00:07
877000 -- [-785.253] (-791.375) (-784.606) (-787.427) * (-785.495) (-786.755) (-786.596) [-784.178] -- 0:00:07
877500 -- (-784.401) (-787.743) (-784.247) [-785.769] * (-786.198) (-783.700) (-783.401) [-785.933] -- 0:00:07
878000 -- (-785.513) (-792.671) [-782.986] (-787.818) * (-785.917) (-784.072) [-785.934] (-783.661) -- 0:00:07
878500 -- (-785.686) (-786.558) (-783.444) [-786.576] * (-785.705) [-783.562] (-785.094) (-785.961) -- 0:00:07
879000 -- (-783.725) (-783.966) [-782.995] (-785.126) * (-785.355) [-783.341] (-786.387) (-785.375) -- 0:00:07
879500 -- (-786.145) (-784.837) (-787.063) [-784.436] * (-785.630) (-783.339) [-785.657] (-783.697) -- 0:00:07
880000 -- [-787.470] (-784.138) (-786.634) (-784.350) * [-784.513] (-784.519) (-784.881) (-791.355) -- 0:00:07
Average standard deviation of split frequencies: 0.008155
880500 -- (-788.343) [-784.372] (-783.726) (-784.288) * (-784.158) (-783.357) [-785.792] (-787.514) -- 0:00:07
881000 -- (-784.556) [-786.064] (-788.859) (-786.954) * [-784.556] (-783.728) (-784.313) (-785.494) -- 0:00:07
881500 -- (-783.444) (-784.787) [-785.589] (-785.330) * (-783.697) (-786.034) [-784.130] (-784.846) -- 0:00:07
882000 -- (-785.408) (-784.042) [-784.240] (-789.149) * (-787.208) (-784.521) (-785.092) [-786.935] -- 0:00:07
882500 -- (-788.041) [-783.566] (-788.510) (-783.829) * (-788.413) (-783.366) (-784.413) [-784.566] -- 0:00:07
883000 -- [-783.952] (-789.433) (-783.465) (-783.759) * (-785.449) (-783.675) [-788.015] (-784.146) -- 0:00:07
883500 -- (-789.924) (-786.985) [-787.952] (-783.901) * (-785.510) [-785.246] (-788.587) (-784.535) -- 0:00:06
884000 -- (-787.719) [-783.586] (-790.534) (-784.493) * (-784.822) (-786.160) (-790.865) [-787.230] -- 0:00:06
884500 -- (-784.273) (-785.478) (-785.011) [-784.411] * (-784.953) (-784.224) (-784.883) [-784.744] -- 0:00:06
885000 -- (-786.533) (-785.952) (-784.044) [-784.935] * (-786.241) [-784.197] (-787.510) (-784.966) -- 0:00:06
Average standard deviation of split frequencies: 0.007981
885500 -- (-786.084) (-787.206) [-784.745] (-785.144) * (-789.371) (-785.377) (-785.793) [-783.269] -- 0:00:06
886000 -- [-788.098] (-784.316) (-784.258) (-789.409) * [-785.212] (-785.774) (-784.397) (-785.460) -- 0:00:06
886500 -- (-783.723) (-785.157) (-784.062) [-785.254] * (-791.591) (-785.888) [-784.983] (-790.069) -- 0:00:06
887000 -- [-784.411] (-783.718) (-785.281) (-785.428) * (-792.660) [-788.241] (-783.166) (-785.988) -- 0:00:06
887500 -- (-788.506) (-784.805) [-786.438] (-788.201) * (-786.343) [-786.169] (-783.064) (-788.195) -- 0:00:06
888000 -- (-783.271) (-783.677) [-786.457] (-785.382) * (-784.777) [-784.775] (-785.107) (-783.928) -- 0:00:06
888500 -- [-783.516] (-785.464) (-785.093) (-783.083) * (-788.183) (-784.374) (-785.128) [-783.721] -- 0:00:06
889000 -- [-783.664] (-786.811) (-784.723) (-786.509) * (-786.014) (-785.843) (-785.006) [-784.066] -- 0:00:06
889500 -- (-786.526) (-784.920) (-784.878) [-784.900] * (-783.924) [-786.093] (-783.910) (-783.918) -- 0:00:06
890000 -- (-784.274) (-785.522) (-783.986) [-783.290] * (-785.643) (-784.978) [-785.382] (-785.880) -- 0:00:06
Average standard deviation of split frequencies: 0.008157
890500 -- (-784.881) (-784.088) [-784.021] (-784.297) * [-783.525] (-786.580) (-784.719) (-789.952) -- 0:00:06
891000 -- [-787.678] (-784.022) (-783.961) (-785.514) * [-783.581] (-787.289) (-786.917) (-790.051) -- 0:00:06
891500 -- (-785.495) (-784.150) [-788.085] (-784.725) * (-784.484) (-790.087) [-784.944] (-784.927) -- 0:00:06
892000 -- (-787.803) [-784.148] (-786.704) (-789.120) * (-788.006) (-784.710) (-785.647) [-784.814] -- 0:00:06
892500 -- (-784.522) (-786.734) [-784.632] (-784.371) * (-786.247) (-784.523) [-783.432] (-786.179) -- 0:00:06
893000 -- [-784.168] (-786.565) (-791.372) (-784.155) * (-784.859) (-783.795) (-786.425) [-785.044] -- 0:00:06
893500 -- [-784.841] (-788.084) (-791.456) (-786.130) * [-785.017] (-785.923) (-784.111) (-783.620) -- 0:00:06
894000 -- (-783.833) [-787.877] (-785.013) (-787.140) * (-790.343) (-784.701) (-785.476) [-787.793] -- 0:00:06
894500 -- [-783.883] (-790.242) (-783.235) (-787.719) * (-784.953) [-786.405] (-785.571) (-791.524) -- 0:00:06
895000 -- (-785.306) (-785.459) [-785.015] (-784.409) * (-786.048) (-786.540) (-784.222) [-787.009] -- 0:00:06
Average standard deviation of split frequencies: 0.008078
895500 -- (-785.280) (-784.763) (-784.673) [-784.515] * (-784.845) (-785.433) (-784.846) [-783.734] -- 0:00:06
896000 -- (-784.804) (-786.483) [-785.625] (-784.318) * (-784.856) (-788.495) (-784.047) [-784.983] -- 0:00:06
896500 -- (-783.474) (-786.745) (-787.651) [-783.243] * [-785.324] (-788.266) (-784.718) (-784.575) -- 0:00:06
897000 -- (-783.778) (-786.079) [-784.415] (-786.325) * (-783.730) (-786.583) (-785.969) [-789.684] -- 0:00:06
897500 -- (-783.683) [-783.057] (-786.614) (-785.066) * (-792.816) (-786.502) (-783.405) [-784.225] -- 0:00:06
898000 -- (-784.209) (-787.286) [-784.281] (-784.907) * (-788.688) (-790.492) [-784.027] (-785.587) -- 0:00:06
898500 -- (-788.543) (-784.615) [-785.490] (-783.938) * (-788.081) [-784.829] (-786.150) (-788.306) -- 0:00:06
899000 -- [-783.590] (-783.660) (-786.425) (-785.805) * (-788.911) (-785.195) [-785.052] (-789.296) -- 0:00:06
899500 -- (-785.908) (-784.447) [-783.152] (-783.993) * (-785.783) (-786.672) [-788.208] (-786.964) -- 0:00:06
900000 -- [-786.106] (-787.605) (-783.562) (-785.699) * (-786.974) [-784.669] (-785.758) (-787.428) -- 0:00:06
Average standard deviation of split frequencies: 0.008036
900500 -- (-785.161) (-784.721) [-786.346] (-783.616) * (-783.625) [-786.568] (-788.110) (-785.853) -- 0:00:05
901000 -- (-786.435) (-785.605) [-784.373] (-784.945) * [-785.964] (-784.416) (-785.417) (-785.269) -- 0:00:05
901500 -- (-785.776) (-784.761) (-785.156) [-790.647] * (-786.127) (-784.777) (-787.319) [-784.062] -- 0:00:05
902000 -- (-784.978) (-784.245) [-784.480] (-786.466) * (-784.620) (-794.666) [-784.722] (-784.935) -- 0:00:05
902500 -- (-785.002) (-786.818) (-789.144) [-785.306] * (-786.913) [-787.713] (-787.086) (-788.829) -- 0:00:05
903000 -- (-786.310) [-783.459] (-785.663) (-787.524) * (-789.019) (-787.805) (-789.904) [-785.663] -- 0:00:05
903500 -- (-783.499) (-783.155) [-784.214] (-785.169) * (-796.108) (-791.426) (-787.729) [-786.918] -- 0:00:05
904000 -- (-783.469) [-783.452] (-784.608) (-786.074) * (-784.447) (-789.372) [-790.083] (-785.718) -- 0:00:05
904500 -- [-785.218] (-786.411) (-785.880) (-784.713) * (-786.012) [-792.260] (-786.733) (-790.165) -- 0:00:05
905000 -- (-783.394) (-784.040) [-783.958] (-785.889) * (-787.420) (-791.096) (-786.784) [-784.404] -- 0:00:05
Average standard deviation of split frequencies: 0.007958
905500 -- [-785.016] (-783.905) (-784.548) (-783.321) * (-784.927) (-783.445) (-784.898) [-784.248] -- 0:00:05
906000 -- [-785.437] (-783.613) (-784.120) (-783.683) * (-787.571) (-788.512) [-783.836] (-784.171) -- 0:00:05
906500 -- [-786.154] (-787.668) (-784.433) (-783.170) * (-784.501) (-789.611) (-784.267) [-783.961] -- 0:00:05
907000 -- (-788.927) (-785.489) (-786.727) [-783.102] * (-784.447) (-784.812) (-784.187) [-783.549] -- 0:00:05
907500 -- [-783.518] (-782.908) (-787.400) (-783.102) * (-784.979) (-784.224) (-784.206) [-784.959] -- 0:00:05
908000 -- [-785.404] (-784.231) (-784.566) (-790.074) * [-783.264] (-784.136) (-784.298) (-784.306) -- 0:00:05
908500 -- [-784.461] (-783.950) (-785.922) (-789.241) * (-783.928) [-784.755] (-784.507) (-784.770) -- 0:00:05
909000 -- (-789.424) [-784.832] (-785.937) (-784.444) * (-785.767) (-784.335) (-784.709) [-785.819] -- 0:00:05
909500 -- (-785.263) (-785.343) [-786.509] (-785.519) * (-786.151) (-785.117) (-786.469) [-787.556] -- 0:00:05
910000 -- (-784.234) (-783.319) (-786.371) [-785.530] * (-783.274) (-788.799) (-785.205) [-785.713] -- 0:00:05
Average standard deviation of split frequencies: 0.007344
910500 -- (-785.146) [-786.337] (-785.832) (-784.879) * (-783.081) (-783.987) (-782.950) [-785.015] -- 0:00:05
911000 -- (-787.216) [-784.441] (-787.770) (-783.813) * (-787.023) [-784.047] (-783.715) (-785.788) -- 0:00:05
911500 -- (-788.919) (-783.732) (-786.748) [-787.126] * (-784.487) (-784.404) (-788.381) [-783.274] -- 0:00:05
912000 -- (-787.014) [-784.766] (-785.606) (-783.637) * (-783.610) (-784.664) (-785.206) [-788.052] -- 0:00:05
912500 -- (-787.519) [-787.097] (-785.571) (-783.606) * (-783.891) (-785.448) [-786.012] (-785.031) -- 0:00:05
913000 -- [-785.127] (-788.615) (-784.263) (-785.728) * [-786.737] (-788.429) (-782.936) (-784.097) -- 0:00:05
913500 -- (-786.462) (-796.294) (-784.781) [-783.578] * (-785.111) [-787.171] (-783.370) (-783.285) -- 0:00:05
914000 -- [-785.294] (-784.802) (-782.949) (-785.612) * [-783.129] (-790.119) (-784.468) (-783.844) -- 0:00:05
914500 -- (-787.214) (-785.580) [-784.461] (-784.376) * (-788.695) (-786.022) (-784.832) [-783.931] -- 0:00:05
915000 -- [-783.790] (-785.323) (-786.327) (-784.254) * (-784.369) (-785.669) (-785.627) [-783.720] -- 0:00:05
Average standard deviation of split frequencies: 0.007366
915500 -- (-785.815) (-784.485) (-788.520) [-785.861] * (-785.464) (-786.536) [-784.446] (-785.814) -- 0:00:05
916000 -- (-783.901) [-784.154] (-784.542) (-785.187) * [-785.091] (-785.358) (-783.376) (-784.219) -- 0:00:05
916500 -- (-785.051) [-785.009] (-785.652) (-783.152) * [-785.329] (-786.694) (-784.316) (-786.134) -- 0:00:05
917000 -- (-783.099) (-785.254) [-784.229] (-785.308) * [-789.270] (-783.828) (-785.495) (-787.452) -- 0:00:04
917500 -- (-783.828) (-787.697) [-784.039] (-791.043) * (-789.030) (-785.424) (-786.851) [-782.990] -- 0:00:04
918000 -- (-787.202) (-786.703) [-784.177] (-785.896) * [-785.954] (-786.679) (-784.638) (-784.624) -- 0:00:04
918500 -- (-784.437) (-783.905) (-786.892) [-783.886] * [-783.210] (-785.529) (-784.077) (-786.913) -- 0:00:04
919000 -- [-785.582] (-786.512) (-785.107) (-785.638) * [-784.838] (-789.880) (-784.305) (-786.288) -- 0:00:04
919500 -- (-783.933) (-788.885) (-786.495) [-784.540] * (-784.424) [-789.369] (-786.329) (-786.397) -- 0:00:04
920000 -- (-784.145) [-784.884] (-792.031) (-784.867) * (-786.112) (-784.637) [-784.136] (-783.821) -- 0:00:04
Average standard deviation of split frequencies: 0.007328
920500 -- (-788.589) (-784.685) [-785.571] (-785.751) * (-784.491) (-784.028) [-784.144] (-783.057) -- 0:00:04
921000 -- [-786.416] (-784.556) (-786.622) (-784.189) * (-783.703) (-784.235) [-784.023] (-785.116) -- 0:00:04
921500 -- (-785.163) (-786.822) [-785.284] (-783.376) * (-783.682) [-784.842] (-786.130) (-785.727) -- 0:00:04
922000 -- [-785.912] (-786.979) (-788.498) (-787.049) * (-786.408) (-787.340) (-786.338) [-784.687] -- 0:00:04
922500 -- (-785.019) [-786.268] (-786.255) (-784.531) * (-784.408) (-789.193) (-785.323) [-784.648] -- 0:00:04
923000 -- (-784.508) (-785.306) (-785.226) [-787.547] * (-784.003) (-785.721) [-786.404] (-786.178) -- 0:00:04
923500 -- [-786.812] (-784.621) (-785.040) (-788.150) * (-783.971) (-784.857) (-785.873) [-785.323] -- 0:00:04
924000 -- [-784.198] (-784.752) (-786.820) (-786.779) * (-783.820) (-784.300) (-786.324) [-783.254] -- 0:00:04
924500 -- (-784.309) (-784.886) (-788.969) [-783.978] * (-787.740) (-786.615) [-785.781] (-784.262) -- 0:00:04
925000 -- (-783.566) (-786.176) [-785.656] (-786.473) * (-783.793) (-783.445) (-785.294) [-784.546] -- 0:00:04
Average standard deviation of split frequencies: 0.007350
925500 -- (-785.968) (-787.946) (-785.673) [-785.356] * (-786.456) (-784.826) [-786.219] (-785.086) -- 0:00:04
926000 -- (-785.530) (-786.392) [-785.537] (-791.279) * (-787.081) (-784.873) [-785.023] (-784.101) -- 0:00:04
926500 -- (-784.023) (-785.094) [-786.487] (-787.942) * (-784.244) (-784.418) (-783.943) [-784.133] -- 0:00:04
927000 -- [-788.576] (-789.852) (-786.575) (-784.846) * [-783.586] (-786.189) (-783.327) (-784.111) -- 0:00:04
927500 -- (-789.440) [-786.773] (-786.682) (-784.165) * (-784.877) (-786.477) [-784.073] (-784.467) -- 0:00:04
928000 -- (-786.574) [-782.958] (-785.678) (-785.756) * (-784.519) (-786.018) (-784.591) [-786.313] -- 0:00:04
928500 -- (-784.577) (-784.893) [-785.782] (-783.377) * (-785.024) (-784.771) [-783.523] (-784.899) -- 0:00:04
929000 -- (-790.282) (-787.475) [-785.188] (-785.384) * (-785.055) (-786.548) [-783.657] (-789.101) -- 0:00:04
929500 -- (-791.582) [-785.477] (-786.746) (-785.609) * [-784.154] (-783.712) (-785.666) (-785.406) -- 0:00:04
930000 -- (-785.891) (-784.893) (-783.792) [-785.999] * (-785.101) (-784.598) (-785.494) [-786.022] -- 0:00:04
Average standard deviation of split frequencies: 0.007661
930500 -- (-784.187) (-786.325) [-784.781] (-784.007) * (-791.237) (-785.346) [-784.167] (-786.024) -- 0:00:04
931000 -- (-787.369) (-785.977) [-784.177] (-783.063) * (-785.088) [-785.288] (-790.805) (-786.438) -- 0:00:04
931500 -- (-787.355) (-784.037) (-785.823) [-783.584] * [-784.462] (-785.855) (-784.003) (-786.062) -- 0:00:04
932000 -- (-784.329) (-783.089) (-784.664) [-783.841] * (-785.666) [-785.653] (-783.674) (-786.344) -- 0:00:04
932500 -- [-784.519] (-787.282) (-788.182) (-783.724) * [-788.438] (-786.976) (-784.107) (-787.512) -- 0:00:04
933000 -- (-785.693) (-787.524) (-785.691) [-784.568] * [-787.710] (-788.611) (-784.716) (-784.900) -- 0:00:04
933500 -- (-785.260) (-787.603) (-785.386) [-784.617] * (-785.852) (-784.377) (-783.464) [-783.455] -- 0:00:03
934000 -- (-784.681) [-786.734] (-786.498) (-786.111) * (-784.388) (-787.197) [-784.841] (-783.401) -- 0:00:03
934500 -- (-786.435) [-789.133] (-784.408) (-784.587) * (-787.080) (-789.069) [-783.960] (-783.562) -- 0:00:03
935000 -- (-785.258) (-786.409) (-786.092) [-785.488] * (-786.074) (-785.532) (-790.173) [-784.614] -- 0:00:03
Average standard deviation of split frequencies: 0.007334
935500 -- (-785.503) (-784.086) (-784.276) [-783.552] * (-783.855) (-783.790) (-784.777) [-786.325] -- 0:00:03
936000 -- [-783.518] (-789.699) (-787.419) (-785.221) * (-787.329) (-785.818) (-785.097) [-788.141] -- 0:00:03
936500 -- (-783.750) [-783.597] (-783.516) (-783.766) * (-785.369) (-787.569) (-783.068) [-783.556] -- 0:00:03
937000 -- (-784.928) [-783.799] (-783.672) (-786.361) * (-784.093) (-786.481) [-786.749] (-783.264) -- 0:00:03
937500 -- (-785.812) [-784.510] (-786.172) (-785.445) * [-785.371] (-791.242) (-786.001) (-784.087) -- 0:00:03
938000 -- (-787.208) (-787.304) [-783.963] (-786.741) * (-784.134) (-791.096) (-783.592) [-784.290] -- 0:00:03
938500 -- (-786.941) [-783.236] (-784.069) (-784.188) * (-787.055) (-785.187) (-784.633) [-784.527] -- 0:00:03
939000 -- (-785.675) (-785.765) (-784.626) [-784.825] * (-785.495) (-789.207) (-783.871) [-785.323] -- 0:00:03
939500 -- (-787.878) (-785.197) [-786.053] (-785.366) * (-784.071) (-785.626) (-784.985) [-785.364] -- 0:00:03
940000 -- [-783.724] (-783.412) (-786.096) (-785.240) * [-785.611] (-783.196) (-785.057) (-784.208) -- 0:00:03
Average standard deviation of split frequencies: 0.007454
940500 -- (-783.284) [-786.506] (-785.091) (-783.841) * (-783.779) (-786.261) (-786.576) [-784.450] -- 0:00:03
941000 -- (-784.237) [-784.032] (-784.280) (-787.577) * (-787.652) (-784.801) (-787.567) [-784.370] -- 0:00:03
941500 -- (-786.946) (-783.947) [-783.839] (-785.784) * (-793.682) (-785.439) (-789.778) [-788.774] -- 0:00:03
942000 -- [-785.361] (-784.521) (-786.223) (-789.238) * (-786.725) (-785.144) [-783.427] (-786.432) -- 0:00:03
942500 -- (-785.604) [-784.243] (-785.727) (-787.359) * (-784.273) (-784.857) [-785.202] (-788.161) -- 0:00:03
943000 -- (-785.548) (-786.933) (-787.315) [-785.055] * [-785.221] (-785.039) (-784.002) (-787.277) -- 0:00:03
943500 -- (-786.845) (-784.799) [-783.918] (-787.139) * (-784.606) (-788.051) [-784.232] (-785.229) -- 0:00:03
944000 -- (-785.568) (-785.293) [-784.250] (-785.302) * (-784.224) (-785.781) (-786.117) [-783.794] -- 0:00:03
944500 -- (-784.435) [-787.305] (-785.880) (-787.331) * [-784.588] (-784.295) (-786.398) (-783.535) -- 0:00:03
945000 -- (-785.088) (-788.164) [-785.353] (-784.956) * (-787.486) (-784.698) (-786.367) [-784.284] -- 0:00:03
Average standard deviation of split frequencies: 0.006914
945500 -- (-785.128) [-784.201] (-787.388) (-787.479) * (-784.605) (-783.225) [-784.587] (-788.579) -- 0:00:03
946000 -- (-784.921) (-786.211) (-786.323) [-785.233] * (-784.246) (-783.505) (-784.574) [-785.554] -- 0:00:03
946500 -- (-785.454) [-787.338] (-784.848) (-786.462) * [-787.396] (-788.046) (-786.607) (-784.048) -- 0:00:03
947000 -- (-784.901) (-792.948) (-785.018) [-786.075] * [-786.975] (-792.985) (-787.922) (-783.382) -- 0:00:03
947500 -- (-787.172) [-785.694] (-784.569) (-783.948) * (-784.765) (-787.989) [-783.964] (-783.375) -- 0:00:03
948000 -- (-787.560) (-791.420) (-787.105) [-783.813] * (-788.387) (-784.861) [-785.746] (-784.313) -- 0:00:03
948500 -- (-791.647) [-786.916] (-783.736) (-785.935) * (-783.026) (-786.413) (-784.663) [-783.626] -- 0:00:03
949000 -- (-787.362) (-784.129) (-786.330) [-787.335] * (-783.579) (-786.815) (-784.766) [-784.792] -- 0:00:03
949500 -- (-783.443) [-783.797] (-784.736) (-792.476) * [-785.090] (-784.726) (-784.549) (-783.915) -- 0:00:03
950000 -- [-784.333] (-786.187) (-784.833) (-783.142) * (-788.374) (-786.838) (-789.806) [-786.063] -- 0:00:03
Average standard deviation of split frequencies: 0.007128
950500 -- [-783.639] (-790.612) (-783.931) (-784.641) * (-785.501) (-783.971) [-785.784] (-784.279) -- 0:00:02
951000 -- [-785.835] (-785.668) (-785.611) (-784.504) * (-785.242) (-784.131) (-784.901) [-783.566] -- 0:00:02
951500 -- (-786.439) [-785.902] (-785.421) (-785.205) * (-788.960) [-784.899] (-784.467) (-785.908) -- 0:00:02
952000 -- (-788.628) [-785.689] (-786.047) (-786.991) * (-790.162) [-784.727] (-785.231) (-787.095) -- 0:00:02
952500 -- (-783.712) (-784.563) (-783.751) [-786.614] * [-786.956] (-785.368) (-786.379) (-786.238) -- 0:00:02
953000 -- [-786.498] (-786.246) (-787.754) (-785.965) * (-786.218) [-783.388] (-784.651) (-786.606) -- 0:00:02
953500 -- (-785.052) [-786.508] (-784.945) (-787.279) * (-789.063) (-785.483) (-783.983) [-783.451] -- 0:00:02
954000 -- (-786.376) [-783.674] (-785.976) (-784.712) * (-785.587) [-784.711] (-784.628) (-783.775) -- 0:00:02
954500 -- (-787.390) (-783.755) (-786.384) [-785.313] * (-784.953) [-783.998] (-788.146) (-787.049) -- 0:00:02
955000 -- (-786.219) [-787.293] (-786.435) (-784.119) * (-784.766) [-785.050] (-785.068) (-783.660) -- 0:00:02
Average standard deviation of split frequencies: 0.006903
955500 -- (-783.547) [-784.677] (-785.801) (-783.493) * [-787.115] (-782.947) (-784.765) (-785.241) -- 0:00:02
956000 -- (-785.922) (-784.739) [-788.918] (-785.324) * [-784.278] (-783.215) (-783.914) (-784.632) -- 0:00:02
956500 -- (-785.415) [-785.123] (-786.087) (-784.815) * (-792.826) [-783.954] (-785.295) (-784.552) -- 0:00:02
957000 -- (-785.121) (-787.020) [-784.664] (-787.352) * [-784.321] (-785.381) (-783.345) (-785.797) -- 0:00:02
957500 -- (-784.647) [-789.560] (-786.508) (-783.784) * (-785.653) (-785.756) [-788.049] (-787.257) -- 0:00:02
958000 -- (-783.588) (-784.726) [-784.896] (-784.697) * [-786.212] (-787.772) (-784.423) (-791.840) -- 0:00:02
958500 -- [-782.869] (-785.488) (-784.104) (-784.234) * (-783.788) (-787.629) [-784.213] (-792.045) -- 0:00:02
959000 -- (-786.885) (-785.590) (-784.944) [-784.570] * (-784.304) [-784.812] (-783.622) (-787.568) -- 0:00:02
959500 -- (-783.089) (-783.210) [-784.198] (-784.570) * (-786.507) [-782.931] (-784.759) (-784.650) -- 0:00:02
960000 -- (-783.223) [-785.098] (-785.024) (-783.746) * [-783.799] (-783.203) (-783.460) (-783.771) -- 0:00:02
Average standard deviation of split frequencies: 0.006901
960500 -- (-791.300) (-791.462) [-782.773] (-785.891) * (-784.829) [-783.144] (-784.834) (-785.049) -- 0:00:02
961000 -- (-785.973) (-787.684) [-786.188] (-787.796) * (-784.313) [-784.356] (-784.994) (-784.593) -- 0:00:02
961500 -- (-784.002) [-786.983] (-788.257) (-783.539) * (-784.028) [-783.463] (-786.938) (-784.135) -- 0:00:02
962000 -- [-784.041] (-787.871) (-786.146) (-783.835) * (-788.801) (-786.280) [-784.299] (-784.458) -- 0:00:02
962500 -- [-785.822] (-788.136) (-787.622) (-785.285) * [-785.157] (-785.596) (-783.358) (-784.195) -- 0:00:02
963000 -- [-786.406] (-786.452) (-784.925) (-785.903) * (-788.132) (-784.836) (-784.536) [-784.040] -- 0:00:02
963500 -- [-786.919] (-786.802) (-789.246) (-784.471) * (-786.047) (-786.785) (-789.882) [-788.574] -- 0:00:02
964000 -- (-788.673) (-787.257) (-788.779) [-785.834] * (-787.442) (-784.972) [-788.251] (-783.760) -- 0:00:02
964500 -- [-786.595] (-786.188) (-788.065) (-785.847) * (-789.963) (-787.037) [-783.299] (-788.037) -- 0:00:02
965000 -- (-785.889) [-790.490] (-787.006) (-785.248) * (-787.754) (-785.956) [-785.170] (-795.360) -- 0:00:02
Average standard deviation of split frequencies: 0.007167
965500 -- (-789.338) [-785.284] (-787.790) (-784.528) * (-787.803) (-786.763) (-786.338) [-785.879] -- 0:00:02
966000 -- (-787.096) [-784.689] (-785.389) (-786.749) * [-785.668] (-785.347) (-787.807) (-786.307) -- 0:00:02
966500 -- (-793.336) [-785.367] (-783.337) (-785.771) * [-785.035] (-788.415) (-787.651) (-786.718) -- 0:00:02
967000 -- (-788.160) [-783.764] (-785.962) (-785.987) * (-786.231) [-788.049] (-784.357) (-786.758) -- 0:00:01
967500 -- [-785.770] (-785.932) (-784.899) (-785.448) * (-787.504) [-784.572] (-785.151) (-789.000) -- 0:00:01
968000 -- (-785.259) (-783.885) [-784.703] (-785.539) * (-787.210) (-785.194) [-785.301] (-785.055) -- 0:00:01
968500 -- (-783.470) [-785.963] (-785.377) (-785.439) * [-787.480] (-783.584) (-784.325) (-784.863) -- 0:00:01
969000 -- [-786.141] (-785.030) (-784.093) (-786.019) * (-794.860) (-790.100) (-785.874) [-784.372] -- 0:00:01
969500 -- (-783.677) (-788.969) [-784.664] (-784.752) * (-784.395) (-788.720) [-786.633] (-786.112) -- 0:00:01
970000 -- (-785.344) (-786.277) [-787.822] (-785.446) * [-788.459] (-786.199) (-791.579) (-787.956) -- 0:00:01
Average standard deviation of split frequencies: 0.007103
970500 -- (-786.025) [-783.808] (-783.230) (-783.741) * (-789.331) (-785.130) [-784.128] (-784.397) -- 0:00:01
971000 -- (-786.739) [-783.949] (-787.846) (-785.936) * (-788.779) (-785.186) (-786.389) [-785.893] -- 0:00:01
971500 -- (-784.676) [-783.116] (-784.188) (-784.471) * (-785.637) [-784.489] (-784.084) (-784.156) -- 0:00:01
972000 -- (-784.823) (-784.666) [-786.859] (-787.988) * (-783.843) (-789.304) (-783.149) [-784.047] -- 0:00:01
972500 -- (-785.448) (-785.174) [-785.289] (-791.005) * (-783.924) (-785.753) [-785.235] (-786.769) -- 0:00:01
973000 -- [-787.278] (-784.357) (-785.130) (-785.082) * (-786.955) (-785.666) (-786.224) [-786.970] -- 0:00:01
973500 -- (-785.902) (-784.727) (-790.561) [-786.645] * [-786.078] (-787.249) (-786.830) (-787.877) -- 0:00:01
974000 -- (-786.556) (-784.227) [-789.162] (-785.155) * [-783.871] (-785.956) (-787.906) (-787.477) -- 0:00:01
974500 -- (-783.747) (-788.123) (-786.341) [-784.482] * (-785.543) (-786.790) [-785.884] (-784.882) -- 0:00:01
975000 -- (-790.151) (-784.551) [-786.031] (-783.636) * (-787.239) (-784.253) [-783.600] (-785.152) -- 0:00:01
Average standard deviation of split frequencies: 0.007245
975500 -- (-786.805) [-785.149] (-783.977) (-787.101) * [-784.030] (-784.405) (-784.588) (-789.438) -- 0:00:01
976000 -- (-784.683) (-784.971) [-783.951] (-784.901) * (-783.701) (-784.299) [-784.017] (-783.334) -- 0:00:01
976500 -- (-783.961) (-786.953) (-784.314) [-784.774] * (-784.653) (-785.114) [-784.638] (-785.334) -- 0:00:01
977000 -- [-783.354] (-783.657) (-783.676) (-784.639) * (-783.213) (-783.555) [-785.907] (-787.240) -- 0:00:01
977500 -- (-784.137) (-784.262) (-787.167) [-784.600] * [-786.352] (-785.066) (-785.244) (-784.552) -- 0:00:01
978000 -- (-784.189) (-785.972) (-784.294) [-787.524] * (-783.848) (-787.369) [-784.230] (-786.677) -- 0:00:01
978500 -- (-786.203) [-784.145] (-784.151) (-783.879) * [-783.805] (-785.871) (-787.774) (-783.086) -- 0:00:01
979000 -- (-790.630) (-785.969) [-783.615] (-785.351) * (-784.741) (-784.763) (-783.930) [-783.355] -- 0:00:01
979500 -- (-785.126) (-783.663) (-786.358) [-784.051] * (-784.021) (-783.624) [-785.883] (-786.369) -- 0:00:01
980000 -- (-790.820) [-783.545] (-788.228) (-784.059) * (-783.961) (-785.911) (-787.399) [-784.824] -- 0:00:01
Average standard deviation of split frequencies: 0.007661
980500 -- (-786.032) [-784.073] (-785.921) (-783.916) * (-783.761) (-787.650) (-789.001) [-785.438] -- 0:00:01
981000 -- (-785.744) (-786.588) [-784.629] (-784.859) * [-786.268] (-783.042) (-785.627) (-784.599) -- 0:00:01
981500 -- (-785.012) (-787.683) (-785.780) [-785.927] * [-788.881] (-782.839) (-784.478) (-789.140) -- 0:00:01
982000 -- (-785.599) (-787.294) (-784.264) [-784.029] * [-785.398] (-783.279) (-784.651) (-789.463) -- 0:00:01
982500 -- (-784.610) (-786.923) [-784.735] (-785.903) * [-785.311] (-785.889) (-784.045) (-787.022) -- 0:00:01
983000 -- [-784.647] (-785.744) (-784.450) (-783.684) * [-785.377] (-783.725) (-787.048) (-785.565) -- 0:00:01
983500 -- [-784.389] (-787.149) (-785.488) (-786.510) * (-786.246) (-785.407) (-783.509) [-787.916] -- 0:00:00
984000 -- (-785.430) (-784.333) [-784.415] (-784.465) * [-787.744] (-787.504) (-783.136) (-785.017) -- 0:00:00
984500 -- [-783.744] (-785.834) (-784.026) (-784.048) * (-787.676) (-789.014) [-785.888] (-787.427) -- 0:00:00
985000 -- (-784.063) (-790.094) (-787.725) [-785.490] * (-785.849) [-788.668] (-783.700) (-790.530) -- 0:00:00
Average standard deviation of split frequencies: 0.007440
985500 -- (-791.253) (-786.745) [-786.346] (-788.149) * [-784.991] (-789.835) (-785.235) (-784.071) -- 0:00:00
986000 -- [-786.032] (-783.777) (-783.421) (-786.925) * (-784.851) (-787.679) [-783.479] (-783.590) -- 0:00:00
986500 -- (-785.203) [-783.135] (-783.736) (-787.444) * (-785.526) (-787.345) [-784.328] (-784.301) -- 0:00:00
987000 -- [-783.700] (-784.373) (-784.892) (-785.165) * (-784.823) [-783.958] (-788.954) (-784.611) -- 0:00:00
987500 -- [-783.821] (-789.522) (-787.592) (-784.372) * (-784.587) (-786.013) [-784.365] (-787.511) -- 0:00:00
988000 -- (-785.562) [-783.914] (-787.350) (-786.289) * (-784.853) [-783.937] (-785.963) (-784.210) -- 0:00:00
988500 -- [-787.676] (-783.915) (-785.457) (-785.856) * (-784.323) [-785.505] (-784.344) (-784.220) -- 0:00:00
989000 -- (-785.233) (-783.150) [-783.319] (-784.679) * [-783.211] (-785.947) (-793.114) (-783.601) -- 0:00:00
989500 -- (-784.470) (-783.457) [-787.513] (-784.349) * (-783.380) (-786.243) (-788.225) [-784.232] -- 0:00:00
990000 -- (-790.206) (-785.098) (-784.882) [-783.254] * (-786.522) (-783.916) (-784.466) [-784.230] -- 0:00:00
Average standard deviation of split frequencies: 0.007227
990500 -- (-784.514) (-792.184) (-785.386) [-783.337] * (-786.339) (-784.636) [-784.385] (-788.254) -- 0:00:00
991000 -- (-786.993) [-788.631] (-783.510) (-786.516) * (-784.433) [-784.478] (-784.396) (-785.906) -- 0:00:00
991500 -- (-785.753) (-788.606) [-786.755] (-791.763) * [-785.617] (-787.230) (-786.561) (-785.414) -- 0:00:00
992000 -- [-785.524] (-784.410) (-789.446) (-785.358) * [-788.075] (-787.124) (-783.457) (-784.435) -- 0:00:00
992500 -- (-784.381) [-785.310] (-785.363) (-783.056) * [-788.081] (-783.495) (-785.346) (-786.329) -- 0:00:00
993000 -- (-785.631) [-783.997] (-785.674) (-784.889) * (-787.418) (-783.318) [-785.130] (-785.447) -- 0:00:00
993500 -- (-784.651) (-786.904) (-785.466) [-783.333] * [-786.153] (-783.000) (-783.422) (-783.244) -- 0:00:00
994000 -- (-783.845) [-788.315] (-786.355) (-784.285) * (-785.916) [-784.994] (-791.753) (-783.345) -- 0:00:00
994500 -- [-785.785] (-788.473) (-785.279) (-784.156) * (-784.729) (-783.837) [-784.124] (-783.885) -- 0:00:00
995000 -- (-784.447) (-784.617) [-785.444] (-783.755) * (-783.394) (-786.417) [-785.085] (-786.227) -- 0:00:00
Average standard deviation of split frequencies: 0.006892
995500 -- (-787.498) (-783.740) [-784.291] (-784.085) * (-784.723) [-788.560] (-785.195) (-786.968) -- 0:00:00
996000 -- (-787.616) (-784.389) [-783.378] (-784.446) * [-783.028] (-787.705) (-784.591) (-786.731) -- 0:00:00
996500 -- (-786.203) [-784.436] (-786.418) (-784.227) * (-788.603) (-783.797) (-785.865) [-786.722] -- 0:00:00
997000 -- (-785.470) (-786.046) (-787.071) [-785.298] * (-787.026) (-784.413) (-788.279) [-784.546] -- 0:00:00
997500 -- (-789.393) (-786.414) (-785.633) [-785.581] * [-784.438] (-784.140) (-785.043) (-786.250) -- 0:00:00
998000 -- (-785.591) [-787.407] (-785.325) (-784.866) * [-784.613] (-784.634) (-783.158) (-786.828) -- 0:00:00
998500 -- (-788.305) (-786.138) [-783.658] (-789.339) * (-786.352) (-790.604) (-783.709) [-783.550] -- 0:00:00
999000 -- (-783.579) (-786.925) (-783.724) [-784.117] * (-784.900) (-789.459) [-783.332] (-784.447) -- 0:00:00
999500 -- [-784.940] (-786.187) (-787.168) (-787.175) * (-786.116) [-787.184] (-789.083) (-786.301) -- 0:00:00
1000000 -- [-783.271] (-791.453) (-784.771) (-785.930) * [-783.161] (-784.920) (-788.747) (-788.541) -- 0:00:00
Average standard deviation of split frequencies: 0.006978
Analysis completed in 60 seconds
Analysis used 59.32 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -782.77
Likelihood of best state for "cold" chain of run 2 was -782.77
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 62 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.6 % ( 25 %) Dirichlet(Pi{all})
31.5 % ( 33 %) Slider(Pi{all})
78.4 % ( 50 %) Multiplier(Alpha{1,2})
78.2 % ( 56 %) Multiplier(Alpha{3})
22.2 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.6 % ( 95 %) Nodeslider(V{all})
30.8 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 65 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
29.0 % ( 20 %) Dirichlet(Pi{all})
31.1 % ( 28 %) Slider(Pi{all})
78.7 % ( 48 %) Multiplier(Alpha{1,2})
78.1 % ( 50 %) Multiplier(Alpha{3})
23.2 % ( 20 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167045 0.82 0.67
3 | 166481 166796 0.84
4 | 166749 166156 166773
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166764 0.82 0.67
3 | 166339 166687 0.84
4 | 166720 167065 166425
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -784.41
| 2 |
| 1 2 2 1 |
| 1 22 2 2 1 2 |
| 2 21 2 2 1 2 211 1 1 |
| 1 2 1 1 * 1 * 21 21 2 2 1 * 2|
| 11 1 211 11 1 2 1 211* 212 1** 1|
|2 2 2 2 2 1 2 2 22 *1 2 2 |
|1 22 2 1 1 * 1 2 |
| 2 1 2 1 * 2 1 |
| 1 1 2 2 2 2 2 |
| 2*1 1 1 1 |
| 21 1 |
| 1 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -786.44
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -784.48 -788.26
2 -784.43 -787.55
--------------------------------------
TOTAL -784.45 -787.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882701 0.085419 0.389841 1.498074 0.852894 1212.52 1334.63 1.000
r(A<->C){all} 0.163890 0.019780 0.000066 0.448616 0.126935 151.31 200.37 1.001
r(A<->G){all} 0.163136 0.019291 0.000004 0.451903 0.127031 156.00 190.12 1.001
r(A<->T){all} 0.161379 0.020005 0.000147 0.453598 0.118573 274.75 350.17 1.000
r(C<->G){all} 0.183532 0.023097 0.000033 0.493335 0.142446 178.96 248.52 1.006
r(C<->T){all} 0.161698 0.019229 0.000088 0.444596 0.123327 233.85 253.72 1.008
r(G<->T){all} 0.166363 0.019835 0.000095 0.457652 0.127505 128.35 187.70 1.000
pi(A){all} 0.208960 0.000275 0.177561 0.241584 0.208530 1096.34 1160.88 1.000
pi(C){all} 0.301844 0.000356 0.264974 0.336182 0.301334 1271.91 1312.26 1.000
pi(G){all} 0.276737 0.000336 0.239769 0.312287 0.276740 1170.39 1272.47 1.000
pi(T){all} 0.212459 0.000283 0.179536 0.246499 0.211836 1259.91 1331.46 1.000
alpha{1,2} 0.446697 0.243204 0.000308 1.422536 0.290670 1054.92 1156.25 1.000
alpha{3} 0.458963 0.236490 0.000219 1.456701 0.297959 1202.34 1236.46 1.000
pinvar{all} 0.997292 0.000011 0.991227 0.999998 0.998336 1284.52 1322.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- ..****
9 -- ....**
10 -- ..*..*
11 -- .*...*
12 -- ...**.
13 -- .***.*
14 -- ..**..
15 -- ..*.*.
16 -- .*.***
17 -- .*..*.
18 -- .**.**
19 -- .*.*..
20 -- .**...
21 -- ...*.*
22 -- ..*.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 463 0.154231 0.004240 0.151233 0.157229 2
8 448 0.149234 0.003769 0.146569 0.151899 2
9 444 0.147901 0.013191 0.138574 0.157229 2
10 440 0.146569 0.004711 0.143238 0.149900 2
11 440 0.146569 0.006595 0.141905 0.151233 2
12 436 0.145237 0.001884 0.143904 0.146569 2
13 436 0.145237 0.010364 0.137908 0.152565 2
14 433 0.144237 0.006124 0.139907 0.148568 2
15 430 0.143238 0.000000 0.143238 0.143238 2
16 424 0.141239 0.000000 0.141239 0.141239 2
17 424 0.141239 0.013191 0.131912 0.150566 2
18 421 0.140240 0.005182 0.136576 0.143904 2
19 403 0.134244 0.004240 0.131246 0.137242 2
20 401 0.133578 0.008951 0.127249 0.139907 2
21 389 0.129580 0.011777 0.121252 0.137908 2
22 279 0.092938 0.017430 0.080613 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.095850 0.008732 0.000037 0.280988 0.067718 1.000 2
length{all}[2] 0.096797 0.009384 0.000009 0.298712 0.067318 1.000 2
length{all}[3] 0.099269 0.010034 0.000034 0.304468 0.068181 1.001 2
length{all}[4] 0.099957 0.009569 0.000010 0.292895 0.070251 1.001 2
length{all}[5] 0.094254 0.009045 0.000041 0.284697 0.064451 1.000 2
length{all}[6] 0.096722 0.008991 0.000013 0.282749 0.068558 1.000 2
length{all}[7] 0.095929 0.009978 0.000313 0.286490 0.065530 0.998 2
length{all}[8] 0.100245 0.009239 0.000488 0.290957 0.069057 0.998 2
length{all}[9] 0.103897 0.009278 0.001031 0.304675 0.071311 1.008 2
length{all}[10] 0.094775 0.008665 0.000401 0.315678 0.065263 0.999 2
length{all}[11] 0.088957 0.007748 0.000147 0.255521 0.064326 1.000 2
length{all}[12] 0.098574 0.011370 0.000015 0.300923 0.063012 0.998 2
length{all}[13] 0.098326 0.010769 0.000000 0.315845 0.066018 1.000 2
length{all}[14] 0.097392 0.008854 0.000143 0.289601 0.065613 0.998 2
length{all}[15] 0.094485 0.008948 0.000235 0.292705 0.065522 0.999 2
length{all}[16] 0.095177 0.009676 0.000097 0.309253 0.064595 0.998 2
length{all}[17] 0.101294 0.009928 0.000060 0.298570 0.071832 0.999 2
length{all}[18] 0.101521 0.011260 0.000195 0.298725 0.072086 0.998 2
length{all}[19] 0.100643 0.010641 0.000093 0.306774 0.063230 0.998 2
length{all}[20] 0.110682 0.011549 0.000286 0.333469 0.075921 0.998 2
length{all}[21] 0.101617 0.010001 0.000279 0.318511 0.068599 0.999 2
length{all}[22] 0.098807 0.010789 0.000445 0.317172 0.066161 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006978
Maximum standard deviation of split frequencies = 0.017430
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 570
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 190 / 190 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 190 / 190 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031565 0.057893 0.104562 0.083004 0.038496 0.085354 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -840.462265
Iterating by ming2
Initial: fx= 840.462265
x= 0.03156 0.05789 0.10456 0.08300 0.03850 0.08535 0.30000 1.30000
1 h-m-p 0.0000 0.0002 457.0604 +++ 805.237974 m 0.0002 14 | 1/8
2 h-m-p 0.0022 0.0161 31.3927 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 418.8612 ++ 798.746755 m 0.0000 46 | 2/8
4 h-m-p 0.0006 0.0321 24.3299 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 374.5234 ++ 784.163891 m 0.0001 77 | 3/8
6 h-m-p 0.0017 0.0522 19.5460 ------------.. | 3/8
7 h-m-p 0.0000 0.0001 324.9196 ++ 769.890375 m 0.0001 109 | 4/8
8 h-m-p 0.0024 0.1045 14.9954 ------------.. | 4/8
9 h-m-p 0.0000 0.0000 266.1905 ++ 768.995180 m 0.0000 141 | 5/8
10 h-m-p 0.0003 0.1517 10.6209 ----------.. | 5/8
11 h-m-p 0.0000 0.0001 188.0065 ++ 765.328814 m 0.0001 171 | 6/8
12 h-m-p 0.6343 8.0000 0.0000 ++ 765.328814 m 8.0000 182 | 6/8
13 h-m-p 0.3814 8.0000 0.0000 ---Y 765.328814 0 0.0015 198 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 +++++ 765.328814 m 8.0000 214 | 6/8
15 h-m-p 0.0021 1.0369 0.3002 ------Y 765.328814 0 0.0000 233 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
17 h-m-p 0.0160 8.0000 0.0000 +++++ 765.328814 m 8.0000 273 | 6/8
18 h-m-p 0.0003 0.1437 4.6880 ----------.. | 6/8
19 h-m-p 0.0160 8.0000 0.0000 +++++ 765.328814 m 8.0000 308 | 6/8
20 h-m-p 0.0329 8.0000 0.0044 --------------.. | 6/8
21 h-m-p 0.0160 8.0000 0.0000 +++++ 765.328814 m 8.0000 349 | 6/8
22 h-m-p 0.0011 0.5720 2.5368 ++++C 765.328803 0 0.2991 366 | 6/8
23 h-m-p 0.3122 1.5610 0.4434 C 765.328803 0 0.3763 377 | 6/8
24 h-m-p 1.5379 7.6894 0.0683 Y 765.328803 0 0.7030 390 | 6/8
25 h-m-p 1.6000 8.0000 0.0018 ++ 765.328803 m 8.0000 403 | 6/8
26 h-m-p 0.7880 8.0000 0.0184 +C 765.328802 0 3.9754 417 | 6/8
27 h-m-p 1.6000 8.0000 0.0143 ++ 765.328801 m 8.0000 430 | 6/8
28 h-m-p 0.3141 8.0000 0.3653 ----------Y 765.328801 0 0.0000 453 | 6/8
29 h-m-p 0.0040 1.9766 0.2840 +++++ 765.328682 m 1.9766 469 | 7/8
30 h-m-p 0.7407 8.0000 0.6896 --------------Y 765.328682 0 0.0000 496 | 7/8
31 h-m-p 0.0160 8.0000 0.0000 ------C 765.328682 0 0.0000 514 | 7/8
32 h-m-p 0.0160 8.0000 0.0000 ---Y 765.328682 0 0.0001 529
Out..
lnL = -765.328682
530 lfun, 530 eigenQcodon, 3180 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.041078 0.052862 0.031286 0.079625 0.014802 0.091114 0.271420 0.614325 0.522446
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.636224
np = 9
lnL0 = -822.839120
Iterating by ming2
Initial: fx= 822.839120
x= 0.04108 0.05286 0.03129 0.07962 0.01480 0.09111 0.27142 0.61433 0.52245
1 h-m-p 0.0000 0.0001 447.6517 ++ 806.651060 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0004 233.9453 ++ 791.275603 m 0.0004 26 | 2/9
3 h-m-p 0.0000 0.0001 598.5547 ++ 784.529403 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0002 430.6494 ++ 777.526398 m 0.0002 50 | 4/9
5 h-m-p 0.0000 0.0000 4119.0853 ++ 767.415675 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 2537.1385 ++ 765.328782 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 765.328782 m 8.0000 86 | 6/9
8 h-m-p 0.0160 8.0000 0.0620 -----------C 765.328782 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0011 +++++ 765.328781 m 8.0000 130 | 6/9
10 h-m-p 0.0332 4.5216 0.2667 ------------Y 765.328781 0 0.0000 157 | 6/9
11 h-m-p 0.0160 8.0000 0.0001 +++++ 765.328781 m 8.0000 175 | 6/9
12 h-m-p 0.0026 1.3158 0.9629 --------C 765.328781 0 0.0000 198 | 6/9
13 h-m-p 0.0160 8.0000 0.0011 +++++ 765.328781 m 8.0000 216 | 6/9
14 h-m-p 0.0084 1.2281 1.0433 -----------Y 765.328781 0 0.0000 242 | 6/9
15 h-m-p 0.0160 8.0000 0.0000 +++++ 765.328781 m 8.0000 257 | 6/9
16 h-m-p 0.0000 0.0005 651.4197 +++ 765.328726 m 0.0005 273 | 7/9
17 h-m-p 0.8100 8.0000 0.0740 ------------C 765.328726 0 0.0000 297 | 7/9
18 h-m-p 0.0160 8.0000 0.0000 ---C 765.328726 0 0.0001 314
Out..
lnL = -765.328726
315 lfun, 945 eigenQcodon, 3780 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.096289 0.100268 0.108252 0.066932 0.075605 0.090309 0.219483 1.473758 0.491619 0.300012 2.200240
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.577053
np = 11
lnL0 = -854.736431
Iterating by ming2
Initial: fx= 854.736431
x= 0.09629 0.10027 0.10825 0.06693 0.07561 0.09031 0.21948 1.47376 0.49162 0.30001 2.20024
1 h-m-p 0.0000 0.0004 366.6298 +++ 790.291644 m 0.0004 17 | 1/11
2 h-m-p 0.0001 0.0003 200.5687 ++ 782.307644 m 0.0003 31 | 2/11
3 h-m-p 0.0001 0.0004 396.0854 ++ 770.539763 m 0.0004 45 | 3/11
4 h-m-p 0.0000 0.0000 4314.4191 ++ 767.558977 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 1644.8728 ++ 767.494167 m 0.0000 73 | 5/11
6 h-m-p 0.0005 0.2556 4.9418 -----------.. | 5/11
7 h-m-p 0.0000 0.0000 261.0450 ++ 766.442229 m 0.0000 110 | 6/11
8 h-m-p 0.0010 0.0971 2.7330 -----------.. | 6/11
9 h-m-p 0.0000 0.0000 185.7260 ++ 765.328785 m 0.0000 147 | 7/11
10 h-m-p 0.0541 8.0000 0.0000 ++++ 765.328785 m 8.0000 163 | 7/11
11 h-m-p 0.0160 8.0000 0.0094 +++++ 765.328784 m 8.0000 184 | 7/11
12 h-m-p 0.0160 8.0000 15.2352 ----------Y 765.328784 0 0.0000 212 | 7/11
13 h-m-p 0.0160 8.0000 0.0000 --C 765.328784 0 0.0003 228 | 7/11
14 h-m-p 0.0160 8.0000 0.0000 --Y 765.328784 0 0.0003 248
Out..
lnL = -765.328784
249 lfun, 996 eigenQcodon, 4482 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -765.339569 S = -765.325992 -0.005198
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:03
did 20 / 58 patterns 0:03
did 30 / 58 patterns 0:03
did 40 / 58 patterns 0:03
did 50 / 58 patterns 0:03
did 58 / 58 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048162 0.021106 0.020611 0.035022 0.048814 0.071297 0.169607 0.466751 1.208799
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.901119
np = 9
lnL0 = -809.106795
Iterating by ming2
Initial: fx= 809.106795
x= 0.04816 0.02111 0.02061 0.03502 0.04881 0.07130 0.16961 0.46675 1.20880
1 h-m-p 0.0000 0.0001 421.6161 ++ 787.542016 m 0.0001 14 | 1/9
2 h-m-p 0.0001 0.0003 47.7876 ++ 787.088237 m 0.0003 26 | 2/9
3 h-m-p 0.0000 0.0001 755.6951 ++ 783.059961 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0001 3511.7149 ++ 779.962761 m 0.0001 50 | 4/9
5 h-m-p 0.0000 0.0001 624.8562 ++ 777.111529 m 0.0001 62 | 5/9
6 h-m-p 0.0001 0.0003 612.1081 ++ 775.527977 m 0.0003 74 | 6/9
7 h-m-p 0.0075 0.1339 2.0970 -------------.. | 6/9
8 h-m-p 0.0000 0.0000 246.7701 ++ 774.850255 m 0.0000 109 | 7/9
9 h-m-p 0.0160 8.0000 1.0032 -------------.. | 7/9
10 h-m-p 0.0000 0.0003 170.1376 +++ 765.328593 m 0.0003 145 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 C 765.328593 0 0.4000 157 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 -----N 765.328593 0 0.0004 175
Out..
lnL = -765.328593
176 lfun, 1936 eigenQcodon, 10560 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.064690 0.023986 0.096938 0.100079 0.094288 0.067460 0.000100 0.900000 1.092114 1.399009 2.185430
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 13.372257
np = 11
lnL0 = -840.656545
Iterating by ming2
Initial: fx= 840.656545
x= 0.06469 0.02399 0.09694 0.10008 0.09429 0.06746 0.00011 0.90000 1.09211 1.39901 2.18543
1 h-m-p 0.0000 0.0000 377.3072 ++ 840.423479 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 530.4107 +++ 817.363034 m 0.0002 31 | 2/11
3 h-m-p 0.0001 0.0004 236.4881 ++ 783.622937 m 0.0004 45 | 3/11
4 h-m-p 0.0018 0.0090 36.8136 ++ 773.984943 m 0.0090 59 | 4/11
5 h-m-p 0.0000 0.0002 2482.3405 ++ 765.617324 m 0.0002 73 | 5/11
6 h-m-p 0.0000 0.0000 1641.3532 ++ 765.424085 m 0.0000 87 | 6/11
7 h-m-p 0.0000 0.0006 1086.5935 ++ 765.334567 m 0.0006 101 | 7/11
8 h-m-p 0.0021 0.0115 234.0291 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 187.6933 ++ 765.328793 m 0.0000 139 | 8/11
10 h-m-p 0.0160 8.0000 0.0000 N 765.328793 0 0.0160 153
Out..
lnL = -765.328793
154 lfun, 1848 eigenQcodon, 10164 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -765.339982 S = -765.325603 -0.006314
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:09
did 20 / 58 patterns 0:09
did 30 / 58 patterns 0:09
did 40 / 58 patterns 0:09
did 50 / 58 patterns 0:10
did 58 / 58 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=190
NC_011896_1_WP_010908938_1_2681_MLBR_RS12755 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
NC_002677_1_NP_302619_1_1491_dcd VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH
**************************************************
NC_011896_1_WP_010908938_1_2681_MLBR_RS12755 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
NC_002677_1_NP_302619_1_1491_dcd IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140 IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG
**************************************************
NC_011896_1_WP_010908938_1_2681_MLBR_RS12755 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
NC_002677_1_NP_302619_1_1491_dcd KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140 KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC
**************************************************
NC_011896_1_WP_010908938_1_2681_MLBR_RS12755 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
NC_002677_1_NP_302619_1_1491_dcd VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140 VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
****************************************
>NC_011896_1_WP_010908938_1_2681_MLBR_RS12755 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG AGAATTTCATAAAAAATACC >NC_002677_1_NP_302619_1_1491_dcd GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG AGAATTTCATAAAAAATACC >NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG AGAATTTCATAAAAAATACC >NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG AGAATTTCATAAAAAATACC >NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG AGAATTTCATAAAAAATACC >NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140 GTGCTGCTCTCCGATCGTGACCTCAGGGCCGAAATCACCGCCGGCCGATT CAGCATCGATCCGTTCGACGACACCCTGGTGCAGCCGTCCAGCATTGATG TTCGCCTTGACTGCATGTTCCGCGTGTTCAACAACACCCGCTACACTCAC ATCGACCCCGCGCGACAACAGGATGAGCTGACGAGCCTGGTAGAACTGGT TGACGGGGAACCGTTTGTACTGCACCCGGGTGGATTTGTGCTTGGCTCCA CGCTAGAATTATTCACCCTGCCCGAGGACTTAGCAGGACGGCTGGAAGGC AAATCATCGCTGGGCCGGCTGGGCCTGTTGACGCACTCGACCGCGGGTTT CATTGATCCTGGCTTCTGTGGCCACATCACGCTCGAACTGTCCAATGTTG CTAACTTGCCGATCACCCTGTGGCCAGGCATGAAGATCGGCCAGCTGTGC GTTTTGCGCTTGACCAGTCCGGCGGAACATCCCTACGGTAGTGCGAGCGC GGGGTCAAAATATCAGGGTCAACGGGGGCCGACACCATCCCGAAGCTACG AGAATTTCATAAAAAATACC
>NC_011896_1_WP_010908938_1_2681_MLBR_RS12755 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT >NC_002677_1_NP_302619_1_1491_dcd VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT >NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT >NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT >NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT >NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140 VLLSDRDLRAEITAGRFSIDPFDDTLVQPSSIDVRLDCMFRVFNNTRYTH IDPARQQDELTSLVELVDGEPFVLHPGGFVLGSTLELFTLPEDLAGRLEG KSSLGRLGLLTHSTAGFIDPGFCGHITLELSNVANLPITLWPGMKIGQLC VLRLTSPAEHPYGSASAGSKYQGQRGPTPSRSYENFIKNT
#NEXUS
[ID: 9796803718]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908938_1_2681_MLBR_RS12755
NC_002677_1_NP_302619_1_1491_dcd
NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395
NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195
NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805
NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908938_1_2681_MLBR_RS12755,
2 NC_002677_1_NP_302619_1_1491_dcd,
3 NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395,
4 NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195,
5 NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805,
6 NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06771807,2:0.06731831,3:0.06818091,4:0.07025063,5:0.06445055,6:0.06855773);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06771807,2:0.06731831,3:0.06818091,4:0.07025063,5:0.06445055,6:0.06855773);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -784.48 -788.26
2 -784.43 -787.55
--------------------------------------
TOTAL -784.45 -787.96
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/dcd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882701 0.085419 0.389841 1.498074 0.852894 1212.52 1334.63 1.000
r(A<->C){all} 0.163890 0.019780 0.000066 0.448616 0.126935 151.31 200.37 1.001
r(A<->G){all} 0.163136 0.019291 0.000004 0.451903 0.127031 156.00 190.12 1.001
r(A<->T){all} 0.161379 0.020005 0.000147 0.453598 0.118573 274.75 350.17 1.000
r(C<->G){all} 0.183532 0.023097 0.000033 0.493335 0.142446 178.96 248.52 1.006
r(C<->T){all} 0.161698 0.019229 0.000088 0.444596 0.123327 233.85 253.72 1.008
r(G<->T){all} 0.166363 0.019835 0.000095 0.457652 0.127505 128.35 187.70 1.000
pi(A){all} 0.208960 0.000275 0.177561 0.241584 0.208530 1096.34 1160.88 1.000
pi(C){all} 0.301844 0.000356 0.264974 0.336182 0.301334 1271.91 1312.26 1.000
pi(G){all} 0.276737 0.000336 0.239769 0.312287 0.276740 1170.39 1272.47 1.000
pi(T){all} 0.212459 0.000283 0.179536 0.246499 0.211836 1259.91 1331.46 1.000
alpha{1,2} 0.446697 0.243204 0.000308 1.422536 0.290670 1054.92 1156.25 1.000
alpha{3} 0.458963 0.236490 0.000219 1.456701 0.297959 1202.34 1236.46 1.000
pinvar{all} 0.997292 0.000011 0.991227 0.999998 0.998336 1284.52 1322.50 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/dcd/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 190
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 8 8 8 8 8 8 | TCC 5 5 5 5 5 5 | TAC 3 3 3 3 3 3 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 3 3 3 3 3 3 | CCC 3 3 3 3 3 3 | CAC 4 4 4 4 4 4 | CGC 4 4 4 4 4 4
CTA 1 1 1 1 1 1 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 3 3 3 3 3 3
CTG 14 14 14 14 14 14 | CCG 7 7 7 7 7 7 | CAG 4 4 4 4 4 4 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 2 2 2 2 2 2
ATC 6 6 6 6 6 6 | ACC 8 8 8 8 8 8 | AAC 3 3 3 3 3 3 | AGC 5 5 5 5 5 5
ATA 1 1 1 1 1 1 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 4 4 4 4 4 4 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 4 4 4 4 4 | Ala GCT 1 1 1 1 1 1 | Asp GAT 5 5 5 5 5 5 | Gly GGT 4 4 4 4 4 4
GTC 0 0 0 0 0 0 | GCC 2 2 2 2 2 2 | GAC 7 7 7 7 7 7 | GGC 9 9 9 9 9 9
GTA 2 2 2 2 2 2 | GCA 1 1 1 1 1 1 | Glu GAA 7 7 7 7 7 7 | GGA 2 2 2 2 2 2
GTG 4 4 4 4 4 4 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908938_1_2681_MLBR_RS12755
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
#2: NC_002677_1_NP_302619_1_1491_dcd
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
#3: NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
#4: NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
#5: NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
#6: NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 6
TTC 48 | TCC 30 | TAC 18 | TGC 12
Leu L TTA 12 | TCA 12 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 6
CTC 18 | CCC 18 | CAC 24 | CGC 24
CTA 6 | CCA 12 | Gln Q CAA 12 | CGA 18
CTG 84 | CCG 42 | CAG 24 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 18 | Ser S AGT 12
ATC 36 | ACC 48 | AAC 18 | AGC 30
ATA 6 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 24 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 24 | Ala A GCT 6 | Asp D GAT 30 | Gly G GGT 24
GTC 0 | GCC 12 | GAC 42 | GGC 54
GTA 12 | GCA 6 | Glu E GAA 42 | GGA 12
GTG 24 | GCG 30 | GAG 18 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17368 C:0.28947 A:0.22632 G:0.31053
position 2: T:0.30000 C:0.23684 A:0.24737 G:0.21579
position 3: T:0.16316 C:0.37895 A:0.15263 G:0.30526
Average T:0.21228 C:0.30175 A:0.20877 G:0.27719
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -765.328682 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.271420 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908938_1_2681_MLBR_RS12755: 0.000004, NC_002677_1_NP_302619_1_1491_dcd: 0.000004, NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395: 0.000004, NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195: 0.000004, NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805: 0.000004, NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.27142
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 447.3 122.7 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 447.3 122.7 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 447.3 122.7 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 447.3 122.7 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 447.3 122.7 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 447.3 122.7 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -765.328726 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.219483 0.999990 0.133138
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908938_1_2681_MLBR_RS12755: 0.000004, NC_002677_1_NP_302619_1_1491_dcd: 0.000004, NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395: 0.000004, NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195: 0.000004, NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805: 0.000004, NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.21948
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.13314 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 448.4 121.6 0.1331 0.0000 0.0000 0.0 0.0
7..2 0.000 448.4 121.6 0.1331 0.0000 0.0000 0.0 0.0
7..3 0.000 448.4 121.6 0.1331 0.0000 0.0000 0.0 0.0
7..4 0.000 448.4 121.6 0.1331 0.0000 0.0000 0.0 0.0
7..5 0.000 448.4 121.6 0.1331 0.0000 0.0000 0.0 0.0
7..6 0.000 448.4 121.6 0.1331 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -765.328784 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.169607 0.621088 0.235423 0.000001 2.207320
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908938_1_2681_MLBR_RS12755: 0.000004, NC_002677_1_NP_302619_1_1491_dcd: 0.000004, NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395: 0.000004, NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195: 0.000004, NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805: 0.000004, NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16961
MLEs of dN/dS (w) for site classes (K=3)
p: 0.62109 0.23542 0.14349
w: 0.00000 1.00000 2.20732
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 449.5 120.5 0.5521 0.0000 0.0000 0.0 0.0
7..2 0.000 449.5 120.5 0.5521 0.0000 0.0000 0.0 0.0
7..3 0.000 449.5 120.5 0.5521 0.0000 0.0000 0.0 0.0
7..4 0.000 449.5 120.5 0.5521 0.0000 0.0000 0.0 0.0
7..5 0.000 449.5 120.5 0.5521 0.0000 0.0000 0.0 0.0
7..6 0.000 449.5 120.5 0.5521 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908938_1_2681_MLBR_RS12755)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908938_1_2681_MLBR_RS12755)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -765.328593 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.177825
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908938_1_2681_MLBR_RS12755: 0.000004, NC_002677_1_NP_302619_1_1491_dcd: 0.000004, NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395: 0.000004, NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195: 0.000004, NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805: 0.000004, NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.17783
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.5 116.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 453.5 116.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 453.5 116.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 453.5 116.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 453.5 116.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 453.5 116.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -765.328793 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.761350 0.005000 2.113564 3.172861
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908938_1_2681_MLBR_RS12755: 0.000004, NC_002677_1_NP_302619_1_1491_dcd: 0.000004, NZ_LVXE01000003_1_WP_010908938_1_1341_A3216_RS02395: 0.000004, NZ_LYPH01000044_1_WP_010908938_1_1721_A8144_RS08195: 0.000004, NZ_CP029543_1_WP_010908938_1_2711_DIJ64_RS13805: 0.000004, NZ_AP014567_1_WP_010908938_1_2778_JK2ML_RS14140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.76135 p = 0.00500 q = 2.11356
(p1 = 0.23865) w = 3.17286
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.07613 0.23865
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.17286
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 453.5 116.5 0.7572 0.0000 0.0000 0.0 0.0
7..2 0.000 453.5 116.5 0.7572 0.0000 0.0000 0.0 0.0
7..3 0.000 453.5 116.5 0.7572 0.0000 0.0000 0.0 0.0
7..4 0.000 453.5 116.5 0.7572 0.0000 0.0000 0.0 0.0
7..5 0.000 453.5 116.5 0.7572 0.0000 0.0000 0.0 0.0
7..6 0.000 453.5 116.5 0.7572 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908938_1_2681_MLBR_RS12755)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908938_1_2681_MLBR_RS12755)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:10
Model 1: NearlyNeutral -765.328726 Model 2: PositiveSelection -765.328784 Model 0: one-ratio -765.328682 Model 7: beta -765.328593 Model 8: beta&w>1 -765.328793 Model 0 vs 1 8.800000000519503E-5 Model 2 vs 1 1.160000001618755E-4 Model 8 vs 7 4.0000000012696546E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
