--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 13:13:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/pgsA2/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -828.26 -831.35
2 -828.35 -833.94
--------------------------------------
TOTAL -828.30 -833.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895963 0.089910 0.361387 1.486257 0.866003 1315.08 1408.04 1.000
r(A<->C){all} 0.169357 0.020028 0.000097 0.454095 0.132689 197.76 255.52 1.000
r(A<->G){all} 0.166286 0.019854 0.000140 0.451814 0.130450 130.02 203.57 1.000
r(A<->T){all} 0.164858 0.018657 0.000023 0.433245 0.127543 230.06 232.95 1.001
r(C<->G){all} 0.166340 0.018332 0.000032 0.432645 0.133810 338.27 340.02 1.000
r(C<->T){all} 0.164775 0.019172 0.000019 0.446368 0.129512 151.49 194.21 1.000
r(G<->T){all} 0.168384 0.019266 0.000045 0.447367 0.133267 139.12 150.43 1.003
pi(A){all} 0.136666 0.000188 0.110679 0.163476 0.136383 1315.43 1328.15 1.000
pi(C){all} 0.249699 0.000306 0.215068 0.283423 0.249677 1364.21 1393.45 1.000
pi(G){all} 0.346399 0.000369 0.308879 0.383391 0.346319 1328.09 1337.15 1.000
pi(T){all} 0.267236 0.000324 0.231997 0.301127 0.267229 1031.12 1164.72 1.000
alpha{1,2} 0.435071 0.236751 0.000148 1.455342 0.266912 1320.44 1341.77 1.000
alpha{3} 0.459567 0.248955 0.000557 1.441762 0.292395 1180.33 1249.57 1.000
pinvar{all} 0.997506 0.000009 0.991931 0.999999 0.998467 1091.99 1248.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -791.610852
Model 2: PositiveSelection -791.610852
Model 0: one-ratio -791.611106
Model 7: beta -791.610852
Model 8: beta&w>1 -791.610852
Model 0 vs 1 5.079999998542917E-4
Model 2 vs 1 0.0
Model 8 vs 7 0.0
>C1
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C2
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C3
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C4
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C5
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C6
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=206
C1 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C2 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C3 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C4 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C5 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C6 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
**************************************************
C1 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C2 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C3 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C4 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C5 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C6 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
**************************************************
C1 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C2 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C3 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C4 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C5 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C6 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
**************************************************
C1 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C2 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C3 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C4 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C5 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C6 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
**************************************************
C1 FAGKAR
C2 FAGKAR
C3 FAGKAR
C4 FAGKAR
C5 FAGKAR
C6 FAGKAR
******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 206 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 206 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [6180]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [6180]--->[6180]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.745 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C2 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C3 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C4 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C5 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C6 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
**************************************************
C1 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C2 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C3 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C4 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C5 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C6 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
**************************************************
C1 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C2 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C3 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C4 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C5 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C6 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
**************************************************
C1 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C2 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C3 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C4 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C5 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C6 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
**************************************************
C1 FAGKAR
C2 FAGKAR
C3 FAGKAR
C4 FAGKAR
C5 FAGKAR
C6 FAGKAR
******
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C2 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C3 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C4 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C5 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C6 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
**************************************************
C1 CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C2 CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C3 CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C4 CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C5 CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C6 CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
**************************************************
C1 TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C2 TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C3 TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C4 TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C5 TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C6 TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
**************************************************
C1 TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C2 TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C3 TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C4 TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C5 TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C6 TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
**************************************************
C1 GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C2 GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C3 GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C4 GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C5 GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C6 GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
**************************************************
C1 TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C2 TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C3 TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C4 TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C5 TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C6 TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
**************************************************
C1 GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C2 GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C3 GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C4 GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C5 GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C6 GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
**************************************************
C1 GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C2 GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C3 GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C4 GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C5 GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C6 GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
**************************************************
C1 CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C2 CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C3 CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C4 CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C5 CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C6 CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
**************************************************
C1 ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C2 ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C3 ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C4 ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C5 ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C6 ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
**************************************************
C1 GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C2 GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C3 GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C4 GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C5 GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C6 GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
**************************************************
C1 CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C2 CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C3 CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C4 CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C5 CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C6 CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
**************************************************
C1 TTTGCGGGAAAGGCCAGA
C2 TTTGCGGGAAAGGCCAGA
C3 TTTGCGGGAAAGGCCAGA
C4 TTTGCGGGAAAGGCCAGA
C5 TTTGCGGGAAAGGCCAGA
C6 TTTGCGGGAAAGGCCAGA
******************
>C1
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C2
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C3
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C4
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C5
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C6
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C1
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C2
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C3
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C4
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C5
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C6
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 618 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579785135
Setting output file names to "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 928828474
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9395073317
Seed = 313649239
Swapseed = 1579785135
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1383.113619 -- -24.965149
Chain 2 -- -1383.113538 -- -24.965149
Chain 3 -- -1383.113409 -- -24.965149
Chain 4 -- -1383.113538 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1383.113619 -- -24.965149
Chain 2 -- -1383.113619 -- -24.965149
Chain 3 -- -1383.113538 -- -24.965149
Chain 4 -- -1383.113619 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1383.114] (-1383.114) (-1383.113) (-1383.114) * [-1383.114] (-1383.114) (-1383.114) (-1383.114)
500 -- (-863.228) (-857.529) [-844.392] (-861.525) * (-838.074) (-866.368) [-838.458] (-862.943) -- 0:00:00
1000 -- (-842.420) (-846.383) (-840.321) [-843.042] * [-833.393] (-865.291) (-835.934) (-833.253) -- 0:00:00
1500 -- [-839.006] (-843.062) (-841.037) (-836.064) * [-840.739] (-857.348) (-836.568) (-834.576) -- 0:00:00
2000 -- (-838.367) [-835.030] (-839.777) (-843.131) * (-855.464) (-843.179) [-836.867] (-836.463) -- 0:00:00
2500 -- [-833.675] (-837.066) (-847.496) (-840.735) * (-835.523) (-839.785) [-831.545] (-835.581) -- 0:00:00
3000 -- [-835.024] (-840.870) (-836.827) (-838.510) * (-844.439) (-842.287) (-844.310) [-838.457] -- 0:00:00
3500 -- (-841.184) (-841.561) [-835.391] (-839.697) * (-841.471) [-837.651] (-835.930) (-845.722) -- 0:00:00
4000 -- (-841.655) (-838.858) [-835.831] (-842.436) * (-838.523) [-835.058] (-835.547) (-834.000) -- 0:00:00
4500 -- (-841.354) (-837.473) [-836.323] (-838.593) * (-834.294) (-844.323) [-837.955] (-834.280) -- 0:00:00
5000 -- [-836.490] (-841.369) (-849.251) (-835.776) * [-832.429] (-838.376) (-839.312) (-835.886) -- 0:00:00
Average standard deviation of split frequencies: 0.107137
5500 -- (-840.452) (-843.206) [-843.318] (-841.544) * (-839.016) (-831.771) [-834.277] (-843.048) -- 0:00:00
6000 -- (-845.001) (-836.884) [-833.905] (-837.444) * [-839.092] (-851.293) (-835.969) (-831.319) -- 0:00:00
6500 -- (-842.813) (-836.926) [-835.912] (-844.980) * (-841.993) [-830.953] (-847.777) (-841.195) -- 0:00:00
7000 -- (-833.875) (-844.372) [-839.748] (-835.361) * (-835.978) (-833.103) [-837.377] (-846.593) -- 0:00:00
7500 -- [-840.104] (-839.496) (-840.861) (-845.068) * (-834.115) (-837.577) (-837.260) [-837.560] -- 0:00:00
8000 -- [-834.723] (-834.641) (-843.934) (-839.306) * (-834.986) (-838.018) (-840.811) [-841.353] -- 0:00:00
8500 -- [-833.276] (-838.792) (-834.235) (-844.769) * (-834.330) (-839.926) (-832.165) [-841.400] -- 0:00:00
9000 -- [-834.680] (-843.606) (-837.444) (-832.641) * [-840.612] (-839.290) (-835.875) (-833.249) -- 0:00:00
9500 -- (-837.533) (-842.901) (-843.349) [-837.132] * (-836.647) (-835.741) [-836.519] (-834.565) -- 0:00:00
10000 -- (-836.349) (-842.534) [-836.712] (-837.526) * (-832.066) (-840.089) (-843.814) [-838.471] -- 0:00:00
Average standard deviation of split frequencies: 0.077340
10500 -- (-836.537) (-836.143) [-836.438] (-836.044) * [-837.772] (-836.533) (-841.220) (-834.273) -- 0:00:00
11000 -- (-835.883) [-838.382] (-837.049) (-841.664) * [-834.382] (-836.720) (-837.829) (-849.230) -- 0:00:00
11500 -- (-836.082) [-835.960] (-840.541) (-836.286) * (-837.040) [-833.823] (-837.654) (-845.945) -- 0:00:00
12000 -- [-836.364] (-837.158) (-839.182) (-839.526) * [-834.798] (-836.583) (-835.594) (-838.458) -- 0:00:00
12500 -- (-836.961) (-831.946) [-840.665] (-838.578) * (-839.647) [-838.671] (-835.644) (-840.375) -- 0:01:19
13000 -- [-837.389] (-839.346) (-830.781) (-852.676) * [-840.423] (-838.611) (-844.263) (-845.464) -- 0:01:15
13500 -- (-839.522) (-843.136) [-831.717] (-831.145) * (-845.106) (-835.129) (-840.042) [-833.691] -- 0:01:13
14000 -- (-842.198) (-837.441) [-829.758] (-828.244) * (-850.716) (-835.319) (-838.237) [-837.313] -- 0:01:10
14500 -- (-835.670) (-832.553) (-829.738) [-828.833] * [-843.285] (-836.621) (-857.541) (-840.277) -- 0:01:07
15000 -- (-841.791) [-836.233] (-834.340) (-828.351) * (-849.613) (-836.679) [-828.580] (-835.098) -- 0:01:05
Average standard deviation of split frequencies: 0.070149
15500 -- [-841.372] (-835.630) (-834.488) (-829.784) * (-843.276) [-836.652] (-832.456) (-834.899) -- 0:01:03
16000 -- (-846.963) [-840.939] (-831.627) (-828.493) * (-852.753) [-832.754] (-831.465) (-834.621) -- 0:01:01
16500 -- (-836.909) (-844.741) (-829.474) [-832.142] * (-836.927) [-832.889] (-828.727) (-836.844) -- 0:00:59
17000 -- [-840.700] (-859.212) (-829.613) (-827.690) * (-830.390) (-836.465) [-831.081] (-838.716) -- 0:00:57
17500 -- (-834.776) (-837.501) (-830.648) [-827.031] * (-828.173) [-839.330] (-831.868) (-840.752) -- 0:00:56
18000 -- (-838.322) (-835.920) (-830.098) [-829.069] * [-827.518] (-838.768) (-828.734) (-836.659) -- 0:00:54
18500 -- (-843.328) [-837.872] (-832.213) (-829.065) * [-827.479] (-841.624) (-830.654) (-840.369) -- 0:00:53
19000 -- (-837.225) (-839.770) [-828.830] (-831.075) * (-828.244) [-840.930] (-828.707) (-841.745) -- 0:00:51
19500 -- (-839.747) [-827.828] (-828.087) (-831.602) * [-829.339] (-840.347) (-827.762) (-841.666) -- 0:00:50
20000 -- (-840.133) [-829.438] (-830.346) (-830.924) * [-826.978] (-837.879) (-828.763) (-836.631) -- 0:00:49
Average standard deviation of split frequencies: 0.054951
20500 -- (-848.713) (-831.610) [-830.608] (-830.517) * (-829.697) (-843.189) (-833.008) [-836.517] -- 0:00:47
21000 -- [-838.865] (-829.758) (-827.575) (-827.035) * [-829.902] (-838.100) (-827.964) (-834.073) -- 0:00:46
21500 -- [-835.982] (-827.757) (-826.938) (-828.330) * (-828.572) [-837.641] (-829.204) (-833.317) -- 0:00:45
22000 -- (-835.652) (-830.130) [-826.982] (-827.419) * [-828.871] (-840.105) (-829.107) (-834.557) -- 0:00:44
22500 -- (-839.585) [-831.956] (-830.137) (-827.868) * (-830.988) (-848.180) (-829.883) [-838.509] -- 0:00:43
23000 -- (-843.091) (-829.637) [-827.307] (-828.992) * (-831.068) (-858.446) [-829.824] (-833.082) -- 0:00:42
23500 -- (-841.529) (-827.767) [-826.989] (-829.049) * (-828.049) [-842.811] (-829.250) (-837.047) -- 0:00:41
24000 -- (-835.393) (-831.382) (-827.605) [-827.129] * [-827.426] (-837.638) (-829.034) (-839.185) -- 0:00:40
24500 -- (-837.140) [-830.742] (-827.978) (-828.824) * (-828.125) (-827.930) (-828.795) [-833.743] -- 0:00:39
25000 -- (-838.006) (-831.047) (-828.568) [-831.172] * (-831.380) [-828.141] (-829.344) (-832.823) -- 0:00:39
Average standard deviation of split frequencies: 0.046151
25500 -- (-828.417) [-830.708] (-828.594) (-828.707) * [-830.017] (-828.428) (-833.913) (-845.300) -- 0:00:38
26000 -- (-827.004) (-827.592) [-827.290] (-832.977) * (-828.696) (-830.659) (-828.630) [-835.531] -- 0:00:37
26500 -- [-828.588] (-827.723) (-828.174) (-836.228) * [-827.415] (-828.354) (-831.114) (-831.583) -- 0:00:36
27000 -- (-827.706) (-827.522) (-830.087) [-831.278] * [-827.465] (-827.992) (-835.175) (-828.384) -- 0:00:36
27500 -- (-829.446) (-830.394) [-827.452] (-830.351) * (-831.304) [-828.445] (-832.127) (-828.045) -- 0:00:35
28000 -- (-832.024) (-829.325) (-830.096) [-829.985] * [-827.989] (-828.333) (-831.335) (-829.569) -- 0:00:34
28500 -- [-829.132] (-830.147) (-828.743) (-829.781) * (-828.161) (-828.936) (-829.684) [-831.455] -- 0:00:34
29000 -- (-827.449) (-829.115) [-827.383] (-829.775) * (-830.516) [-828.167] (-829.593) (-827.629) -- 0:01:06
29500 -- (-829.491) (-828.343) [-827.909] (-828.170) * (-829.910) (-831.168) [-828.087] (-827.623) -- 0:01:05
30000 -- (-827.739) (-828.770) [-830.474] (-827.979) * (-827.175) (-829.507) [-830.001] (-835.784) -- 0:01:04
Average standard deviation of split frequencies: 0.036600
30500 -- (-832.798) [-828.983] (-833.588) (-827.934) * (-831.253) [-829.682] (-829.703) (-831.970) -- 0:01:03
31000 -- (-830.989) (-830.259) [-830.361] (-827.530) * [-828.634] (-829.552) (-831.880) (-831.546) -- 0:01:02
31500 -- (-829.651) [-827.573] (-827.664) (-828.980) * (-829.271) (-828.088) [-828.063] (-828.783) -- 0:01:01
32000 -- [-831.153] (-829.012) (-832.113) (-828.530) * (-828.662) (-828.259) [-828.445] (-827.454) -- 0:01:00
32500 -- (-829.179) [-830.475] (-831.020) (-829.888) * (-830.084) (-828.852) (-830.156) [-828.203] -- 0:00:59
33000 -- (-828.636) (-828.797) [-827.542] (-833.962) * (-829.906) (-829.782) [-829.391] (-828.735) -- 0:00:58
33500 -- (-828.208) [-828.877] (-827.597) (-830.431) * (-829.055) (-830.342) [-829.252] (-827.572) -- 0:00:57
34000 -- (-831.022) (-829.215) [-830.403] (-829.992) * (-827.701) [-828.980] (-830.911) (-828.351) -- 0:00:56
34500 -- (-828.696) [-827.913] (-830.423) (-829.147) * (-828.560) (-830.626) (-830.367) [-828.951] -- 0:00:55
35000 -- (-830.729) [-827.331] (-830.150) (-830.300) * (-828.076) (-829.656) (-829.059) [-830.292] -- 0:00:55
Average standard deviation of split frequencies: 0.033048
35500 -- (-828.866) [-827.102] (-833.050) (-827.961) * (-827.711) (-829.335) [-831.142] (-829.764) -- 0:00:54
36000 -- (-828.273) (-828.168) (-834.313) [-828.589] * (-827.365) (-829.504) [-829.700] (-829.066) -- 0:00:53
36500 -- (-829.777) [-828.334] (-836.444) (-831.269) * (-828.853) (-829.699) (-828.426) [-829.617] -- 0:00:52
37000 -- (-828.767) [-829.564] (-828.694) (-831.282) * (-830.678) [-829.863] (-827.985) (-831.480) -- 0:00:52
37500 -- (-828.455) (-827.515) (-829.032) [-830.977] * (-829.725) (-829.443) [-828.628] (-830.462) -- 0:00:51
38000 -- (-835.203) (-835.011) (-833.018) [-827.151] * [-829.964] (-828.833) (-831.167) (-831.528) -- 0:00:50
38500 -- (-830.101) (-828.342) [-829.076] (-828.307) * (-831.998) (-830.873) [-834.197] (-831.595) -- 0:00:49
39000 -- (-828.877) (-831.130) [-829.182] (-829.167) * (-829.197) (-827.791) [-829.184] (-836.174) -- 0:00:49
39500 -- (-829.624) [-832.768] (-828.572) (-827.732) * (-831.109) (-828.880) (-828.845) [-829.445] -- 0:00:48
40000 -- (-830.550) (-828.852) [-829.371] (-827.112) * (-828.848) [-827.217] (-828.167) (-832.408) -- 0:00:48
Average standard deviation of split frequencies: 0.032945
40500 -- (-834.804) (-827.574) (-828.944) [-829.225] * [-829.328] (-827.736) (-827.488) (-832.051) -- 0:00:47
41000 -- [-830.748] (-828.281) (-829.283) (-829.247) * (-827.142) (-827.773) [-830.503] (-828.076) -- 0:00:46
41500 -- (-831.941) (-829.937) [-830.875] (-831.173) * (-828.397) [-829.755] (-828.844) (-828.288) -- 0:00:46
42000 -- (-833.858) (-827.518) [-830.614] (-827.829) * (-830.041) [-831.029] (-828.691) (-831.051) -- 0:00:45
42500 -- (-828.554) (-828.839) (-826.937) [-830.256] * (-829.996) [-830.022] (-832.898) (-830.583) -- 0:00:45
43000 -- (-832.253) (-829.179) [-826.885] (-832.266) * (-828.699) [-829.485] (-829.932) (-829.518) -- 0:00:44
43500 -- (-831.056) (-831.151) [-828.017] (-828.129) * (-829.591) (-829.722) (-827.280) [-827.658] -- 0:00:43
44000 -- (-830.815) (-828.158) (-828.460) [-828.050] * (-830.525) (-828.254) (-828.697) [-830.773] -- 0:00:43
44500 -- (-826.999) (-827.263) (-829.157) [-828.609] * (-829.601) (-829.626) [-828.111] (-827.689) -- 0:00:42
45000 -- [-828.587] (-827.838) (-828.967) (-828.977) * (-830.846) (-830.460) (-832.019) [-830.088] -- 0:01:03
Average standard deviation of split frequencies: 0.029407
45500 -- (-827.961) [-830.505] (-828.043) (-827.897) * (-829.278) [-826.713] (-831.195) (-828.715) -- 0:01:02
46000 -- (-827.789) (-836.520) (-827.703) [-830.877] * [-827.588] (-827.523) (-828.433) (-829.463) -- 0:01:02
46500 -- [-827.800] (-832.227) (-830.516) (-829.711) * (-827.503) (-826.937) [-829.019] (-831.185) -- 0:01:01
47000 -- [-832.002] (-827.773) (-829.937) (-828.063) * [-828.280] (-829.782) (-828.220) (-829.547) -- 0:01:00
47500 -- (-830.374) (-828.568) (-830.867) [-828.926] * (-827.406) (-827.878) [-827.542] (-828.991) -- 0:01:00
48000 -- [-827.121] (-832.054) (-832.475) (-832.774) * [-829.516] (-827.736) (-828.170) (-827.742) -- 0:00:59
48500 -- (-829.261) (-832.266) [-829.929] (-828.077) * [-828.585] (-828.376) (-830.458) (-828.447) -- 0:00:58
49000 -- [-829.711] (-830.494) (-830.643) (-830.059) * (-834.931) [-828.860] (-832.075) (-827.501) -- 0:00:58
49500 -- [-830.856] (-829.314) (-831.085) (-828.603) * (-831.307) (-830.068) [-827.119] (-827.752) -- 0:00:57
50000 -- (-829.287) (-827.974) [-833.169] (-834.287) * [-830.328] (-831.391) (-830.134) (-826.885) -- 0:00:57
Average standard deviation of split frequencies: 0.030027
50500 -- (-827.162) (-829.033) [-830.613] (-834.287) * [-829.252] (-828.696) (-829.516) (-826.885) -- 0:00:56
51000 -- [-828.671] (-828.632) (-828.588) (-832.516) * (-829.226) (-830.101) (-829.276) [-831.186] -- 0:00:55
51500 -- [-828.338] (-828.415) (-830.581) (-831.742) * (-828.733) [-829.337] (-829.898) (-828.710) -- 0:00:55
52000 -- (-828.719) (-829.049) (-832.925) [-835.387] * (-828.718) (-828.395) [-827.451] (-828.573) -- 0:00:54
52500 -- (-828.997) (-829.710) [-828.956] (-831.804) * (-827.918) [-829.913] (-827.171) (-828.891) -- 0:00:54
53000 -- (-831.107) (-829.292) (-827.735) [-829.086] * (-828.699) (-827.638) [-827.006] (-829.381) -- 0:00:53
53500 -- (-831.610) (-828.769) [-828.901] (-828.715) * (-831.868) (-829.867) [-829.643] (-834.504) -- 0:00:53
54000 -- (-832.202) (-829.739) (-827.935) [-828.474] * (-829.672) (-828.600) (-827.536) [-831.552] -- 0:00:52
54500 -- (-829.453) (-827.890) (-828.010) [-830.124] * [-828.834] (-828.874) (-830.887) (-827.758) -- 0:00:52
55000 -- [-830.910] (-830.284) (-827.701) (-830.856) * (-833.408) [-828.633] (-828.000) (-826.987) -- 0:00:51
Average standard deviation of split frequencies: 0.030866
55500 -- (-832.120) (-828.198) [-827.185] (-831.058) * (-834.303) [-827.998] (-830.449) (-827.123) -- 0:00:51
56000 -- (-831.196) (-834.165) [-829.054] (-831.463) * (-829.032) (-827.487) (-829.309) [-827.203] -- 0:00:50
56500 -- [-827.967] (-828.789) (-826.935) (-835.879) * (-829.417) [-830.124] (-833.251) (-829.795) -- 0:00:50
57000 -- (-827.858) (-830.434) [-829.255] (-828.205) * (-830.367) [-828.029] (-828.904) (-828.479) -- 0:00:49
57500 -- (-828.444) (-829.273) (-828.918) [-827.040] * (-829.577) [-830.761] (-829.778) (-829.171) -- 0:00:49
58000 -- (-827.259) (-832.367) [-829.511] (-827.639) * (-828.073) [-829.067] (-828.252) (-828.586) -- 0:00:48
58500 -- (-827.459) (-828.687) [-827.493] (-831.472) * (-830.534) (-828.537) (-827.542) [-827.868] -- 0:00:48
59000 -- (-827.907) [-831.258] (-830.741) (-829.552) * [-833.260] (-827.926) (-827.115) (-828.205) -- 0:00:47
59500 -- (-829.359) (-831.570) [-832.293] (-829.252) * (-828.060) (-828.432) [-827.969] (-828.610) -- 0:00:47
60000 -- (-827.953) (-838.292) [-830.421] (-829.232) * (-830.881) [-827.201] (-828.387) (-830.412) -- 0:00:47
Average standard deviation of split frequencies: 0.029037
60500 -- (-827.408) (-830.692) [-831.638] (-828.674) * [-834.845] (-830.152) (-828.326) (-829.201) -- 0:00:46
61000 -- (-828.829) (-833.809) (-832.467) [-828.649] * (-834.101) (-829.713) [-830.131] (-830.823) -- 0:00:46
61500 -- [-827.422] (-836.625) (-832.043) (-826.959) * [-829.663] (-833.807) (-829.543) (-828.705) -- 0:00:45
62000 -- (-830.076) [-831.636] (-829.566) (-829.619) * [-829.202] (-830.575) (-830.211) (-829.432) -- 0:01:00
62500 -- [-828.362] (-827.351) (-829.103) (-829.644) * (-828.797) (-827.574) [-829.706] (-828.926) -- 0:01:00
63000 -- (-832.509) (-827.559) (-827.058) [-826.992] * (-827.921) (-828.241) [-829.195] (-830.059) -- 0:00:59
63500 -- [-838.873] (-826.757) (-827.236) (-826.997) * (-831.215) [-827.102] (-831.976) (-827.320) -- 0:00:58
64000 -- (-828.813) (-830.581) [-828.209] (-829.933) * (-828.678) (-827.332) [-826.818] (-827.138) -- 0:00:58
64500 -- (-830.077) (-828.582) [-827.881] (-832.094) * (-833.794) (-828.286) (-830.271) [-829.014] -- 0:00:58
65000 -- (-829.976) [-828.325] (-829.883) (-829.357) * (-830.830) (-827.956) (-834.029) [-830.399] -- 0:00:57
Average standard deviation of split frequencies: 0.032918
65500 -- (-830.001) (-828.002) [-827.135] (-830.164) * (-828.460) (-827.853) (-830.100) [-832.168] -- 0:00:57
66000 -- (-833.774) (-827.864) (-828.643) [-827.928] * (-828.174) (-829.037) (-828.682) [-829.433] -- 0:00:56
66500 -- (-830.727) (-827.882) (-829.182) [-829.773] * (-828.307) [-830.249] (-831.470) (-831.292) -- 0:00:56
67000 -- (-831.889) [-828.102] (-829.616) (-830.092) * (-831.609) (-830.676) (-830.000) [-829.522] -- 0:00:55
67500 -- (-832.682) (-828.725) (-827.891) [-828.828] * (-828.991) [-829.159] (-826.720) (-828.881) -- 0:00:55
68000 -- (-830.226) (-827.742) [-829.224] (-828.643) * [-828.415] (-828.447) (-828.453) (-828.915) -- 0:00:54
68500 -- [-828.540] (-826.862) (-828.204) (-830.060) * (-834.951) [-827.555] (-827.275) (-833.674) -- 0:00:54
69000 -- (-829.861) (-827.501) [-827.827] (-831.000) * (-831.155) (-827.518) [-827.317] (-834.124) -- 0:00:53
69500 -- (-828.380) [-827.724] (-827.804) (-828.596) * (-829.434) [-830.436] (-830.202) (-832.777) -- 0:00:53
70000 -- (-827.422) (-826.769) (-828.205) [-829.514] * (-828.606) (-828.164) (-827.697) [-829.152] -- 0:00:53
Average standard deviation of split frequencies: 0.032719
70500 -- (-826.803) (-826.670) (-827.084) [-827.763] * (-826.911) [-829.890] (-830.162) (-833.342) -- 0:00:52
71000 -- [-829.728] (-829.192) (-829.001) (-828.487) * (-829.452) (-828.524) (-830.377) [-828.727] -- 0:00:52
71500 -- (-829.466) (-828.590) (-829.305) [-828.303] * [-830.796] (-831.767) (-827.855) (-828.194) -- 0:00:51
72000 -- [-828.906] (-828.565) (-829.203) (-829.112) * [-829.459] (-831.897) (-830.286) (-826.936) -- 0:00:51
72500 -- (-829.163) [-831.725] (-828.728) (-827.214) * [-830.189] (-830.391) (-830.295) (-831.595) -- 0:00:51
73000 -- [-829.548] (-828.615) (-827.628) (-827.416) * (-829.674) (-828.492) (-828.699) [-831.508] -- 0:00:50
73500 -- (-827.532) [-834.062] (-829.215) (-829.577) * (-829.735) (-830.525) (-832.676) [-826.845] -- 0:00:50
74000 -- (-827.955) [-831.460] (-828.091) (-827.225) * (-830.226) (-832.935) [-827.930] (-829.209) -- 0:00:50
74500 -- (-829.111) [-830.180] (-831.482) (-828.396) * (-829.609) [-831.567] (-828.144) (-828.271) -- 0:00:49
75000 -- (-828.395) (-832.163) (-832.422) [-828.647] * (-831.338) (-829.402) [-828.361] (-828.933) -- 0:00:49
Average standard deviation of split frequencies: 0.029241
75500 -- (-832.237) (-830.991) (-834.047) [-829.579] * (-828.477) (-828.873) [-829.500] (-828.947) -- 0:00:48
76000 -- (-827.746) (-829.551) (-829.471) [-831.142] * (-828.279) (-828.157) [-834.379] (-828.968) -- 0:00:48
76500 -- (-828.305) [-827.760] (-829.476) (-828.895) * [-834.624] (-833.616) (-831.877) (-829.886) -- 0:00:48
77000 -- (-829.744) (-830.799) [-828.642] (-833.679) * (-833.107) (-831.403) [-830.872] (-830.361) -- 0:00:47
77500 -- (-830.677) (-827.459) (-829.532) [-828.347] * [-829.376] (-829.018) (-830.186) (-830.610) -- 0:00:47
78000 -- (-828.638) [-828.601] (-833.733) (-829.945) * (-827.937) [-827.183] (-828.066) (-828.107) -- 0:00:47
78500 -- (-831.017) (-827.119) [-833.258] (-828.017) * (-830.653) (-829.772) [-827.758] (-831.502) -- 0:00:58
79000 -- [-827.811] (-827.299) (-831.242) (-828.177) * [-833.217] (-829.527) (-827.816) (-833.946) -- 0:00:58
79500 -- (-832.890) (-828.343) (-827.568) [-827.243] * (-833.292) [-827.198] (-829.470) (-837.017) -- 0:00:57
80000 -- [-827.572] (-827.267) (-827.387) (-828.066) * (-827.706) (-828.638) [-831.731] (-832.882) -- 0:00:57
Average standard deviation of split frequencies: 0.032726
80500 -- (-827.652) (-829.273) [-826.893] (-827.004) * [-827.524] (-827.788) (-830.499) (-831.326) -- 0:00:57
81000 -- (-830.058) (-827.296) [-828.756] (-827.211) * [-826.873] (-827.106) (-827.208) (-826.934) -- 0:00:56
81500 -- (-829.162) (-831.047) (-829.339) [-828.416] * (-826.891) [-827.740] (-828.670) (-829.159) -- 0:00:56
82000 -- (-828.777) (-831.647) (-828.149) [-827.724] * [-828.837] (-828.222) (-829.932) (-827.045) -- 0:00:55
82500 -- (-827.526) (-829.897) (-827.559) [-828.354] * [-827.855] (-829.698) (-827.961) (-827.623) -- 0:00:55
83000 -- (-829.234) (-830.970) [-827.975] (-832.354) * (-833.394) (-828.866) [-828.613] (-828.692) -- 0:00:55
83500 -- [-828.254] (-830.996) (-827.918) (-829.636) * (-829.806) (-828.492) [-827.349] (-829.803) -- 0:00:54
84000 -- (-830.599) (-829.521) [-828.756] (-830.685) * (-831.538) (-828.254) [-828.138] (-828.423) -- 0:00:54
84500 -- (-831.483) (-827.366) [-827.250] (-832.618) * (-829.004) (-828.241) [-827.320] (-826.922) -- 0:00:54
85000 -- (-827.985) (-830.467) (-827.837) [-829.199] * (-829.442) (-829.368) (-828.281) [-827.387] -- 0:00:53
Average standard deviation of split frequencies: 0.032066
85500 -- (-830.661) (-831.552) [-831.214] (-832.129) * (-833.187) [-828.389] (-830.023) (-828.143) -- 0:00:53
86000 -- [-827.974] (-830.676) (-828.622) (-838.803) * (-829.874) [-832.936] (-829.202) (-829.357) -- 0:00:53
86500 -- (-828.474) (-829.291) [-829.195] (-828.654) * [-830.231] (-831.593) (-827.865) (-833.177) -- 0:00:52
87000 -- (-832.737) [-828.411] (-829.374) (-827.257) * (-829.748) (-831.737) [-829.676] (-836.529) -- 0:00:52
87500 -- [-830.474] (-831.473) (-831.089) (-828.180) * (-831.988) [-827.766] (-828.059) (-830.963) -- 0:00:52
88000 -- [-827.723] (-828.812) (-831.280) (-829.763) * [-829.521] (-830.765) (-834.121) (-829.948) -- 0:00:51
88500 -- (-827.496) (-832.334) (-831.204) [-830.953] * (-830.318) (-827.960) [-831.124] (-829.364) -- 0:00:51
89000 -- (-828.676) (-831.105) (-829.700) [-829.868] * (-827.819) (-830.566) [-826.905] (-829.290) -- 0:00:51
89500 -- (-829.087) [-830.515] (-829.986) (-833.399) * (-828.055) (-829.862) [-826.737] (-830.168) -- 0:00:50
90000 -- (-829.187) [-828.193] (-832.585) (-827.490) * (-828.024) (-829.860) (-828.190) [-828.324] -- 0:00:50
Average standard deviation of split frequencies: 0.034206
90500 -- (-832.656) (-828.266) [-830.296] (-827.674) * [-828.125] (-827.378) (-827.727) (-827.780) -- 0:00:50
91000 -- (-827.993) (-828.478) [-831.246] (-828.467) * [-828.125] (-827.583) (-827.417) (-827.694) -- 0:00:49
91500 -- (-831.779) (-830.066) [-828.540] (-828.539) * [-827.303] (-827.222) (-829.210) (-829.246) -- 0:00:49
92000 -- [-831.414] (-828.386) (-829.030) (-829.526) * (-829.615) (-828.433) (-829.473) [-828.972] -- 0:00:49
92500 -- (-831.821) [-828.737] (-830.602) (-829.759) * [-828.062] (-829.234) (-828.043) (-832.018) -- 0:00:49
93000 -- (-837.903) (-831.343) (-829.502) [-828.227] * (-827.973) [-828.515] (-830.935) (-829.707) -- 0:00:48
93500 -- (-836.211) [-830.389] (-829.472) (-830.310) * (-828.211) (-829.028) (-829.294) [-829.036] -- 0:00:48
94000 -- (-829.073) [-828.143] (-827.824) (-832.702) * (-831.681) (-833.392) [-827.507] (-832.793) -- 0:00:48
94500 -- (-830.184) [-829.855] (-827.313) (-833.466) * [-829.945] (-830.699) (-829.768) (-829.511) -- 0:00:47
95000 -- (-831.053) (-827.957) [-831.029] (-828.436) * (-829.689) (-827.913) [-831.952] (-829.399) -- 0:00:57
Average standard deviation of split frequencies: 0.030238
95500 -- [-828.575] (-827.279) (-829.409) (-832.236) * (-827.580) (-829.695) [-833.083] (-834.988) -- 0:00:56
96000 -- (-827.547) (-826.759) [-831.521] (-828.990) * (-829.001) [-828.962] (-829.759) (-828.977) -- 0:00:56
96500 -- (-827.253) (-830.522) (-827.618) [-827.579] * [-828.449] (-828.415) (-828.112) (-830.526) -- 0:00:56
97000 -- (-831.112) (-830.897) [-828.226] (-828.277) * [-827.965] (-828.565) (-828.041) (-828.839) -- 0:00:55
97500 -- (-829.651) (-828.845) (-833.308) [-828.722] * (-828.375) [-826.876] (-830.051) (-831.570) -- 0:00:55
98000 -- [-830.634] (-827.970) (-828.882) (-831.297) * (-829.483) [-828.218] (-829.453) (-830.498) -- 0:00:55
98500 -- [-827.239] (-828.110) (-830.994) (-827.081) * (-827.923) (-827.166) (-830.860) [-832.018] -- 0:00:54
99000 -- (-828.365) (-828.680) [-827.895] (-827.856) * (-829.435) (-828.965) [-830.348] (-831.141) -- 0:00:54
99500 -- (-827.972) (-829.761) (-831.986) [-827.673] * (-828.438) (-830.171) (-836.215) [-827.281] -- 0:00:54
100000 -- [-829.729] (-828.802) (-831.598) (-830.451) * (-830.006) [-828.439] (-832.780) (-828.662) -- 0:00:54
Average standard deviation of split frequencies: 0.025632
100500 -- (-828.455) (-827.292) [-831.902] (-831.153) * (-829.556) [-829.336] (-827.762) (-828.008) -- 0:00:53
101000 -- (-827.668) (-828.480) [-828.885] (-829.404) * [-829.079] (-827.602) (-827.831) (-829.146) -- 0:00:53
101500 -- (-826.938) (-828.782) (-827.893) [-828.365] * [-827.469] (-832.357) (-827.447) (-827.097) -- 0:00:53
102000 -- (-827.272) (-829.069) (-829.069) [-827.266] * (-828.873) (-830.202) (-827.876) [-830.055] -- 0:00:52
102500 -- (-828.854) (-828.534) (-827.668) [-830.008] * (-829.938) (-830.948) [-828.049] (-829.239) -- 0:00:52
103000 -- (-830.283) (-827.507) [-828.855] (-827.330) * (-831.813) (-829.884) [-827.684] (-829.218) -- 0:00:52
103500 -- (-827.079) (-827.350) (-829.165) [-830.460] * (-830.361) (-828.253) [-827.449] (-829.440) -- 0:00:51
104000 -- [-828.157] (-827.966) (-829.198) (-828.480) * (-831.656) (-827.953) [-827.122] (-826.954) -- 0:00:51
104500 -- [-826.842] (-833.811) (-827.551) (-827.815) * (-832.258) (-831.014) [-828.867] (-827.489) -- 0:00:51
105000 -- (-829.013) [-828.611] (-831.532) (-827.435) * (-832.663) (-827.920) [-828.961] (-829.237) -- 0:00:51
Average standard deviation of split frequencies: 0.022704
105500 -- (-828.524) (-829.969) (-829.979) [-828.456] * [-828.472] (-827.221) (-827.348) (-829.542) -- 0:00:50
106000 -- (-828.783) [-827.619] (-828.019) (-829.481) * [-830.177] (-828.015) (-827.557) (-832.896) -- 0:00:50
106500 -- (-827.780) (-827.749) [-831.492] (-831.904) * [-832.953] (-828.470) (-829.224) (-830.831) -- 0:00:50
107000 -- (-828.269) [-827.664] (-831.077) (-828.966) * (-830.207) (-828.580) (-828.718) [-828.184] -- 0:00:50
107500 -- (-828.800) (-829.713) (-829.340) [-828.463] * (-829.785) [-828.648] (-829.174) (-828.706) -- 0:00:49
108000 -- (-832.145) (-827.537) (-828.399) [-828.712] * (-829.759) [-827.682] (-827.820) (-826.930) -- 0:00:49
108500 -- (-831.512) (-827.885) [-829.380] (-827.976) * [-828.244] (-830.817) (-830.641) (-827.407) -- 0:00:49
109000 -- [-827.466] (-830.469) (-829.794) (-828.689) * (-828.043) (-836.230) (-828.705) [-828.866] -- 0:00:49
109500 -- (-827.209) [-827.384] (-828.647) (-827.295) * (-829.842) (-833.444) (-827.883) [-831.484] -- 0:00:48
110000 -- (-827.754) [-828.264] (-828.962) (-827.625) * [-827.697] (-829.496) (-829.125) (-827.775) -- 0:00:48
Average standard deviation of split frequencies: 0.020850
110500 -- (-826.894) [-827.689] (-830.586) (-829.316) * [-828.550] (-829.839) (-831.537) (-828.180) -- 0:00:48
111000 -- (-828.879) (-829.746) (-831.721) [-829.568] * (-829.825) [-829.520] (-831.103) (-829.539) -- 0:00:48
111500 -- (-830.424) (-834.261) [-828.014] (-828.186) * (-828.334) (-830.533) [-828.334] (-829.481) -- 0:00:47
112000 -- (-833.018) (-829.479) (-827.451) [-826.623] * [-828.601] (-827.996) (-828.613) (-829.123) -- 0:00:55
112500 -- (-832.870) (-829.475) [-829.609] (-827.808) * (-830.181) (-832.472) (-827.817) [-827.083] -- 0:00:55
113000 -- (-830.070) (-834.669) (-831.771) [-828.309] * (-829.396) [-831.724] (-831.305) (-833.098) -- 0:00:54
113500 -- (-829.897) (-829.040) (-827.649) [-828.726] * (-827.869) (-828.484) (-827.299) [-830.643] -- 0:00:54
114000 -- (-829.486) (-831.004) (-829.094) [-830.602] * (-828.834) (-829.047) [-829.168] (-828.611) -- 0:00:54
114500 -- (-828.087) (-827.917) (-827.861) [-829.890] * (-828.719) [-832.393] (-829.604) (-827.778) -- 0:00:54
115000 -- (-828.238) (-828.408) (-834.850) [-827.494] * (-829.613) (-829.470) [-828.603] (-829.650) -- 0:00:53
Average standard deviation of split frequencies: 0.020533
115500 -- (-834.325) [-832.375] (-830.020) (-827.659) * (-828.600) (-832.033) (-828.663) [-828.489] -- 0:00:53
116000 -- (-830.703) (-831.561) [-829.395] (-830.953) * (-827.144) (-829.235) (-827.540) [-828.128] -- 0:00:53
116500 -- (-827.664) [-832.097] (-830.035) (-831.714) * (-830.923) [-828.505] (-828.758) (-830.269) -- 0:00:53
117000 -- [-832.116] (-833.735) (-830.195) (-831.569) * (-831.360) (-828.301) [-828.285] (-832.881) -- 0:00:52
117500 -- (-830.812) (-827.415) [-829.889] (-828.533) * (-828.118) (-827.954) (-828.192) [-830.543] -- 0:00:52
118000 -- (-829.308) (-826.965) (-827.848) [-827.126] * (-829.933) [-829.105] (-828.110) (-832.045) -- 0:00:52
118500 -- (-827.218) [-827.500] (-827.893) (-827.378) * [-829.603] (-827.811) (-828.743) (-830.334) -- 0:00:52
119000 -- (-831.196) [-828.016] (-827.517) (-828.806) * (-831.238) [-827.606] (-831.845) (-828.180) -- 0:00:51
119500 -- (-831.017) [-828.641] (-828.494) (-828.190) * (-827.805) [-828.005] (-828.031) (-829.185) -- 0:00:51
120000 -- (-830.454) [-828.058] (-828.457) (-828.191) * (-830.996) [-834.367] (-830.156) (-829.536) -- 0:00:51
Average standard deviation of split frequencies: 0.023210
120500 -- (-828.917) (-830.809) [-831.507] (-828.405) * (-827.373) [-829.983] (-829.315) (-828.536) -- 0:00:51
121000 -- (-828.276) (-829.720) (-828.060) [-827.650] * [-832.568] (-830.821) (-829.264) (-831.180) -- 0:00:50
121500 -- (-830.718) [-827.860] (-829.033) (-827.966) * [-829.710] (-829.554) (-829.453) (-828.475) -- 0:00:50
122000 -- (-833.551) [-828.812] (-829.308) (-831.633) * [-829.022] (-829.582) (-829.694) (-830.006) -- 0:00:50
122500 -- (-831.106) (-827.719) [-832.283] (-829.268) * [-827.783] (-828.636) (-829.188) (-828.581) -- 0:00:50
123000 -- [-831.527] (-830.872) (-828.273) (-829.772) * (-831.552) [-831.028] (-829.722) (-829.610) -- 0:00:49
123500 -- (-828.905) (-828.409) [-829.165] (-829.288) * (-827.196) (-828.618) [-828.876] (-831.652) -- 0:00:49
124000 -- (-828.239) (-830.441) [-829.781] (-827.478) * (-830.312) [-827.437] (-828.141) (-828.752) -- 0:00:49
124500 -- (-829.518) (-827.369) [-830.768] (-827.914) * (-828.985) (-827.305) [-827.185] (-828.776) -- 0:00:49
125000 -- [-826.627] (-827.843) (-830.241) (-829.339) * [-827.992] (-830.156) (-828.802) (-829.201) -- 0:00:49
Average standard deviation of split frequencies: 0.020488
125500 -- [-826.932] (-828.165) (-830.302) (-830.516) * [-828.425] (-832.457) (-830.843) (-827.343) -- 0:00:48
126000 -- [-826.920] (-828.369) (-833.758) (-827.696) * [-827.491] (-829.886) (-828.099) (-828.058) -- 0:00:48
126500 -- (-827.538) [-829.009] (-827.497) (-828.870) * (-828.503) (-829.047) [-830.096] (-827.934) -- 0:00:48
127000 -- [-827.041] (-828.119) (-827.982) (-831.594) * (-829.388) (-828.757) (-829.927) [-833.168] -- 0:00:48
127500 -- (-828.771) (-829.688) (-829.871) [-828.854] * (-831.673) (-828.666) [-828.605] (-832.377) -- 0:00:47
128000 -- (-828.847) (-829.921) (-828.241) [-827.157] * (-828.810) (-830.296) [-828.562] (-827.675) -- 0:00:47
128500 -- [-827.131] (-829.329) (-828.638) (-827.266) * (-828.840) (-830.872) (-828.946) [-827.674] -- 0:00:54
129000 -- (-827.798) (-829.099) (-832.251) [-827.264] * [-827.587] (-827.287) (-827.853) (-830.454) -- 0:00:54
129500 -- (-827.269) (-828.203) [-828.576] (-827.513) * (-828.635) [-828.267] (-828.369) (-829.465) -- 0:00:53
130000 -- [-832.246] (-828.557) (-829.517) (-830.876) * [-827.901] (-830.017) (-828.102) (-831.780) -- 0:00:53
Average standard deviation of split frequencies: 0.020787
130500 -- (-827.151) (-830.107) (-829.425) [-836.019] * (-829.532) (-830.221) [-827.704] (-829.752) -- 0:00:53
131000 -- (-831.467) [-831.478] (-828.255) (-832.562) * (-827.581) (-831.648) [-826.877] (-830.169) -- 0:00:53
131500 -- (-828.663) [-830.157] (-832.270) (-829.335) * [-828.007] (-828.427) (-828.759) (-829.814) -- 0:00:52
132000 -- (-830.812) [-829.812] (-832.102) (-829.495) * (-829.046) (-829.668) [-828.368] (-830.729) -- 0:00:52
132500 -- [-832.169] (-830.510) (-831.396) (-827.595) * [-828.723] (-829.733) (-827.381) (-832.967) -- 0:00:52
133000 -- (-828.823) (-828.620) [-828.659] (-826.741) * (-827.622) (-828.322) (-828.271) [-834.088] -- 0:00:52
133500 -- (-830.329) [-828.820] (-830.465) (-828.291) * (-828.698) (-830.056) (-827.738) [-831.115] -- 0:00:51
134000 -- [-829.514] (-827.757) (-828.382) (-832.917) * (-827.014) [-829.218] (-832.311) (-827.791) -- 0:00:51
134500 -- (-827.523) [-828.994] (-829.499) (-830.517) * (-826.969) (-828.584) [-832.179] (-828.381) -- 0:00:51
135000 -- (-828.048) (-829.053) (-828.163) [-828.768] * (-828.351) [-828.933] (-828.043) (-831.252) -- 0:00:51
Average standard deviation of split frequencies: 0.019411
135500 -- (-827.956) [-829.945] (-828.163) (-828.653) * (-829.450) [-828.821] (-828.040) (-828.048) -- 0:00:51
136000 -- (-828.250) [-831.021] (-828.292) (-830.008) * (-829.245) (-827.023) [-828.954] (-831.711) -- 0:00:50
136500 -- (-830.926) (-827.616) (-829.717) [-827.666] * (-829.214) (-830.587) [-827.175] (-826.786) -- 0:00:50
137000 -- (-829.864) (-829.100) (-829.761) [-829.297] * (-828.422) [-827.149] (-826.904) (-827.666) -- 0:00:50
137500 -- (-829.012) (-829.242) [-828.912] (-833.513) * (-827.584) (-827.921) [-829.081] (-828.872) -- 0:00:50
138000 -- (-833.017) (-828.272) [-830.027] (-830.290) * (-830.421) [-828.114] (-827.691) (-829.139) -- 0:00:49
138500 -- [-828.588] (-831.972) (-830.562) (-832.278) * [-829.171] (-827.248) (-832.421) (-829.567) -- 0:00:49
139000 -- (-830.328) (-830.878) [-828.812] (-829.132) * (-835.463) (-826.985) [-830.846] (-829.175) -- 0:00:49
139500 -- (-827.909) (-832.926) [-830.970] (-828.336) * [-834.239] (-828.063) (-828.129) (-838.110) -- 0:00:49
140000 -- [-827.533] (-834.201) (-829.938) (-827.798) * [-829.786] (-831.090) (-828.930) (-829.772) -- 0:00:49
Average standard deviation of split frequencies: 0.020813
140500 -- [-829.321] (-828.092) (-836.044) (-827.872) * [-827.125] (-829.121) (-831.379) (-827.289) -- 0:00:48
141000 -- (-832.617) [-827.408] (-828.467) (-829.529) * [-828.842] (-829.534) (-827.935) (-827.776) -- 0:00:48
141500 -- (-834.177) [-829.736] (-828.495) (-831.100) * (-828.974) (-828.594) (-830.643) [-829.233] -- 0:00:48
142000 -- (-828.527) (-829.895) (-829.108) [-830.480] * (-831.015) (-827.223) [-829.950] (-830.032) -- 0:00:48
142500 -- [-829.130] (-828.176) (-827.487) (-828.744) * (-828.524) (-829.823) (-829.541) [-830.776] -- 0:00:48
143000 -- (-828.859) (-831.422) [-827.193] (-830.350) * [-829.369] (-828.364) (-831.593) (-827.614) -- 0:00:47
143500 -- (-827.872) [-828.854] (-827.754) (-829.359) * (-829.459) (-829.996) [-827.822] (-829.325) -- 0:00:47
144000 -- (-830.123) (-827.105) (-828.153) [-829.306] * (-829.488) (-833.129) (-827.873) [-829.997] -- 0:00:47
144500 -- (-827.891) (-832.045) [-828.570] (-828.900) * (-829.586) [-827.693] (-830.156) (-832.012) -- 0:00:47
145000 -- (-832.474) (-828.495) [-827.703] (-830.968) * [-827.480] (-830.647) (-830.465) (-827.716) -- 0:00:53
Average standard deviation of split frequencies: 0.020449
145500 -- (-830.695) (-827.647) (-827.815) [-827.870] * [-827.246] (-830.015) (-831.539) (-828.224) -- 0:00:52
146000 -- [-830.034] (-827.943) (-828.215) (-827.667) * [-828.299] (-830.291) (-830.915) (-830.081) -- 0:00:52
146500 -- (-829.090) (-832.087) (-830.311) [-827.290] * (-829.758) [-828.060] (-835.843) (-835.925) -- 0:00:52
147000 -- (-828.432) [-827.560] (-829.540) (-828.838) * [-829.621] (-828.635) (-832.832) (-830.178) -- 0:00:52
147500 -- (-829.093) (-827.798) (-827.228) [-827.475] * (-828.544) [-829.224] (-828.093) (-833.447) -- 0:00:52
148000 -- [-827.580] (-830.165) (-828.837) (-828.639) * [-827.578] (-830.310) (-829.634) (-831.730) -- 0:00:51
148500 -- (-827.787) [-827.495] (-827.864) (-830.369) * [-830.149] (-829.046) (-830.502) (-828.436) -- 0:00:51
149000 -- [-827.093] (-828.673) (-830.127) (-831.553) * (-831.353) (-831.678) [-829.838] (-828.478) -- 0:00:51
149500 -- [-827.217] (-828.207) (-829.734) (-829.265) * (-830.660) [-830.543] (-827.185) (-829.881) -- 0:00:51
150000 -- (-827.229) (-828.844) [-829.589] (-827.793) * (-830.248) (-828.486) [-831.501] (-833.236) -- 0:00:51
Average standard deviation of split frequencies: 0.021119
150500 -- (-833.121) (-828.323) (-828.380) [-828.123] * (-830.888) [-829.308] (-828.061) (-832.649) -- 0:00:50
151000 -- (-826.723) [-829.809] (-828.768) (-829.779) * (-827.514) (-828.833) (-829.709) [-830.796] -- 0:00:50
151500 -- (-827.438) (-829.334) (-832.136) [-829.779] * (-828.917) (-833.173) (-829.960) [-828.061] -- 0:00:50
152000 -- [-826.838] (-830.112) (-829.860) (-829.385) * [-827.892] (-830.304) (-828.174) (-827.793) -- 0:00:50
152500 -- (-827.828) (-828.997) (-827.996) [-829.960] * (-829.654) (-830.762) [-826.809] (-829.294) -- 0:00:50
153000 -- (-827.665) (-827.277) [-828.071] (-827.816) * [-828.889] (-829.731) (-827.307) (-830.084) -- 0:00:49
153500 -- (-828.303) [-829.294] (-827.408) (-827.958) * (-827.722) (-829.328) [-831.667] (-830.223) -- 0:00:49
154000 -- (-826.863) (-829.408) (-828.550) [-827.501] * (-829.986) (-827.637) (-829.614) [-829.333] -- 0:00:49
154500 -- (-827.179) (-828.090) [-831.918] (-829.698) * [-831.216] (-827.405) (-830.564) (-827.814) -- 0:00:49
155000 -- (-827.587) (-827.751) (-829.117) [-830.478] * [-828.677] (-831.376) (-828.738) (-831.905) -- 0:00:49
Average standard deviation of split frequencies: 0.023503
155500 -- (-830.074) [-827.839] (-831.640) (-828.083) * [-829.612] (-831.282) (-830.717) (-829.666) -- 0:00:48
156000 -- (-828.197) (-828.554) (-829.838) [-828.598] * [-831.706] (-827.716) (-828.266) (-829.058) -- 0:00:48
156500 -- (-828.222) (-828.360) (-829.598) [-828.143] * [-827.394] (-829.978) (-832.975) (-829.018) -- 0:00:48
157000 -- (-832.266) (-830.979) (-827.975) [-827.377] * (-832.849) (-832.546) [-829.513] (-827.874) -- 0:00:48
157500 -- (-829.552) (-827.200) [-828.774] (-829.589) * (-834.441) (-829.444) [-827.012] (-827.568) -- 0:00:48
158000 -- [-829.470] (-830.212) (-828.687) (-827.883) * (-831.658) (-829.226) [-827.284] (-830.675) -- 0:00:47
158500 -- (-829.389) (-830.077) (-829.385) [-829.441] * (-834.480) [-829.217] (-829.551) (-831.269) -- 0:00:47
159000 -- [-829.295] (-828.624) (-827.604) (-829.179) * (-837.604) (-828.967) (-830.248) [-829.232] -- 0:00:47
159500 -- [-830.049] (-832.190) (-830.609) (-828.665) * [-829.684] (-829.132) (-829.648) (-829.197) -- 0:00:47
160000 -- (-833.747) [-832.606] (-833.590) (-829.520) * (-828.959) (-829.789) (-828.087) [-827.478] -- 0:00:47
Average standard deviation of split frequencies: 0.022005
160500 -- (-835.277) (-831.089) (-830.010) [-829.949] * [-827.866] (-828.397) (-830.929) (-829.410) -- 0:00:47
161000 -- (-830.014) (-827.596) [-829.937] (-830.440) * (-829.725) (-832.500) (-830.211) [-831.222] -- 0:00:46
161500 -- (-828.943) (-828.424) (-831.438) [-828.648] * (-827.601) [-832.356] (-828.665) (-831.097) -- 0:00:51
162000 -- [-830.710] (-830.409) (-828.018) (-827.770) * [-831.606] (-833.234) (-833.614) (-830.320) -- 0:00:51
162500 -- (-831.117) (-830.203) (-828.244) [-826.924] * (-829.026) (-831.009) [-830.206] (-828.739) -- 0:00:51
163000 -- [-829.999] (-827.967) (-830.083) (-828.279) * (-830.782) (-828.157) [-828.581] (-828.235) -- 0:00:51
163500 -- [-830.748] (-828.162) (-832.345) (-834.613) * [-828.097] (-830.311) (-828.443) (-830.520) -- 0:00:51
164000 -- [-827.503] (-828.025) (-828.493) (-827.865) * [-827.939] (-828.361) (-829.651) (-828.092) -- 0:00:50
164500 -- [-830.214] (-827.643) (-828.222) (-829.657) * (-828.153) [-828.908] (-828.485) (-828.822) -- 0:00:50
165000 -- (-829.987) [-831.172] (-831.172) (-828.309) * [-827.818] (-827.984) (-830.991) (-832.752) -- 0:00:50
Average standard deviation of split frequencies: 0.018533
165500 -- [-829.225] (-830.900) (-834.715) (-828.644) * (-826.888) [-827.413] (-832.710) (-828.478) -- 0:00:50
166000 -- (-828.491) (-829.913) [-828.441] (-830.751) * (-827.380) (-833.560) [-831.362] (-827.708) -- 0:00:50
166500 -- (-831.775) (-832.242) (-827.035) [-830.870] * (-827.747) (-830.698) [-831.288] (-828.602) -- 0:00:50
167000 -- (-831.595) (-827.472) (-828.405) [-828.249] * [-827.746] (-829.572) (-830.472) (-830.887) -- 0:00:49
167500 -- (-831.352) (-829.221) [-827.567] (-828.382) * (-829.464) (-834.415) (-827.370) [-829.338] -- 0:00:49
168000 -- [-830.630] (-830.423) (-830.515) (-829.059) * [-830.446] (-828.845) (-827.636) (-831.170) -- 0:00:49
168500 -- (-833.314) [-831.125] (-831.534) (-829.011) * [-827.064] (-828.940) (-827.155) (-827.254) -- 0:00:49
169000 -- [-828.209] (-833.036) (-829.080) (-828.224) * (-830.831) (-828.265) [-827.159] (-827.962) -- 0:00:49
169500 -- (-827.130) (-828.931) [-828.091] (-831.478) * (-828.451) (-829.952) [-829.130] (-829.051) -- 0:00:48
170000 -- [-832.230] (-828.486) (-827.658) (-827.128) * [-827.132] (-828.099) (-829.859) (-829.573) -- 0:00:48
Average standard deviation of split frequencies: 0.019949
170500 -- (-831.439) (-827.489) [-829.364] (-827.735) * [-828.078] (-832.298) (-829.461) (-828.462) -- 0:00:48
171000 -- (-830.978) [-827.632] (-828.688) (-830.919) * (-828.120) (-827.966) (-829.318) [-828.642] -- 0:00:48
171500 -- (-830.923) (-826.921) [-830.575] (-829.392) * (-830.394) (-830.608) (-832.372) [-828.522] -- 0:00:48
172000 -- [-832.008] (-828.849) (-828.674) (-829.485) * (-828.767) [-828.969] (-827.806) (-827.922) -- 0:00:48
172500 -- (-828.797) [-827.438] (-827.969) (-831.078) * (-833.921) [-827.372] (-830.321) (-828.319) -- 0:00:47
173000 -- [-830.380] (-827.475) (-830.882) (-827.415) * (-834.762) [-828.639] (-831.798) (-829.913) -- 0:00:47
173500 -- [-827.474] (-827.475) (-828.948) (-832.165) * [-827.841] (-827.983) (-828.565) (-832.404) -- 0:00:47
174000 -- [-828.713] (-829.267) (-829.128) (-828.888) * [-828.709] (-827.705) (-828.780) (-828.023) -- 0:00:47
174500 -- [-829.176] (-831.378) (-828.235) (-829.067) * [-829.071] (-829.752) (-829.174) (-827.072) -- 0:00:47
175000 -- (-829.634) (-832.032) (-830.932) [-827.349] * (-831.065) [-828.478] (-828.634) (-827.642) -- 0:00:47
Average standard deviation of split frequencies: 0.017480
175500 -- [-829.769] (-830.978) (-828.146) (-829.317) * (-833.982) (-829.937) [-829.100] (-829.501) -- 0:00:46
176000 -- (-828.107) [-829.567] (-830.344) (-828.613) * (-831.083) [-828.077] (-828.795) (-827.258) -- 0:00:46
176500 -- [-828.414] (-831.095) (-827.666) (-834.246) * (-832.626) (-828.081) [-826.810] (-828.682) -- 0:00:46
177000 -- (-827.168) (-829.481) (-829.822) [-828.553] * (-832.111) (-827.322) (-828.258) [-828.016] -- 0:00:46
177500 -- (-830.715) (-829.688) (-831.977) [-831.755] * (-831.772) (-827.379) (-828.392) [-827.694] -- 0:00:46
178000 -- (-833.799) [-829.780] (-831.966) (-831.523) * [-831.525] (-828.144) (-827.932) (-832.209) -- 0:00:50
178500 -- [-832.604] (-827.451) (-830.724) (-832.976) * (-832.157) [-828.602] (-830.046) (-830.829) -- 0:00:50
179000 -- [-828.181] (-827.892) (-827.202) (-829.852) * (-827.943) (-829.574) (-830.009) [-829.833] -- 0:00:50
179500 -- [-829.948] (-831.220) (-827.316) (-827.638) * (-829.232) [-830.995] (-827.809) (-829.390) -- 0:00:50
180000 -- (-829.010) (-829.238) [-827.471] (-829.785) * (-828.802) (-831.677) (-828.319) [-834.035] -- 0:00:50
Average standard deviation of split frequencies: 0.016815
180500 -- (-829.095) (-828.154) [-831.019] (-831.360) * [-827.641] (-830.359) (-827.809) (-827.614) -- 0:00:49
181000 -- [-828.652] (-832.608) (-830.149) (-832.019) * (-827.272) (-831.662) [-828.048] (-828.443) -- 0:00:49
181500 -- (-828.794) (-829.073) [-829.325] (-827.788) * (-829.085) (-827.475) (-828.047) [-827.412] -- 0:00:49
182000 -- [-831.158] (-828.263) (-830.322) (-828.467) * [-829.775] (-829.952) (-829.118) (-830.688) -- 0:00:49
182500 -- [-827.864] (-827.280) (-827.407) (-830.566) * (-828.648) (-829.109) [-828.957] (-829.224) -- 0:00:49
183000 -- [-828.551] (-827.436) (-829.923) (-828.776) * [-827.089] (-827.338) (-828.332) (-829.628) -- 0:00:49
183500 -- [-828.723] (-829.298) (-827.319) (-829.142) * [-826.934] (-827.177) (-830.169) (-835.091) -- 0:00:48
184000 -- [-828.304] (-831.436) (-828.190) (-832.704) * [-827.879] (-828.919) (-833.230) (-830.213) -- 0:00:48
184500 -- (-827.922) [-829.509] (-831.854) (-828.855) * (-828.695) (-827.871) (-834.689) [-829.831] -- 0:00:48
185000 -- (-828.114) (-830.084) [-828.580] (-828.338) * (-831.352) (-830.883) (-827.148) [-829.454] -- 0:00:48
Average standard deviation of split frequencies: 0.018408
185500 -- (-829.431) (-827.968) [-827.740] (-828.762) * [-828.196] (-828.140) (-830.442) (-829.577) -- 0:00:48
186000 -- (-829.217) (-831.852) (-829.528) [-827.634] * (-830.632) (-830.085) (-827.502) [-828.252] -- 0:00:48
186500 -- (-830.871) (-830.198) (-828.089) [-828.010] * (-829.934) (-828.344) [-828.822] (-827.592) -- 0:00:47
187000 -- (-830.968) (-831.360) [-827.073] (-828.631) * [-829.399] (-830.111) (-832.235) (-830.998) -- 0:00:47
187500 -- (-829.246) (-829.156) (-830.373) [-829.872] * (-830.225) (-828.516) [-827.549] (-828.487) -- 0:00:47
188000 -- (-827.879) (-829.888) [-829.183] (-830.209) * [-827.545] (-832.880) (-826.914) (-833.046) -- 0:00:47
188500 -- (-831.456) (-830.196) (-827.205) [-828.316] * [-828.134] (-829.735) (-827.665) (-829.193) -- 0:00:47
189000 -- (-831.448) [-828.750] (-828.994) (-830.711) * (-827.658) (-829.037) [-831.761] (-827.709) -- 0:00:47
189500 -- (-830.445) (-831.530) (-833.848) [-832.744] * [-832.103] (-827.543) (-827.336) (-828.129) -- 0:00:47
190000 -- (-829.844) (-832.313) (-833.136) [-833.534] * (-828.605) [-827.526] (-827.019) (-831.261) -- 0:00:46
Average standard deviation of split frequencies: 0.016071
190500 -- (-828.727) [-827.591] (-827.770) (-832.863) * (-827.585) (-830.560) (-827.167) [-831.379] -- 0:00:46
191000 -- (-828.742) (-827.191) (-828.580) [-829.274] * (-827.803) (-828.276) [-828.472] (-828.201) -- 0:00:46
191500 -- [-829.034] (-830.956) (-828.341) (-833.062) * (-828.257) (-830.877) [-826.896] (-828.573) -- 0:00:46
192000 -- (-829.249) [-827.396] (-830.104) (-830.812) * (-828.223) (-828.286) [-827.179] (-829.138) -- 0:00:46
192500 -- (-832.545) (-827.404) [-828.932] (-829.652) * (-830.158) [-828.237] (-829.135) (-830.181) -- 0:00:46
193000 -- (-827.682) (-828.035) (-828.066) [-827.534] * (-827.059) (-829.039) [-827.308] (-829.467) -- 0:00:45
193500 -- [-827.403] (-828.118) (-828.175) (-827.598) * [-828.035] (-829.103) (-828.478) (-830.639) -- 0:00:45
194000 -- (-827.451) (-827.634) (-831.635) [-828.674] * (-828.319) [-829.430] (-827.665) (-829.424) -- 0:00:49
194500 -- (-830.737) (-827.389) [-830.978] (-830.874) * (-831.230) (-829.140) [-829.943] (-827.369) -- 0:00:49
195000 -- (-829.890) (-830.313) (-827.482) [-832.473] * [-828.841] (-829.034) (-831.698) (-828.646) -- 0:00:49
Average standard deviation of split frequencies: 0.016076
195500 -- [-828.458] (-828.104) (-827.481) (-832.201) * (-828.240) [-830.247] (-834.368) (-827.702) -- 0:00:49
196000 -- (-829.964) (-836.137) [-830.586] (-828.611) * (-830.169) (-829.418) [-827.666] (-830.050) -- 0:00:49
196500 -- (-826.856) (-828.085) (-831.093) [-827.659] * (-834.295) (-829.651) [-827.563] (-826.993) -- 0:00:49
197000 -- (-829.772) (-828.937) [-829.319] (-827.689) * (-830.646) [-829.967] (-827.568) (-827.584) -- 0:00:48
197500 -- (-831.933) (-828.389) [-828.405] (-827.950) * [-829.882] (-829.424) (-830.176) (-828.162) -- 0:00:48
198000 -- (-828.185) (-828.902) (-827.527) [-831.027] * (-830.109) [-827.748] (-830.323) (-828.321) -- 0:00:48
198500 -- (-828.584) [-828.168] (-831.256) (-829.398) * [-830.189] (-827.328) (-827.429) (-830.757) -- 0:00:48
199000 -- (-831.733) (-831.077) (-829.677) [-830.023] * [-832.357] (-829.177) (-829.389) (-829.042) -- 0:00:48
199500 -- (-831.817) (-829.206) (-827.372) [-827.752] * (-829.851) (-829.472) [-830.253] (-828.223) -- 0:00:48
200000 -- (-831.228) (-830.796) [-827.519] (-828.315) * [-831.128] (-828.112) (-828.075) (-830.458) -- 0:00:48
Average standard deviation of split frequencies: 0.017358
200500 -- (-828.562) [-827.103] (-827.800) (-827.784) * (-827.331) (-830.019) (-832.851) [-828.023] -- 0:00:47
201000 -- [-827.257] (-828.088) (-828.691) (-829.694) * (-826.686) (-829.311) [-828.393] (-828.247) -- 0:00:47
201500 -- (-827.258) (-828.238) (-829.034) [-828.191] * [-830.364] (-829.276) (-831.895) (-828.063) -- 0:00:47
202000 -- (-830.458) (-828.675) (-829.313) [-827.420] * [-827.187] (-830.425) (-833.223) (-827.314) -- 0:00:47
202500 -- (-831.488) (-828.899) [-829.211] (-828.135) * [-827.546] (-827.167) (-827.703) (-830.578) -- 0:00:47
203000 -- (-827.663) [-828.465] (-829.380) (-828.425) * (-828.042) [-827.043] (-831.720) (-828.217) -- 0:00:47
203500 -- (-828.516) (-828.661) [-827.283] (-827.989) * (-827.727) [-830.308] (-834.036) (-827.364) -- 0:00:46
204000 -- (-827.843) [-828.748] (-828.895) (-827.155) * (-830.412) (-827.259) [-829.103] (-827.271) -- 0:00:46
204500 -- (-828.913) (-828.670) [-827.120] (-828.056) * [-827.451] (-829.130) (-829.887) (-827.975) -- 0:00:46
205000 -- [-828.693] (-828.691) (-826.954) (-829.572) * (-828.215) [-827.101] (-830.072) (-829.604) -- 0:00:46
Average standard deviation of split frequencies: 0.016909
205500 -- (-831.208) (-829.996) [-831.016] (-828.632) * (-827.754) (-827.939) [-827.907] (-830.515) -- 0:00:46
206000 -- [-829.324] (-827.682) (-829.049) (-828.150) * (-830.707) (-829.066) [-827.719] (-830.450) -- 0:00:46
206500 -- (-828.814) (-829.033) (-828.261) [-828.367] * (-828.372) (-828.187) [-828.052] (-827.888) -- 0:00:46
207000 -- (-829.337) (-827.558) (-827.595) [-827.897] * [-827.758] (-835.173) (-827.373) (-828.339) -- 0:00:45
207500 -- (-828.578) (-828.580) [-828.524] (-827.969) * (-829.354) (-830.860) [-828.310] (-827.859) -- 0:00:45
208000 -- [-834.358] (-829.873) (-831.197) (-827.977) * (-829.964) (-829.496) [-827.665] (-832.223) -- 0:00:45
208500 -- (-828.923) (-827.888) [-831.872] (-827.376) * [-827.385] (-828.588) (-830.770) (-827.707) -- 0:00:45
209000 -- [-829.273] (-827.943) (-832.347) (-827.057) * (-828.934) [-831.593] (-828.862) (-827.522) -- 0:00:45
209500 -- (-826.897) (-828.160) [-827.822] (-828.290) * (-830.884) (-829.868) [-829.296] (-829.655) -- 0:00:45
210000 -- (-827.014) (-829.846) (-831.283) [-831.778] * (-830.565) [-829.211] (-829.518) (-831.532) -- 0:00:45
Average standard deviation of split frequencies: 0.016534
210500 -- (-841.144) [-831.991] (-828.275) (-831.384) * (-829.663) (-829.606) (-827.905) [-831.458] -- 0:00:48
211000 -- (-829.890) (-833.863) [-827.523] (-827.131) * [-829.014] (-828.776) (-827.815) (-834.220) -- 0:00:48
211500 -- (-831.895) (-830.170) [-827.767] (-828.317) * [-828.851] (-827.836) (-828.536) (-832.845) -- 0:00:48
212000 -- [-828.252] (-829.956) (-829.020) (-827.607) * (-830.403) (-828.104) (-827.160) [-829.414] -- 0:00:48
212500 -- (-830.342) (-829.559) [-827.263] (-827.491) * [-830.383] (-828.098) (-828.322) (-827.627) -- 0:00:48
213000 -- [-833.111] (-828.104) (-827.886) (-827.465) * (-829.889) [-827.711] (-829.541) (-830.304) -- 0:00:48
213500 -- (-832.127) (-826.876) (-827.890) [-827.963] * (-829.354) (-828.701) (-829.192) [-828.843] -- 0:00:47
214000 -- (-828.745) [-826.830] (-829.187) (-828.823) * (-827.733) [-829.234] (-834.224) (-829.783) -- 0:00:47
214500 -- (-830.809) [-829.309] (-837.107) (-832.575) * (-829.873) (-827.564) (-832.986) [-827.109] -- 0:00:47
215000 -- [-834.570] (-833.071) (-829.606) (-831.935) * (-829.196) [-827.532] (-827.042) (-827.523) -- 0:00:47
Average standard deviation of split frequencies: 0.016770
215500 -- (-833.241) (-830.860) (-828.149) [-829.932] * (-828.451) [-827.067] (-827.624) (-827.589) -- 0:00:47
216000 -- (-829.941) [-830.771] (-829.518) (-833.146) * (-827.194) (-836.175) [-827.783] (-826.805) -- 0:00:47
216500 -- (-828.986) [-830.089] (-829.196) (-829.761) * (-827.652) (-828.380) [-828.954] (-827.311) -- 0:00:47
217000 -- (-832.048) (-833.138) [-828.714] (-829.619) * [-830.963] (-828.421) (-827.706) (-827.658) -- 0:00:46
217500 -- (-833.918) (-829.383) [-828.301] (-828.877) * (-828.801) (-828.562) [-829.125] (-827.416) -- 0:00:46
218000 -- (-830.411) (-828.882) (-829.680) [-827.848] * (-829.911) (-828.834) (-827.688) [-828.361] -- 0:00:46
218500 -- (-829.246) (-827.716) [-834.808] (-827.974) * (-827.483) [-828.829] (-830.663) (-831.927) -- 0:00:46
219000 -- (-827.060) (-829.088) [-829.787] (-828.710) * (-827.814) (-830.221) (-830.832) [-827.151] -- 0:00:46
219500 -- (-829.068) [-833.389] (-829.736) (-829.168) * (-829.016) [-828.506] (-831.276) (-827.524) -- 0:00:46
220000 -- [-827.049] (-828.885) (-829.667) (-831.194) * (-831.027) [-830.120] (-827.944) (-827.440) -- 0:00:46
Average standard deviation of split frequencies: 0.013942
220500 -- (-827.958) [-829.439] (-830.429) (-828.309) * [-829.749] (-831.340) (-828.076) (-827.083) -- 0:00:45
221000 -- (-835.452) (-829.963) (-828.194) [-827.917] * (-826.750) (-827.672) (-828.259) [-828.925] -- 0:00:45
221500 -- (-830.527) (-830.286) [-828.353] (-828.235) * (-828.298) (-829.569) [-828.329] (-827.991) -- 0:00:45
222000 -- (-829.874) (-829.531) (-827.148) [-830.754] * [-827.011] (-830.003) (-828.224) (-827.894) -- 0:00:45
222500 -- (-831.418) (-827.529) [-826.984] (-830.958) * (-829.189) [-829.308] (-830.803) (-827.999) -- 0:00:45
223000 -- [-828.660] (-827.816) (-827.369) (-828.081) * (-830.772) (-829.308) (-832.502) [-829.148] -- 0:00:45
223500 -- (-828.540) [-828.388] (-828.861) (-831.354) * (-831.331) (-827.745) (-829.344) [-827.518] -- 0:00:45
224000 -- (-831.377) (-830.912) (-828.340) [-827.159] * (-827.830) (-828.013) (-828.297) [-827.523] -- 0:00:45
224500 -- [-827.585] (-827.962) (-829.855) (-830.222) * [-827.319] (-833.641) (-828.857) (-829.279) -- 0:00:44
225000 -- (-828.035) [-828.010] (-826.741) (-828.792) * (-827.582) (-828.445) (-827.442) [-830.318] -- 0:00:44
Average standard deviation of split frequencies: 0.016290
225500 -- (-829.727) (-827.123) [-829.584] (-829.793) * (-830.431) (-828.774) [-827.075] (-827.305) -- 0:00:44
226000 -- (-832.139) (-827.771) (-832.986) [-829.654] * (-829.092) (-828.615) (-829.281) [-827.819] -- 0:00:44
226500 -- (-829.818) (-830.157) (-831.090) [-827.855] * [-828.421] (-828.093) (-830.867) (-828.533) -- 0:00:44
227000 -- [-828.868] (-827.140) (-829.625) (-828.356) * (-827.432) (-828.998) (-831.083) [-831.821] -- 0:00:47
227500 -- [-830.947] (-828.945) (-829.703) (-827.020) * (-828.770) [-827.444] (-831.613) (-827.739) -- 0:00:47
228000 -- (-830.177) (-831.344) (-827.369) [-828.615] * [-829.173] (-827.117) (-827.558) (-832.589) -- 0:00:47
228500 -- (-831.362) [-829.471] (-829.715) (-830.021) * (-829.436) [-832.365] (-828.366) (-834.717) -- 0:00:47
229000 -- (-831.042) [-829.341] (-830.318) (-829.750) * (-829.349) (-829.532) (-833.852) [-831.051] -- 0:00:47
229500 -- (-828.862) (-828.375) [-829.284] (-829.559) * [-828.283] (-830.914) (-828.061) (-833.138) -- 0:00:47
230000 -- (-829.476) [-829.467] (-831.104) (-827.083) * (-829.328) (-828.428) (-827.557) [-829.450] -- 0:00:46
Average standard deviation of split frequencies: 0.014521
230500 -- (-830.604) (-827.294) (-828.981) [-827.597] * (-828.712) (-830.698) (-826.860) [-830.551] -- 0:00:46
231000 -- (-829.868) (-831.660) (-829.078) [-827.619] * [-827.933] (-829.619) (-830.379) (-827.129) -- 0:00:46
231500 -- (-829.256) (-828.717) (-829.265) [-828.149] * [-829.095] (-831.979) (-830.017) (-826.943) -- 0:00:46
232000 -- [-827.158] (-827.622) (-829.342) (-827.491) * (-829.818) (-834.489) (-828.741) [-827.857] -- 0:00:46
232500 -- (-831.306) (-826.902) [-830.573] (-827.710) * [-830.583] (-830.355) (-829.482) (-828.312) -- 0:00:46
233000 -- (-829.325) [-827.522] (-830.796) (-829.713) * [-828.862] (-830.519) (-831.075) (-827.057) -- 0:00:46
233500 -- (-829.429) [-829.263] (-831.935) (-831.361) * (-827.929) (-829.123) (-830.763) [-829.109] -- 0:00:45
234000 -- [-829.437] (-828.119) (-829.592) (-829.058) * (-827.778) [-831.677] (-827.772) (-829.555) -- 0:00:45
234500 -- (-829.636) [-828.499] (-830.036) (-828.175) * (-827.428) [-828.524] (-829.165) (-828.448) -- 0:00:45
235000 -- (-829.721) [-831.382] (-830.370) (-828.061) * (-827.326) (-828.268) [-829.871] (-829.536) -- 0:00:45
Average standard deviation of split frequencies: 0.012931
235500 -- (-832.083) (-828.403) (-830.347) [-828.380] * [-828.520] (-827.885) (-827.860) (-828.680) -- 0:00:45
236000 -- (-828.680) [-827.175] (-830.863) (-827.952) * (-832.365) [-834.907] (-827.703) (-830.553) -- 0:00:45
236500 -- (-829.290) [-828.437] (-827.118) (-828.381) * (-833.206) (-827.714) (-828.844) [-828.015] -- 0:00:45
237000 -- [-831.288] (-828.579) (-827.039) (-830.530) * (-827.214) (-828.388) (-830.750) [-831.687] -- 0:00:45
237500 -- (-828.086) (-828.607) (-827.969) [-827.805] * (-827.564) (-828.384) (-829.603) [-828.862] -- 0:00:44
238000 -- (-827.749) (-832.434) (-831.817) [-828.662] * (-827.553) (-828.699) (-828.868) [-828.163] -- 0:00:44
238500 -- (-828.056) [-826.707] (-827.309) (-828.568) * (-828.218) (-830.157) (-828.423) [-827.160] -- 0:00:44
239000 -- [-829.953] (-831.435) (-827.937) (-829.282) * [-828.737] (-830.572) (-828.348) (-833.083) -- 0:00:44
239500 -- (-828.341) [-830.110] (-829.746) (-829.216) * (-828.343) (-828.018) [-828.831] (-829.741) -- 0:00:44
240000 -- (-828.827) (-827.587) [-830.435] (-827.195) * (-828.281) [-827.322] (-827.394) (-830.297) -- 0:00:44
Average standard deviation of split frequencies: 0.012949
240500 -- [-830.119] (-829.120) (-827.620) (-829.434) * (-828.021) [-828.676] (-826.926) (-828.394) -- 0:00:44
241000 -- (-830.221) [-827.833] (-829.671) (-827.263) * (-831.433) [-830.878] (-827.910) (-828.235) -- 0:00:44
241500 -- (-829.732) [-828.462] (-829.151) (-827.846) * (-828.741) (-831.933) (-828.838) [-831.129] -- 0:00:43
242000 -- (-828.939) (-827.680) (-830.437) [-834.203] * (-829.079) (-833.059) [-832.496] (-828.863) -- 0:00:43
242500 -- [-830.536] (-828.715) (-830.197) (-829.293) * (-828.449) (-827.680) (-835.331) [-830.503] -- 0:00:43
243000 -- (-831.951) [-830.199] (-835.700) (-831.327) * (-831.101) [-829.692] (-830.808) (-832.049) -- 0:00:43
243500 -- (-830.095) (-831.410) (-830.537) [-830.404] * [-827.907] (-828.611) (-829.674) (-833.571) -- 0:00:46
244000 -- (-830.856) (-831.765) [-828.024] (-829.768) * (-833.845) (-828.798) (-827.193) [-828.192] -- 0:00:46
244500 -- (-828.557) (-830.431) (-827.506) [-827.631] * (-828.035) (-830.815) [-829.222] (-828.655) -- 0:00:46
245000 -- [-832.365] (-829.816) (-827.265) (-830.000) * (-828.029) (-833.092) [-828.298] (-829.423) -- 0:00:46
Average standard deviation of split frequencies: 0.012839
245500 -- (-830.400) [-828.739] (-828.410) (-828.687) * [-830.347] (-828.771) (-830.083) (-831.813) -- 0:00:46
246000 -- (-835.148) [-828.499] (-827.721) (-829.713) * (-828.468) (-834.887) [-828.697] (-829.258) -- 0:00:45
246500 -- [-829.707] (-829.871) (-828.357) (-831.836) * (-830.288) (-831.565) [-829.076] (-827.111) -- 0:00:45
247000 -- (-828.837) (-830.141) [-830.989] (-828.696) * [-831.038] (-828.766) (-827.583) (-827.496) -- 0:00:45
247500 -- [-831.109] (-829.818) (-828.811) (-827.706) * [-830.967] (-826.801) (-829.390) (-828.265) -- 0:00:45
248000 -- (-830.138) (-830.128) (-832.925) [-828.215] * (-829.615) (-827.818) [-830.119] (-835.949) -- 0:00:45
248500 -- (-828.108) (-828.780) (-828.002) [-828.114] * (-830.806) [-827.065] (-830.573) (-829.858) -- 0:00:45
249000 -- (-827.886) [-830.677] (-828.722) (-827.929) * (-826.858) (-826.912) [-830.097] (-830.951) -- 0:00:45
249500 -- [-827.714] (-830.251) (-828.053) (-827.112) * [-827.840] (-826.972) (-827.520) (-831.644) -- 0:00:45
250000 -- (-828.708) (-829.383) (-827.984) [-827.466] * (-832.433) (-831.799) [-828.959] (-831.215) -- 0:00:45
Average standard deviation of split frequencies: 0.014946
250500 -- (-828.891) [-829.058] (-828.676) (-827.317) * (-829.258) [-827.454] (-830.378) (-833.128) -- 0:00:44
251000 -- (-832.330) (-828.298) [-829.570] (-827.724) * [-827.542] (-832.410) (-834.727) (-831.364) -- 0:00:44
251500 -- (-829.167) (-829.028) (-830.167) [-829.481] * [-829.134] (-829.639) (-827.461) (-829.325) -- 0:00:44
252000 -- [-827.511] (-830.141) (-831.277) (-828.073) * [-827.797] (-835.296) (-830.471) (-827.104) -- 0:00:44
252500 -- [-831.435] (-832.133) (-828.191) (-827.776) * [-831.558] (-828.725) (-830.153) (-827.918) -- 0:00:44
253000 -- (-827.859) (-830.084) [-830.046] (-828.209) * [-828.065] (-831.692) (-827.452) (-827.183) -- 0:00:44
253500 -- (-830.439) [-831.475] (-830.523) (-829.327) * (-830.750) (-830.152) [-830.133] (-829.127) -- 0:00:44
254000 -- [-832.563] (-832.845) (-828.384) (-829.310) * (-831.334) (-829.235) [-831.579] (-833.404) -- 0:00:44
254500 -- [-828.334] (-829.854) (-830.425) (-830.142) * [-828.184] (-831.631) (-833.987) (-832.754) -- 0:00:43
255000 -- [-827.771] (-829.582) (-830.392) (-828.393) * (-828.476) [-828.070] (-832.854) (-828.278) -- 0:00:43
Average standard deviation of split frequencies: 0.014834
255500 -- (-831.616) (-828.774) [-826.952] (-827.110) * (-830.226) (-827.063) (-829.662) [-828.509] -- 0:00:43
256000 -- (-830.036) (-829.453) [-829.026] (-830.981) * (-827.338) [-827.713] (-828.360) (-828.908) -- 0:00:43
256500 -- (-831.102) (-829.602) (-828.131) [-828.571] * (-827.963) [-827.437] (-827.812) (-827.902) -- 0:00:43
257000 -- (-832.654) [-832.364] (-826.675) (-828.579) * (-828.641) (-827.220) [-828.196] (-828.147) -- 0:00:43
257500 -- (-829.334) [-831.552] (-827.604) (-828.632) * (-829.900) [-828.958] (-829.906) (-831.623) -- 0:00:43
258000 -- (-833.158) (-832.741) (-827.223) [-828.946] * (-832.821) (-827.656) (-829.236) [-828.857] -- 0:00:43
258500 -- (-828.677) (-826.763) [-831.184] (-829.622) * [-827.464] (-830.087) (-827.499) (-829.627) -- 0:00:43
259000 -- [-828.383] (-828.126) (-828.840) (-829.823) * [-827.481] (-828.158) (-828.830) (-829.993) -- 0:00:42
259500 -- (-828.777) [-832.779] (-830.609) (-828.840) * [-830.531] (-831.371) (-831.351) (-828.513) -- 0:00:42
260000 -- [-829.236] (-828.461) (-827.645) (-828.419) * (-827.667) (-829.708) [-831.925] (-827.711) -- 0:00:42
Average standard deviation of split frequencies: 0.015638
260500 -- [-826.657] (-828.774) (-828.046) (-829.629) * (-831.042) [-828.494] (-829.955) (-828.319) -- 0:00:45
261000 -- [-828.948] (-833.012) (-827.610) (-827.966) * (-832.506) [-828.128] (-829.522) (-829.986) -- 0:00:45
261500 -- (-832.419) (-831.368) [-828.603] (-827.481) * [-828.508] (-827.642) (-827.438) (-838.620) -- 0:00:45
262000 -- (-831.422) (-827.282) [-827.015] (-832.925) * (-828.891) (-830.491) [-829.166] (-836.651) -- 0:00:45
262500 -- [-828.023] (-828.590) (-831.075) (-828.991) * [-828.685] (-828.851) (-830.204) (-830.449) -- 0:00:44
263000 -- (-828.712) [-827.080] (-830.913) (-829.718) * [-828.435] (-829.462) (-831.045) (-828.723) -- 0:00:44
263500 -- (-827.299) [-826.723] (-830.646) (-831.426) * (-829.712) (-827.158) [-829.694] (-828.558) -- 0:00:44
264000 -- (-827.581) [-832.807] (-829.446) (-829.695) * (-828.604) (-828.376) [-831.997] (-830.195) -- 0:00:44
264500 -- (-828.712) (-830.397) [-827.727] (-830.447) * (-832.258) (-827.491) (-827.150) [-828.394] -- 0:00:44
265000 -- [-828.667] (-832.495) (-829.570) (-828.976) * (-829.522) (-829.669) [-827.778] (-828.437) -- 0:00:44
Average standard deviation of split frequencies: 0.015359
265500 -- [-829.390] (-829.575) (-829.535) (-827.654) * (-829.044) (-830.013) (-829.711) [-827.293] -- 0:00:44
266000 -- (-830.614) (-828.246) [-827.152] (-827.990) * (-830.099) (-832.138) [-828.419] (-827.657) -- 0:00:44
266500 -- (-829.968) [-831.211] (-829.062) (-831.105) * [-830.043] (-828.705) (-832.092) (-827.664) -- 0:00:44
267000 -- (-827.856) [-829.076] (-826.917) (-832.374) * (-829.117) [-828.268] (-827.987) (-826.801) -- 0:00:43
267500 -- (-829.163) (-831.245) [-827.201] (-830.769) * [-827.421] (-833.348) (-828.064) (-827.708) -- 0:00:43
268000 -- [-829.959] (-830.895) (-830.826) (-828.374) * (-828.512) [-833.248] (-827.562) (-828.035) -- 0:00:43
268500 -- (-828.100) (-831.666) (-830.336) [-828.798] * [-828.647] (-831.835) (-827.896) (-828.156) -- 0:00:43
269000 -- (-827.044) (-833.745) (-829.574) [-827.431] * (-828.729) [-830.883] (-828.869) (-827.685) -- 0:00:43
269500 -- (-829.534) [-829.539] (-831.054) (-829.531) * [-829.908] (-828.189) (-829.669) (-828.181) -- 0:00:43
270000 -- (-832.761) (-827.807) [-830.736] (-829.703) * [-827.940] (-827.730) (-833.071) (-828.609) -- 0:00:43
Average standard deviation of split frequencies: 0.015216
270500 -- (-833.083) (-827.150) [-829.142] (-829.430) * (-827.750) (-828.527) (-838.213) [-827.235] -- 0:00:43
271000 -- (-831.344) [-826.834] (-829.282) (-829.024) * (-827.292) (-828.026) [-841.169] (-826.653) -- 0:00:43
271500 -- (-831.866) (-828.108) [-831.483] (-827.334) * (-827.866) [-827.763] (-833.792) (-834.482) -- 0:00:42
272000 -- [-828.616] (-827.786) (-829.064) (-829.099) * (-829.122) (-828.575) (-830.673) [-828.916] -- 0:00:42
272500 -- (-828.680) [-827.061] (-827.992) (-827.672) * (-827.564) (-828.274) [-830.892] (-828.113) -- 0:00:42
273000 -- (-831.385) (-828.038) (-830.783) [-827.103] * (-832.871) (-827.425) [-831.530] (-827.427) -- 0:00:42
273500 -- (-829.737) (-828.060) (-829.605) [-828.393] * [-830.916] (-827.843) (-832.030) (-827.329) -- 0:00:42
274000 -- [-827.857] (-828.082) (-830.191) (-828.358) * (-827.734) (-829.317) [-829.927] (-830.394) -- 0:00:42
274500 -- (-829.140) (-827.960) (-827.716) [-829.298] * [-827.907] (-829.614) (-834.365) (-828.478) -- 0:00:42
275000 -- (-828.785) [-828.210] (-828.986) (-827.792) * [-829.144] (-829.513) (-828.394) (-832.005) -- 0:00:42
Average standard deviation of split frequencies: 0.014743
275500 -- (-827.950) (-828.733) [-826.973] (-828.978) * (-827.637) (-828.017) [-829.443] (-828.463) -- 0:00:42
276000 -- (-829.333) [-828.799] (-828.831) (-828.690) * (-832.285) (-827.655) [-830.248] (-828.506) -- 0:00:41
276500 -- [-830.349] (-831.326) (-833.014) (-829.376) * (-828.720) (-828.482) (-831.005) [-828.811] -- 0:00:41
277000 -- [-827.825] (-827.837) (-832.764) (-828.453) * (-830.324) (-829.132) (-828.087) [-828.865] -- 0:00:44
277500 -- (-830.748) [-827.885] (-826.967) (-832.979) * (-828.674) [-828.178] (-828.604) (-831.218) -- 0:00:44
278000 -- [-827.356] (-828.345) (-826.781) (-828.224) * (-827.765) [-830.063] (-830.119) (-830.754) -- 0:00:44
278500 -- (-827.472) (-832.287) (-829.747) [-831.357] * (-830.485) (-830.622) [-828.838] (-832.723) -- 0:00:44
279000 -- [-828.215] (-830.616) (-827.327) (-828.764) * (-827.078) (-829.165) (-828.475) [-831.372] -- 0:00:43
279500 -- [-828.220] (-832.119) (-828.286) (-828.698) * [-829.751] (-828.291) (-828.032) (-831.293) -- 0:00:43
280000 -- (-827.338) (-832.915) (-829.057) [-828.090] * (-828.319) [-827.451] (-829.896) (-832.066) -- 0:00:43
Average standard deviation of split frequencies: 0.014025
280500 -- (-828.739) (-832.906) [-827.780] (-827.115) * (-827.712) [-827.918] (-827.224) (-830.249) -- 0:00:43
281000 -- (-830.038) (-829.086) [-827.082] (-828.047) * (-829.286) [-831.265] (-827.695) (-831.141) -- 0:00:43
281500 -- (-829.569) (-828.070) (-828.891) [-828.531] * (-833.950) (-831.278) [-827.991] (-829.198) -- 0:00:43
282000 -- (-828.230) (-828.759) [-830.159] (-831.209) * [-827.435] (-831.225) (-830.823) (-831.167) -- 0:00:43
282500 -- (-828.591) [-829.115] (-831.516) (-832.109) * (-829.312) [-827.789] (-829.561) (-828.481) -- 0:00:43
283000 -- (-828.383) (-830.014) [-828.098] (-828.395) * (-827.991) (-832.818) [-827.252] (-829.520) -- 0:00:43
283500 -- (-828.024) (-831.520) [-830.516] (-827.710) * [-828.516] (-827.805) (-829.667) (-831.983) -- 0:00:42
284000 -- (-827.387) [-827.516] (-827.811) (-827.230) * (-830.017) [-827.186] (-828.215) (-828.924) -- 0:00:42
284500 -- [-826.689] (-827.461) (-830.944) (-827.649) * (-828.282) [-830.377] (-835.927) (-828.083) -- 0:00:42
285000 -- [-827.686] (-831.267) (-828.801) (-828.631) * (-829.054) (-836.616) (-828.314) [-830.900] -- 0:00:42
Average standard deviation of split frequencies: 0.014258
285500 -- (-827.442) (-834.714) (-828.293) [-827.439] * (-828.190) (-838.116) [-828.973] (-830.201) -- 0:00:42
286000 -- (-828.760) [-828.626] (-827.613) (-829.840) * [-828.522] (-831.337) (-832.589) (-831.377) -- 0:00:42
286500 -- [-827.270] (-829.583) (-832.214) (-828.997) * (-828.353) (-827.186) [-830.081] (-829.724) -- 0:00:42
287000 -- [-828.648] (-829.241) (-833.869) (-828.055) * (-828.244) (-828.312) (-828.540) [-827.754] -- 0:00:42
287500 -- [-831.316] (-832.784) (-832.250) (-828.392) * (-829.612) (-828.775) (-828.698) [-827.918] -- 0:00:42
288000 -- [-828.224] (-829.614) (-828.312) (-827.561) * (-828.590) (-830.286) [-827.808] (-828.742) -- 0:00:42
288500 -- (-829.214) (-827.077) [-829.801] (-828.596) * (-829.766) (-829.351) [-832.095] (-828.128) -- 0:00:41
289000 -- (-829.253) [-828.299] (-832.595) (-828.025) * (-830.304) [-829.210] (-829.896) (-827.875) -- 0:00:41
289500 -- (-829.997) [-827.100] (-828.711) (-826.890) * (-831.941) [-830.158] (-828.820) (-830.408) -- 0:00:41
290000 -- (-828.046) (-828.469) [-828.981] (-827.758) * (-831.198) (-831.795) (-826.899) [-828.974] -- 0:00:41
Average standard deviation of split frequencies: 0.013137
290500 -- (-827.550) (-830.360) (-828.654) [-827.667] * (-831.129) (-836.923) [-827.613] (-829.762) -- 0:00:41
291000 -- (-828.473) [-828.829] (-831.256) (-828.858) * (-830.510) (-831.419) [-827.639] (-826.968) -- 0:00:41
291500 -- (-830.756) [-828.744] (-830.065) (-827.324) * [-827.385] (-831.389) (-830.718) (-830.133) -- 0:00:41
292000 -- (-827.972) (-830.341) (-829.716) [-828.090] * [-828.461] (-831.074) (-828.987) (-828.976) -- 0:00:41
292500 -- (-828.764) (-827.181) (-826.964) [-829.348] * (-830.344) (-834.918) (-829.596) [-826.983] -- 0:00:41
293000 -- (-827.301) [-827.223] (-827.437) (-828.383) * (-830.693) (-831.923) (-828.201) [-827.942] -- 0:00:41
293500 -- [-832.054] (-828.307) (-831.835) (-828.333) * (-830.153) [-827.978] (-829.903) (-831.613) -- 0:00:43
294000 -- (-827.716) [-830.250] (-828.821) (-829.570) * [-828.392] (-830.226) (-830.199) (-832.408) -- 0:00:43
294500 -- [-829.254] (-827.877) (-830.031) (-835.932) * (-828.662) [-831.413] (-828.663) (-829.315) -- 0:00:43
295000 -- (-828.714) [-829.044] (-827.231) (-829.767) * (-828.897) [-828.791] (-827.272) (-827.504) -- 0:00:43
Average standard deviation of split frequencies: 0.013095
295500 -- [-828.358] (-829.272) (-828.297) (-829.826) * (-828.719) (-827.617) [-830.217] (-830.532) -- 0:00:42
296000 -- (-827.610) (-828.799) (-830.137) [-827.857] * (-827.943) [-835.277] (-830.329) (-834.271) -- 0:00:42
296500 -- (-826.957) (-829.872) (-833.291) [-826.878] * (-827.647) (-829.282) [-828.189] (-827.923) -- 0:00:42
297000 -- (-831.821) [-828.330] (-830.741) (-834.204) * (-829.085) (-831.211) (-828.606) [-830.034] -- 0:00:42
297500 -- (-833.788) (-831.898) [-827.982] (-829.972) * [-828.443] (-829.313) (-830.392) (-833.468) -- 0:00:42
298000 -- (-833.120) (-831.509) [-827.160] (-830.513) * [-831.535] (-829.610) (-831.256) (-830.350) -- 0:00:42
298500 -- (-828.852) [-828.862] (-836.124) (-829.282) * [-827.653] (-828.162) (-829.243) (-830.093) -- 0:00:42
299000 -- [-829.868] (-827.985) (-831.789) (-827.752) * [-831.066] (-827.204) (-828.786) (-831.686) -- 0:00:42
299500 -- (-829.500) [-827.466] (-828.891) (-828.625) * (-827.688) (-827.357) (-829.269) [-833.066] -- 0:00:42
300000 -- (-830.260) (-826.948) [-829.458] (-829.163) * (-830.385) (-827.335) (-829.908) [-829.623] -- 0:00:42
Average standard deviation of split frequencies: 0.013588
300500 -- (-829.800) (-827.641) (-829.729) [-828.825] * (-832.917) (-828.820) [-832.028] (-827.538) -- 0:00:41
301000 -- (-828.492) (-829.130) [-828.835] (-829.379) * (-831.172) [-830.949] (-828.925) (-828.328) -- 0:00:41
301500 -- [-833.337] (-829.632) (-828.500) (-833.676) * [-828.556] (-830.892) (-829.133) (-830.982) -- 0:00:41
302000 -- (-832.050) (-828.365) [-828.609] (-828.578) * [-828.445] (-828.571) (-828.757) (-827.985) -- 0:00:41
302500 -- (-831.091) (-829.335) (-829.554) [-829.967] * [-828.316] (-833.357) (-827.376) (-827.644) -- 0:00:41
303000 -- (-831.458) [-830.391] (-828.942) (-830.305) * (-829.513) (-832.352) (-829.041) [-827.602] -- 0:00:41
303500 -- (-828.538) (-831.344) [-827.560] (-829.388) * (-829.469) (-828.748) [-828.870] (-831.155) -- 0:00:41
304000 -- (-829.039) [-832.591] (-828.151) (-829.968) * [-830.551] (-828.441) (-829.225) (-828.664) -- 0:00:41
304500 -- (-830.179) [-831.552] (-831.677) (-831.040) * (-828.353) (-827.836) [-827.838] (-829.068) -- 0:00:41
305000 -- (-829.800) (-827.799) [-830.601] (-828.614) * (-830.084) [-828.051] (-832.073) (-828.184) -- 0:00:41
Average standard deviation of split frequencies: 0.013403
305500 -- (-829.807) (-829.324) [-830.530] (-827.513) * (-831.719) (-829.547) [-830.861] (-831.592) -- 0:00:40
306000 -- (-827.651) [-829.466] (-828.909) (-830.917) * [-830.877] (-830.731) (-831.945) (-829.079) -- 0:00:40
306500 -- [-828.281] (-832.074) (-829.540) (-829.708) * [-829.631] (-827.692) (-829.551) (-829.879) -- 0:00:40
307000 -- (-826.887) (-831.228) (-828.243) [-830.870] * [-831.855] (-827.250) (-828.400) (-831.092) -- 0:00:40
307500 -- (-828.877) [-827.801] (-831.262) (-832.389) * [-828.409] (-829.000) (-827.808) (-827.700) -- 0:00:40
308000 -- (-830.233) (-830.023) (-828.145) [-828.695] * (-828.972) [-827.636] (-828.823) (-828.420) -- 0:00:40
308500 -- (-830.521) (-828.691) (-831.084) [-827.597] * [-827.647] (-827.606) (-830.807) (-831.395) -- 0:00:40
309000 -- (-830.108) [-831.078] (-831.043) (-827.151) * (-828.402) [-827.432] (-832.714) (-829.688) -- 0:00:40
309500 -- [-828.174] (-830.335) (-832.168) (-828.737) * [-828.900] (-836.006) (-830.578) (-827.788) -- 0:00:40
310000 -- (-829.690) (-830.192) (-833.835) [-828.723] * [-828.933] (-828.208) (-827.763) (-828.596) -- 0:00:42
Average standard deviation of split frequencies: 0.013337
310500 -- (-829.570) (-828.488) [-829.303] (-828.822) * (-829.698) (-832.434) [-829.453] (-830.367) -- 0:00:42
311000 -- (-828.301) [-827.507] (-829.927) (-829.492) * (-826.965) (-829.388) [-830.117] (-835.019) -- 0:00:42
311500 -- (-827.640) [-828.478] (-832.755) (-827.640) * (-828.246) [-827.112] (-830.751) (-831.322) -- 0:00:41
312000 -- (-827.199) [-830.581] (-828.259) (-831.612) * [-827.458] (-827.823) (-830.363) (-830.704) -- 0:00:41
312500 -- [-827.571] (-828.172) (-830.015) (-827.972) * (-829.078) (-828.047) (-831.592) [-828.718] -- 0:00:41
313000 -- [-829.155] (-828.485) (-830.676) (-829.153) * (-829.909) (-827.839) [-828.059] (-828.880) -- 0:00:41
313500 -- [-832.408] (-827.676) (-827.818) (-830.095) * (-833.211) (-831.142) (-830.445) [-829.905] -- 0:00:41
314000 -- [-828.920] (-827.403) (-827.710) (-827.580) * [-832.429] (-829.183) (-829.319) (-828.673) -- 0:00:41
314500 -- (-827.018) [-827.600] (-828.150) (-828.255) * (-838.866) [-828.154] (-827.913) (-828.434) -- 0:00:41
315000 -- (-827.188) (-828.194) (-829.939) [-827.729] * (-834.938) (-827.288) (-827.561) [-828.830] -- 0:00:41
Average standard deviation of split frequencies: 0.013505
315500 -- (-828.426) (-831.277) [-829.056] (-828.537) * (-831.053) (-829.338) (-827.893) [-830.886] -- 0:00:41
316000 -- (-829.364) [-829.627] (-829.282) (-828.213) * (-827.582) [-828.457] (-829.102) (-828.041) -- 0:00:41
316500 -- [-831.921] (-829.875) (-827.393) (-828.416) * (-827.760) (-830.915) [-830.971] (-831.199) -- 0:00:41
317000 -- (-830.383) (-828.087) [-828.576] (-828.299) * (-828.088) [-829.633] (-829.281) (-835.394) -- 0:00:40
317500 -- (-829.797) (-828.623) (-827.491) [-827.995] * (-830.236) [-828.124] (-829.323) (-829.901) -- 0:00:40
318000 -- (-830.955) [-827.987] (-830.663) (-827.562) * (-829.259) (-826.822) (-829.538) [-830.065] -- 0:00:40
318500 -- (-828.164) [-829.860] (-829.252) (-830.087) * (-839.287) [-827.966] (-828.344) (-828.293) -- 0:00:40
319000 -- [-827.531] (-829.941) (-830.657) (-830.578) * (-831.429) (-826.738) (-828.480) [-829.080] -- 0:00:40
319500 -- (-829.641) [-830.357] (-831.487) (-827.238) * (-829.691) (-831.603) (-829.781) [-827.926] -- 0:00:40
320000 -- [-828.159] (-827.674) (-831.902) (-828.491) * (-827.472) (-829.650) [-830.292] (-829.568) -- 0:00:40
Average standard deviation of split frequencies: 0.012414
320500 -- (-826.983) (-829.312) (-829.174) [-831.868] * [-826.797] (-829.390) (-830.010) (-828.808) -- 0:00:40
321000 -- (-831.255) (-830.063) [-828.028] (-831.882) * (-827.280) (-827.058) [-827.386] (-828.585) -- 0:00:40
321500 -- (-836.236) [-828.617] (-828.088) (-829.781) * (-830.753) [-827.866] (-827.743) (-830.772) -- 0:00:40
322000 -- (-830.108) [-830.586] (-830.312) (-831.118) * (-826.632) [-830.096] (-827.767) (-830.845) -- 0:00:40
322500 -- (-834.028) (-828.746) [-831.418] (-832.089) * (-826.688) (-831.223) [-827.931] (-832.880) -- 0:00:39
323000 -- [-830.873] (-827.905) (-828.431) (-830.491) * [-828.870] (-827.189) (-829.864) (-831.780) -- 0:00:39
323500 -- [-828.657] (-827.608) (-828.520) (-831.511) * (-832.954) (-832.067) (-831.218) [-834.053] -- 0:00:39
324000 -- (-833.851) (-828.489) [-831.362] (-828.971) * (-830.816) (-827.348) (-829.513) [-831.897] -- 0:00:39
324500 -- [-827.480] (-830.441) (-829.714) (-829.700) * (-827.893) (-828.814) [-832.544] (-827.746) -- 0:00:39
325000 -- (-828.000) (-828.764) [-831.312] (-827.703) * [-832.093] (-830.519) (-831.770) (-828.733) -- 0:00:39
Average standard deviation of split frequencies: 0.012025
325500 -- (-829.696) (-831.802) (-831.049) [-828.212] * (-830.501) (-830.106) [-827.443] (-830.106) -- 0:00:39
326000 -- [-829.600] (-830.645) (-831.923) (-828.819) * (-828.296) (-829.789) (-827.500) [-828.569] -- 0:00:39
326500 -- [-827.685] (-827.081) (-830.793) (-827.621) * [-828.287] (-827.748) (-827.719) (-836.741) -- 0:00:41
327000 -- (-829.019) (-826.807) (-828.919) [-826.900] * (-830.655) [-827.504] (-827.826) (-828.909) -- 0:00:41
327500 -- (-833.047) (-828.323) (-826.901) [-826.888] * [-827.172] (-831.453) (-827.743) (-828.976) -- 0:00:41
328000 -- (-829.228) (-827.063) [-827.132] (-828.650) * [-828.976] (-828.509) (-829.664) (-828.875) -- 0:00:40
328500 -- [-829.596] (-828.387) (-832.378) (-829.348) * (-829.410) (-827.777) (-829.501) [-829.641] -- 0:00:40
329000 -- (-834.738) (-829.425) [-828.549] (-827.417) * (-831.448) [-833.232] (-828.551) (-829.286) -- 0:00:40
329500 -- (-829.020) (-830.079) (-827.996) [-830.432] * [-827.692] (-829.715) (-829.901) (-832.307) -- 0:00:40
330000 -- (-827.995) (-828.880) (-826.850) [-828.840] * (-829.013) [-830.869] (-829.085) (-828.655) -- 0:00:40
Average standard deviation of split frequencies: 0.012672
330500 -- (-828.777) (-828.862) (-827.257) [-829.856] * (-828.561) [-828.162] (-829.419) (-828.950) -- 0:00:40
331000 -- (-828.483) [-828.457] (-827.643) (-831.472) * (-829.751) [-831.016] (-835.669) (-831.869) -- 0:00:40
331500 -- [-827.956] (-829.077) (-828.728) (-829.754) * (-829.480) (-833.465) (-829.267) [-829.645] -- 0:00:40
332000 -- [-828.118] (-830.369) (-831.080) (-827.578) * (-830.319) (-828.049) (-832.288) [-830.990] -- 0:00:40
332500 -- [-828.186] (-828.974) (-830.419) (-828.667) * (-828.990) (-832.077) (-828.482) [-832.101] -- 0:00:40
333000 -- (-829.057) (-828.360) (-830.392) [-832.333] * (-828.062) (-830.361) (-829.893) [-831.078] -- 0:00:40
333500 -- (-828.734) [-829.717] (-827.914) (-829.347) * (-831.279) [-828.297] (-828.824) (-830.684) -- 0:00:39
334000 -- (-828.365) (-834.392) [-828.457] (-829.202) * (-828.694) (-829.959) (-827.079) [-830.092] -- 0:00:39
334500 -- (-828.199) [-829.317] (-829.396) (-830.727) * (-828.986) (-831.699) [-827.924] (-830.592) -- 0:00:39
335000 -- (-831.817) (-829.760) (-828.243) [-827.493] * (-828.370) (-831.950) (-827.490) [-834.585] -- 0:00:39
Average standard deviation of split frequencies: 0.012393
335500 -- [-827.842] (-829.258) (-827.613) (-830.927) * (-831.869) (-831.277) [-827.909] (-829.995) -- 0:00:39
336000 -- (-827.047) (-828.221) [-827.353] (-828.531) * (-831.129) (-834.488) [-827.591] (-828.991) -- 0:00:39
336500 -- (-828.034) (-831.762) (-827.282) [-830.126] * (-828.342) [-827.501] (-829.586) (-830.683) -- 0:00:39
337000 -- (-828.953) (-827.477) (-827.094) [-831.446] * (-827.328) [-827.341] (-826.880) (-833.162) -- 0:00:39
337500 -- [-827.545] (-830.063) (-827.634) (-829.335) * (-827.594) [-829.839] (-828.896) (-830.324) -- 0:00:39
338000 -- (-832.719) [-827.931] (-828.830) (-832.229) * [-829.142] (-832.048) (-830.181) (-831.041) -- 0:00:39
338500 -- (-828.212) [-830.097] (-831.154) (-828.016) * (-828.809) (-829.596) (-827.916) [-829.849] -- 0:00:39
339000 -- (-830.611) [-830.443] (-829.555) (-831.864) * [-827.150] (-828.818) (-827.207) (-830.175) -- 0:00:38
339500 -- [-827.277] (-830.201) (-829.287) (-828.050) * (-830.098) [-828.277] (-828.200) (-828.047) -- 0:00:38
340000 -- (-829.124) (-829.274) (-827.862) [-828.315] * (-832.142) (-828.540) [-828.782] (-827.636) -- 0:00:38
Average standard deviation of split frequencies: 0.012070
340500 -- [-830.016] (-827.196) (-827.761) (-828.652) * (-831.450) (-827.981) [-826.993] (-827.641) -- 0:00:38
341000 -- (-834.190) (-828.012) [-828.058] (-827.702) * (-830.221) (-830.941) (-828.439) [-829.059] -- 0:00:38
341500 -- (-833.344) [-829.453] (-827.837) (-827.851) * (-828.657) [-828.578] (-828.909) (-828.234) -- 0:00:38
342000 -- (-828.080) (-827.293) [-830.093] (-828.065) * (-828.358) (-829.804) (-828.397) [-828.706] -- 0:00:38
342500 -- [-828.739] (-829.962) (-828.755) (-829.107) * (-829.284) (-829.085) (-829.320) [-828.323] -- 0:00:38
343000 -- (-828.995) (-830.100) [-828.339] (-827.913) * (-829.126) [-827.100] (-832.193) (-831.667) -- 0:00:40
343500 -- (-828.214) (-830.256) (-827.700) [-829.332] * [-827.415] (-829.169) (-828.097) (-832.658) -- 0:00:40
344000 -- (-832.240) (-832.160) [-828.384] (-830.417) * [-827.410] (-832.755) (-831.786) (-828.902) -- 0:00:40
344500 -- (-827.370) [-831.015] (-831.026) (-828.499) * [-828.682] (-832.373) (-829.149) (-829.437) -- 0:00:39
345000 -- [-828.352] (-828.764) (-827.400) (-828.518) * [-828.907] (-828.270) (-831.262) (-828.293) -- 0:00:39
Average standard deviation of split frequencies: 0.012489
345500 -- [-828.114] (-832.900) (-829.093) (-829.721) * (-831.706) [-827.740] (-831.056) (-828.677) -- 0:00:39
346000 -- (-829.650) (-828.692) (-827.948) [-827.970] * (-830.332) [-827.777] (-827.264) (-828.738) -- 0:00:39
346500 -- (-837.118) [-830.990] (-828.591) (-833.018) * (-828.334) (-831.952) [-827.234] (-828.595) -- 0:00:39
347000 -- (-831.154) (-828.789) [-831.253] (-829.608) * (-827.749) [-830.921] (-827.508) (-830.100) -- 0:00:39
347500 -- (-830.721) (-832.043) (-832.646) [-831.213] * [-827.076] (-828.234) (-827.525) (-833.299) -- 0:00:39
348000 -- (-830.384) (-829.735) (-828.515) [-829.525] * (-828.853) [-828.247] (-831.213) (-832.475) -- 0:00:39
348500 -- (-829.895) [-828.263] (-828.789) (-829.626) * [-828.240] (-828.529) (-830.475) (-830.701) -- 0:00:39
349000 -- (-828.536) (-827.034) [-829.227] (-831.029) * [-829.599] (-829.305) (-829.122) (-831.525) -- 0:00:39
349500 -- (-828.379) (-830.836) [-831.154] (-831.432) * [-828.415] (-828.304) (-829.570) (-829.950) -- 0:00:39
350000 -- [-829.191] (-829.156) (-829.467) (-827.816) * (-828.042) (-830.122) [-832.749] (-827.661) -- 0:00:39
Average standard deviation of split frequencies: 0.012652
350500 -- [-828.152] (-829.517) (-828.317) (-828.608) * (-828.001) (-832.532) [-832.230] (-830.502) -- 0:00:38
351000 -- (-828.509) (-828.210) [-827.004] (-830.314) * [-829.720] (-827.895) (-826.976) (-829.588) -- 0:00:38
351500 -- (-830.516) (-827.799) [-829.828] (-829.011) * (-827.637) (-827.730) [-827.260] (-829.964) -- 0:00:38
352000 -- (-831.331) (-828.498) (-828.770) [-831.205] * (-826.913) (-827.560) (-831.467) [-831.154] -- 0:00:38
352500 -- [-828.465] (-827.990) (-832.422) (-831.322) * (-827.048) (-829.352) (-827.583) [-827.460] -- 0:00:38
353000 -- (-834.614) (-827.514) [-828.972] (-829.010) * (-827.613) (-829.342) [-827.854] (-829.040) -- 0:00:38
353500 -- (-829.788) [-828.479] (-828.344) (-828.435) * (-829.154) (-827.343) (-827.822) [-829.126] -- 0:00:38
354000 -- (-827.544) (-827.773) (-827.809) [-828.943] * (-829.032) (-827.626) (-828.724) [-828.758] -- 0:00:38
354500 -- (-828.051) [-828.496] (-828.347) (-831.910) * (-828.498) (-827.889) (-828.446) [-827.368] -- 0:00:38
355000 -- (-828.088) [-830.324] (-827.445) (-827.965) * (-828.857) (-831.770) [-830.587] (-835.631) -- 0:00:38
Average standard deviation of split frequencies: 0.011918
355500 -- (-827.873) (-832.058) [-827.141] (-828.745) * (-829.330) [-829.387] (-834.635) (-833.579) -- 0:00:38
356000 -- (-827.528) (-832.224) [-832.277] (-833.742) * (-827.836) [-828.872] (-831.296) (-827.927) -- 0:00:37
356500 -- (-829.620) [-828.855] (-832.925) (-829.097) * (-829.661) [-827.339] (-830.268) (-827.931) -- 0:00:37
357000 -- [-828.418] (-832.121) (-829.933) (-833.558) * (-827.638) (-827.686) (-829.336) [-828.584] -- 0:00:37
357500 -- [-828.707] (-829.307) (-828.965) (-831.147) * (-828.387) [-827.685] (-827.267) (-831.508) -- 0:00:37
358000 -- [-831.660] (-827.149) (-830.128) (-829.353) * (-834.105) (-828.681) (-827.031) [-828.390] -- 0:00:37
358500 -- (-828.898) (-827.903) (-830.010) [-829.040] * [-826.786] (-830.166) (-829.024) (-827.185) -- 0:00:37
359000 -- [-826.951] (-827.948) (-832.088) (-828.760) * [-826.647] (-828.744) (-828.361) (-827.883) -- 0:00:37
359500 -- [-829.295] (-826.973) (-828.339) (-827.036) * (-830.500) (-827.209) (-829.901) [-827.193] -- 0:00:37
360000 -- (-828.581) (-828.928) [-831.808] (-827.442) * (-831.742) (-828.057) (-829.590) [-829.793] -- 0:00:39
Average standard deviation of split frequencies: 0.012562
360500 -- [-830.053] (-827.727) (-830.336) (-827.423) * (-828.222) [-831.651] (-828.258) (-827.725) -- 0:00:39
361000 -- [-827.580] (-835.345) (-830.937) (-827.551) * (-827.359) (-829.532) [-829.076] (-829.420) -- 0:00:38
361500 -- (-828.713) (-829.097) (-833.228) [-827.744] * [-828.619] (-828.487) (-834.561) (-832.121) -- 0:00:38
362000 -- (-830.716) (-828.358) (-831.124) [-828.514] * [-830.101] (-828.285) (-829.571) (-828.867) -- 0:00:38
362500 -- (-828.903) [-828.741] (-831.797) (-832.748) * [-832.579] (-829.646) (-829.960) (-829.777) -- 0:00:38
363000 -- (-828.154) (-833.671) [-827.551] (-826.909) * (-834.002) (-829.557) [-828.404] (-829.592) -- 0:00:38
363500 -- [-828.816] (-828.621) (-829.164) (-833.538) * (-832.269) (-830.963) (-830.068) [-828.290] -- 0:00:38
364000 -- (-830.754) [-828.840] (-828.985) (-834.816) * (-828.372) [-830.312] (-831.510) (-831.364) -- 0:00:38
364500 -- [-829.867] (-828.737) (-831.353) (-832.352) * [-827.939] (-830.207) (-831.884) (-829.197) -- 0:00:38
365000 -- [-827.732] (-829.738) (-832.211) (-832.207) * (-827.495) (-829.343) [-829.891] (-832.638) -- 0:00:38
Average standard deviation of split frequencies: 0.013953
365500 -- (-834.911) (-831.004) (-830.305) [-830.312] * (-828.458) (-828.913) [-827.820] (-829.890) -- 0:00:38
366000 -- (-829.087) (-827.088) [-831.605] (-827.332) * (-829.042) (-832.140) (-833.416) [-829.144] -- 0:00:38
366500 -- (-828.141) (-832.275) [-833.021] (-829.220) * (-828.026) [-831.472] (-832.585) (-829.377) -- 0:00:38
367000 -- (-828.537) (-832.297) [-831.413] (-828.370) * (-832.051) (-832.343) (-832.658) [-826.834] -- 0:00:37
367500 -- (-828.199) [-830.735] (-829.188) (-828.553) * [-829.145] (-835.303) (-831.883) (-831.071) -- 0:00:37
368000 -- [-828.316] (-832.776) (-831.072) (-827.791) * (-829.495) (-836.912) (-831.493) [-832.707] -- 0:00:37
368500 -- [-828.625] (-832.272) (-828.713) (-827.775) * (-827.072) (-827.312) [-829.125] (-829.153) -- 0:00:37
369000 -- (-828.129) (-830.159) [-828.622] (-828.251) * [-827.504] (-830.597) (-829.604) (-828.544) -- 0:00:37
369500 -- (-827.088) (-827.363) (-827.522) [-827.625] * [-828.455] (-829.119) (-830.217) (-832.128) -- 0:00:37
370000 -- [-826.684] (-827.364) (-827.293) (-828.495) * (-827.911) (-829.352) [-829.473] (-829.679) -- 0:00:37
Average standard deviation of split frequencies: 0.014908
370500 -- [-829.773] (-826.981) (-829.561) (-828.836) * (-831.042) (-827.254) [-828.852] (-830.023) -- 0:00:37
371000 -- (-827.459) [-826.998] (-828.670) (-833.315) * (-836.240) [-830.125] (-828.495) (-833.703) -- 0:00:37
371500 -- (-834.553) [-828.714] (-831.831) (-829.470) * (-831.394) [-828.616] (-827.428) (-831.627) -- 0:00:37
372000 -- (-831.489) [-827.450] (-828.626) (-829.187) * (-826.839) (-828.150) (-832.496) [-826.906] -- 0:00:37
372500 -- (-827.454) (-827.458) (-830.844) [-829.448] * [-828.280] (-827.179) (-829.950) (-828.408) -- 0:00:37
373000 -- (-827.318) (-828.435) [-828.309] (-828.417) * (-828.937) (-831.943) [-830.055] (-827.169) -- 0:00:36
373500 -- [-827.385] (-831.354) (-829.500) (-830.948) * (-830.209) [-827.730] (-830.122) (-828.099) -- 0:00:36
374000 -- (-828.097) (-831.785) [-828.507] (-828.278) * [-828.968] (-827.353) (-832.485) (-830.279) -- 0:00:36
374500 -- [-826.817] (-829.140) (-834.960) (-830.458) * (-832.749) [-831.268] (-828.459) (-829.270) -- 0:00:36
375000 -- (-830.932) (-830.437) (-828.638) [-828.317] * (-828.621) [-828.104] (-826.690) (-828.305) -- 0:00:36
Average standard deviation of split frequencies: 0.014455
375500 -- (-828.156) (-827.880) (-828.137) [-827.481] * (-827.423) (-828.340) (-828.612) [-830.806] -- 0:00:36
376000 -- (-829.529) [-827.249] (-830.106) (-827.612) * [-829.204] (-828.612) (-829.840) (-830.457) -- 0:00:36
376500 -- (-827.553) (-829.081) [-829.390] (-830.587) * [-827.988] (-828.908) (-833.533) (-832.867) -- 0:00:38
377000 -- (-828.460) [-826.985] (-833.366) (-831.464) * [-827.952] (-829.385) (-828.072) (-831.751) -- 0:00:38
377500 -- (-828.341) (-828.378) (-830.204) [-826.686] * (-827.443) (-829.549) (-829.530) [-827.769] -- 0:00:37
378000 -- (-827.529) (-831.138) (-829.996) [-829.137] * (-829.070) [-828.630] (-828.110) (-827.567) -- 0:00:37
378500 -- (-829.217) [-829.799] (-829.928) (-830.269) * [-827.470] (-828.077) (-832.393) (-831.686) -- 0:00:37
379000 -- (-830.108) [-826.886] (-832.623) (-830.382) * [-831.492] (-829.515) (-829.951) (-830.746) -- 0:00:37
379500 -- [-828.344] (-827.206) (-831.023) (-829.897) * (-831.892) (-827.615) [-827.467] (-830.874) -- 0:00:37
380000 -- [-828.109] (-827.742) (-832.844) (-827.442) * [-829.496] (-829.448) (-827.880) (-832.846) -- 0:00:37
Average standard deviation of split frequencies: 0.014933
380500 -- (-828.017) (-830.974) (-828.894) [-831.745] * [-829.736] (-830.298) (-829.905) (-829.084) -- 0:00:37
381000 -- [-828.442] (-833.527) (-828.926) (-828.055) * (-827.362) (-830.203) [-830.657] (-828.229) -- 0:00:37
381500 -- (-831.150) (-828.488) [-831.452] (-827.798) * (-829.992) (-830.330) [-828.687] (-830.936) -- 0:00:37
382000 -- (-831.299) (-829.396) [-833.306] (-827.617) * (-829.749) (-828.348) (-832.190) [-829.082] -- 0:00:37
382500 -- [-827.926] (-828.305) (-830.330) (-828.900) * (-832.333) (-828.026) (-828.258) [-828.640] -- 0:00:37
383000 -- [-828.386] (-830.445) (-832.512) (-828.220) * (-831.315) [-827.778] (-832.298) (-831.368) -- 0:00:37
383500 -- (-831.973) [-830.411] (-831.991) (-832.076) * [-830.455] (-829.281) (-827.462) (-827.236) -- 0:00:36
384000 -- (-829.304) (-829.270) (-833.855) [-829.028] * (-828.453) (-830.217) [-829.476] (-830.092) -- 0:00:36
384500 -- (-829.968) (-827.292) (-827.435) [-829.367] * (-829.142) (-828.858) [-827.504] (-828.868) -- 0:00:36
385000 -- (-828.690) [-828.535] (-827.524) (-829.539) * (-828.404) (-827.818) [-827.576] (-828.296) -- 0:00:36
Average standard deviation of split frequencies: 0.015808
385500 -- (-827.864) (-833.018) [-829.036] (-830.518) * [-828.263] (-830.725) (-829.306) (-830.573) -- 0:00:36
386000 -- [-828.211] (-829.475) (-828.538) (-829.401) * (-828.001) (-829.837) (-842.260) [-828.566] -- 0:00:36
386500 -- (-828.848) [-828.804] (-827.241) (-829.305) * (-826.888) (-828.739) (-827.320) [-827.254] -- 0:00:36
387000 -- [-828.605] (-830.763) (-828.490) (-831.798) * (-827.791) [-829.087] (-829.685) (-827.791) -- 0:00:36
387500 -- (-827.894) (-830.349) [-827.689] (-835.449) * [-827.997] (-828.337) (-833.025) (-833.184) -- 0:00:36
388000 -- [-828.581] (-828.265) (-830.157) (-830.221) * (-830.638) [-829.404] (-827.475) (-830.427) -- 0:00:36
388500 -- (-827.860) [-826.724] (-829.376) (-829.424) * (-829.563) (-828.341) [-828.885] (-834.686) -- 0:00:36
389000 -- (-827.141) [-827.742] (-827.181) (-828.546) * (-827.961) (-828.149) (-827.503) [-831.466] -- 0:00:36
389500 -- (-828.875) [-827.890] (-829.636) (-828.230) * (-830.970) (-828.119) (-830.707) [-831.749] -- 0:00:36
390000 -- (-831.070) [-828.017] (-827.374) (-830.713) * (-828.187) (-834.084) (-828.508) [-828.946] -- 0:00:35
Average standard deviation of split frequencies: 0.015616
390500 -- (-829.396) [-827.312] (-828.687) (-831.971) * (-829.451) (-829.725) [-828.672] (-832.559) -- 0:00:35
391000 -- [-831.644] (-829.467) (-828.855) (-829.240) * (-828.418) (-829.651) [-830.066] (-827.207) -- 0:00:35
391500 -- (-830.760) (-828.104) [-829.203] (-827.654) * (-828.309) (-834.100) [-829.291] (-827.681) -- 0:00:35
392000 -- (-829.760) (-829.776) (-828.242) [-827.142] * [-828.778] (-828.679) (-828.302) (-827.432) -- 0:00:35
392500 -- [-827.464] (-829.568) (-831.104) (-829.378) * [-828.015] (-829.927) (-830.432) (-829.375) -- 0:00:35
393000 -- (-827.594) [-829.495] (-831.510) (-830.051) * [-829.129] (-827.950) (-830.436) (-828.722) -- 0:00:37
393500 -- (-827.553) (-829.686) (-829.698) [-829.595] * (-827.613) (-829.876) (-831.633) [-829.954] -- 0:00:36
394000 -- (-827.648) (-828.658) [-830.899] (-828.865) * [-827.965] (-828.462) (-828.865) (-831.741) -- 0:00:36
394500 -- (-828.101) (-827.916) [-830.069] (-829.800) * (-828.960) [-829.941] (-827.702) (-828.928) -- 0:00:36
395000 -- (-828.174) (-828.188) (-829.248) [-828.761] * (-827.630) (-829.274) (-833.264) [-827.621] -- 0:00:36
Average standard deviation of split frequencies: 0.015966
395500 -- (-828.121) [-828.639] (-829.939) (-827.466) * [-827.923] (-829.203) (-827.945) (-833.516) -- 0:00:36
396000 -- [-831.214] (-828.883) (-829.655) (-830.112) * (-828.443) (-831.885) (-828.862) [-828.579] -- 0:00:36
396500 -- [-827.912] (-828.344) (-828.858) (-829.921) * (-829.724) (-829.104) (-830.665) [-833.940] -- 0:00:36
397000 -- (-832.305) (-827.513) [-827.562] (-833.030) * (-827.225) [-827.299] (-829.535) (-830.004) -- 0:00:36
397500 -- (-831.054) [-827.693] (-827.160) (-828.924) * (-827.100) (-827.200) (-828.420) [-828.981] -- 0:00:36
398000 -- (-827.863) (-829.665) (-829.189) [-830.308] * (-830.481) (-827.530) [-827.807] (-830.938) -- 0:00:36
398500 -- (-830.288) (-831.732) [-827.468] (-827.968) * (-835.737) [-831.835] (-828.262) (-827.993) -- 0:00:36
399000 -- (-838.765) (-829.020) [-827.510] (-829.588) * (-831.559) [-828.020] (-827.787) (-832.111) -- 0:00:36
399500 -- [-829.022] (-827.631) (-828.451) (-833.030) * (-827.483) [-828.051] (-829.279) (-830.948) -- 0:00:36
400000 -- (-834.862) (-831.355) (-829.297) [-827.630] * (-827.741) [-828.132] (-832.135) (-833.752) -- 0:00:36
Average standard deviation of split frequencies: 0.015710
400500 -- (-827.709) (-827.769) (-831.555) [-827.417] * (-828.995) (-828.978) [-833.030] (-831.808) -- 0:00:35
401000 -- (-831.093) [-829.522] (-829.762) (-827.397) * [-833.413] (-827.833) (-828.863) (-829.372) -- 0:00:35
401500 -- (-830.549) (-830.545) (-833.637) [-828.773] * (-837.050) [-828.891] (-830.460) (-829.362) -- 0:00:35
402000 -- (-829.265) (-830.905) [-829.663] (-828.705) * (-834.393) [-827.580] (-829.135) (-828.026) -- 0:00:35
402500 -- (-830.121) (-829.492) [-827.446] (-828.886) * (-828.415) (-827.693) (-829.773) [-831.418] -- 0:00:35
403000 -- [-828.034] (-828.389) (-827.879) (-830.287) * [-828.556] (-829.296) (-827.724) (-828.646) -- 0:00:35
403500 -- (-832.094) [-827.298] (-830.600) (-827.688) * (-837.771) [-833.428] (-827.977) (-829.021) -- 0:00:35
404000 -- (-831.899) (-829.893) (-827.122) [-827.714] * (-830.544) (-828.540) [-830.016] (-827.413) -- 0:00:35
404500 -- (-830.810) [-831.359] (-828.632) (-830.356) * (-827.765) [-827.324] (-829.092) (-829.488) -- 0:00:35
405000 -- (-830.017) (-829.958) (-828.960) [-827.469] * (-829.397) (-829.432) [-828.080] (-830.230) -- 0:00:35
Average standard deviation of split frequencies: 0.015231
405500 -- [-827.873] (-831.288) (-829.419) (-826.888) * (-829.556) [-834.262] (-827.904) (-827.915) -- 0:00:35
406000 -- (-828.020) (-829.646) [-831.646] (-828.199) * (-828.420) (-830.811) [-829.169] (-831.493) -- 0:00:35
406500 -- (-828.454) [-827.485] (-833.614) (-828.023) * (-828.950) (-830.443) (-830.490) [-828.687] -- 0:00:35
407000 -- (-829.540) (-830.329) [-828.651] (-828.789) * (-828.208) [-828.470] (-827.924) (-828.587) -- 0:00:34
407500 -- [-828.219] (-830.369) (-829.325) (-830.475) * (-829.370) [-827.274] (-827.439) (-828.072) -- 0:00:34
408000 -- (-828.789) (-829.758) [-829.872] (-830.894) * (-831.775) (-826.844) (-828.814) [-829.874] -- 0:00:34
408500 -- (-827.935) (-828.984) (-829.856) [-832.110] * (-833.418) [-826.891] (-830.532) (-831.222) -- 0:00:34
409000 -- (-827.573) [-830.393] (-828.918) (-827.517) * (-833.587) (-833.857) (-828.170) [-826.984] -- 0:00:34
409500 -- (-828.438) (-827.627) (-830.650) [-827.263] * (-828.791) (-829.580) [-830.484] (-827.127) -- 0:00:36
410000 -- (-829.042) (-827.420) [-828.031] (-827.286) * (-829.296) (-827.810) (-828.069) [-827.497] -- 0:00:35
Average standard deviation of split frequencies: 0.015058
410500 -- (-831.735) (-830.482) (-834.938) [-827.579] * (-830.907) (-828.262) [-829.712] (-829.439) -- 0:00:35
411000 -- (-834.314) (-834.044) (-829.350) [-831.555] * (-828.528) [-826.771] (-829.325) (-830.347) -- 0:00:35
411500 -- (-829.305) (-829.413) (-826.705) [-828.566] * (-828.721) (-827.232) [-827.077] (-830.467) -- 0:00:35
412000 -- (-829.931) [-828.711] (-827.544) (-827.306) * (-828.904) [-827.186] (-827.977) (-829.260) -- 0:00:35
412500 -- [-829.834] (-830.800) (-828.647) (-828.331) * (-828.840) [-828.819] (-827.952) (-828.160) -- 0:00:35
413000 -- (-829.451) [-827.293] (-827.726) (-829.058) * (-830.544) (-832.913) (-830.405) [-828.885] -- 0:00:35
413500 -- (-831.567) (-830.188) [-828.632] (-829.937) * (-828.795) [-828.098] (-831.607) (-829.426) -- 0:00:35
414000 -- (-830.463) [-827.191] (-828.886) (-827.315) * (-829.565) [-826.731] (-829.449) (-827.621) -- 0:00:35
414500 -- [-832.324] (-827.216) (-829.743) (-829.314) * [-827.806] (-828.792) (-830.117) (-829.229) -- 0:00:35
415000 -- [-827.557] (-829.584) (-828.338) (-830.069) * (-827.650) [-829.545] (-829.689) (-834.419) -- 0:00:35
Average standard deviation of split frequencies: 0.014465
415500 -- (-827.126) (-828.942) [-830.863] (-827.738) * [-828.564] (-830.328) (-829.665) (-827.446) -- 0:00:35
416000 -- (-826.763) (-827.351) (-830.462) [-829.195] * (-828.514) [-830.436] (-827.377) (-828.548) -- 0:00:35
416500 -- (-828.103) [-827.956] (-831.469) (-829.117) * [-829.394] (-832.089) (-827.370) (-830.507) -- 0:00:35
417000 -- (-827.613) (-827.921) [-827.942] (-833.320) * [-829.453] (-828.427) (-829.194) (-829.825) -- 0:00:34
417500 -- (-827.975) (-827.727) (-827.342) [-831.107] * [-829.728] (-828.314) (-833.693) (-829.921) -- 0:00:34
418000 -- (-828.963) (-831.485) [-827.918] (-829.020) * [-830.912] (-827.531) (-834.163) (-829.181) -- 0:00:34
418500 -- (-828.955) (-829.901) [-826.827] (-828.658) * (-829.854) (-830.490) [-833.376] (-828.031) -- 0:00:34
419000 -- (-830.935) (-830.266) (-828.762) [-828.665] * (-829.219) [-828.466] (-829.643) (-827.848) -- 0:00:34
419500 -- (-837.430) (-827.192) [-828.724] (-829.373) * (-828.608) (-828.192) [-829.828] (-830.629) -- 0:00:34
420000 -- [-832.911] (-828.194) (-827.603) (-828.844) * (-828.182) (-828.473) [-833.781] (-828.887) -- 0:00:34
Average standard deviation of split frequencies: 0.013909
420500 -- (-835.246) (-827.607) [-828.971] (-829.340) * (-830.604) (-832.358) (-832.816) [-827.574] -- 0:00:34
421000 -- (-831.600) (-829.113) (-827.843) [-828.997] * (-828.212) (-827.172) [-828.431] (-828.705) -- 0:00:34
421500 -- [-827.906] (-828.927) (-829.874) (-828.371) * (-830.165) (-828.169) (-827.658) [-827.953] -- 0:00:34
422000 -- (-829.541) (-829.240) (-829.475) [-829.022] * (-829.970) [-827.426] (-829.075) (-827.208) -- 0:00:34
422500 -- (-830.800) [-827.529] (-830.792) (-827.484) * (-828.616) [-827.677] (-828.025) (-828.033) -- 0:00:34
423000 -- (-829.694) [-827.046] (-831.107) (-827.615) * (-831.201) (-828.080) [-827.677] (-828.614) -- 0:00:34
423500 -- (-829.804) [-826.772] (-832.093) (-829.152) * [-830.659] (-828.948) (-828.393) (-830.838) -- 0:00:34
424000 -- (-828.962) (-828.525) (-833.429) [-828.116] * [-827.931] (-828.304) (-827.172) (-829.081) -- 0:00:33
424500 -- [-829.291] (-829.599) (-828.926) (-828.096) * [-828.060] (-828.601) (-832.544) (-830.926) -- 0:00:33
425000 -- (-828.810) [-829.719] (-829.364) (-831.692) * (-827.979) (-828.042) (-828.966) [-830.072] -- 0:00:33
Average standard deviation of split frequencies: 0.013735
425500 -- [-828.846] (-828.815) (-830.193) (-829.824) * (-829.824) [-829.698] (-830.556) (-828.028) -- 0:00:33
426000 -- (-829.854) (-829.147) (-827.326) [-831.586] * (-830.852) (-834.785) [-829.833] (-827.970) -- 0:00:35
426500 -- (-832.434) [-828.675] (-827.321) (-828.425) * (-829.223) (-828.622) (-828.989) [-827.329] -- 0:00:34
427000 -- (-831.038) (-829.596) (-829.459) [-828.045] * [-828.225] (-829.225) (-828.815) (-833.370) -- 0:00:34
427500 -- (-835.030) (-829.345) (-833.287) [-836.170] * (-828.603) (-830.015) (-830.823) [-827.351] -- 0:00:34
428000 -- (-831.237) (-831.366) (-829.834) [-830.156] * (-828.946) (-831.569) (-828.067) [-830.093] -- 0:00:34
428500 -- (-828.878) (-830.718) [-828.752] (-829.223) * (-827.141) (-827.482) (-829.454) [-827.994] -- 0:00:34
429000 -- (-830.461) (-827.856) [-827.315] (-829.533) * (-828.041) [-829.228] (-828.189) (-827.687) -- 0:00:34
429500 -- (-831.272) (-829.792) (-833.704) [-830.000] * (-828.295) [-827.174] (-827.867) (-827.204) -- 0:00:34
430000 -- (-830.946) [-827.407] (-833.045) (-832.166) * (-830.921) (-829.053) (-831.573) [-827.136] -- 0:00:34
Average standard deviation of split frequencies: 0.013071
430500 -- (-828.231) (-828.446) (-833.350) [-826.969] * (-827.953) [-830.955] (-830.559) (-828.722) -- 0:00:34
431000 -- [-827.157] (-832.244) (-832.101) (-827.657) * (-827.287) (-830.248) [-829.103] (-830.036) -- 0:00:34
431500 -- (-827.535) (-829.656) (-831.282) [-827.272] * (-828.376) [-830.918] (-827.833) (-830.880) -- 0:00:34
432000 -- (-827.950) (-829.774) (-830.206) [-827.191] * (-829.984) (-832.929) [-827.477] (-829.485) -- 0:00:34
432500 -- (-829.311) [-829.699] (-831.100) (-828.843) * (-831.191) [-829.749] (-827.032) (-829.860) -- 0:00:34
433000 -- [-828.210] (-827.819) (-831.853) (-829.334) * (-830.136) (-828.483) [-829.089] (-827.374) -- 0:00:34
433500 -- (-830.530) [-827.213] (-828.370) (-829.039) * (-829.414) (-829.417) [-833.059] (-827.279) -- 0:00:33
434000 -- [-827.636] (-828.046) (-828.323) (-828.219) * [-829.803] (-828.328) (-829.548) (-831.905) -- 0:00:33
434500 -- [-827.765] (-831.559) (-828.739) (-828.178) * (-834.067) [-831.313] (-827.999) (-827.986) -- 0:00:33
435000 -- (-829.261) (-828.118) [-828.795] (-828.366) * [-830.371] (-830.231) (-827.852) (-827.976) -- 0:00:33
Average standard deviation of split frequencies: 0.012593
435500 -- (-830.560) [-830.586] (-829.806) (-829.624) * (-829.604) (-827.847) (-828.279) [-829.742] -- 0:00:33
436000 -- [-828.744] (-827.662) (-830.426) (-829.898) * (-827.965) (-828.025) (-831.803) [-828.527] -- 0:00:33
436500 -- (-828.137) (-828.126) [-831.544] (-828.365) * (-827.811) [-827.542] (-829.644) (-828.887) -- 0:00:33
437000 -- [-828.216] (-832.006) (-829.207) (-829.099) * (-826.750) (-828.660) (-827.788) [-829.177] -- 0:00:33
437500 -- (-829.183) [-829.673] (-829.744) (-828.999) * [-827.738] (-828.201) (-828.091) (-829.735) -- 0:00:33
438000 -- [-828.261] (-828.600) (-828.231) (-830.197) * (-827.705) (-829.351) [-828.427] (-828.748) -- 0:00:33
438500 -- (-827.633) (-827.659) (-827.658) [-829.107] * [-827.245] (-829.674) (-827.055) (-829.498) -- 0:00:33
439000 -- (-828.160) [-827.092] (-830.817) (-831.153) * (-828.292) (-827.336) [-828.363] (-828.240) -- 0:00:33
439500 -- (-827.960) (-828.683) [-829.140] (-827.516) * (-829.990) (-830.294) [-831.200] (-828.786) -- 0:00:33
440000 -- (-828.954) (-830.318) [-828.850] (-827.964) * (-832.058) (-831.960) [-829.085] (-827.453) -- 0:00:33
Average standard deviation of split frequencies: 0.012648
440500 -- (-827.666) (-831.225) (-831.898) [-831.011] * (-833.994) (-828.858) (-827.962) [-827.899] -- 0:00:33
441000 -- (-830.173) (-829.467) (-834.197) [-829.753] * (-827.908) (-831.215) [-827.898] (-827.621) -- 0:00:32
441500 -- (-827.548) (-830.971) [-829.960] (-827.412) * (-829.083) (-828.790) [-828.511] (-828.371) -- 0:00:32
442000 -- [-827.341] (-831.948) (-831.360) (-828.054) * (-828.593) (-832.887) [-827.973] (-827.910) -- 0:00:32
442500 -- (-827.703) (-829.580) [-830.744] (-829.345) * (-829.171) (-829.584) [-828.778] (-827.610) -- 0:00:34
443000 -- (-826.973) [-826.702] (-832.080) (-829.299) * (-828.148) (-829.969) (-828.180) [-830.264] -- 0:00:33
443500 -- (-827.196) [-827.646] (-832.712) (-831.980) * (-829.224) (-830.148) (-827.637) [-827.728] -- 0:00:33
444000 -- [-827.022] (-828.026) (-831.074) (-829.189) * [-828.515] (-827.114) (-829.656) (-828.658) -- 0:00:33
444500 -- [-827.383] (-829.628) (-827.402) (-828.904) * (-831.022) (-832.946) (-828.456) [-832.366] -- 0:00:33
445000 -- (-830.721) [-828.799] (-826.850) (-829.770) * (-828.031) (-827.969) [-828.436] (-830.466) -- 0:00:33
Average standard deviation of split frequencies: 0.012621
445500 -- (-831.559) [-828.750] (-827.051) (-829.131) * [-830.903] (-827.918) (-832.433) (-829.314) -- 0:00:33
446000 -- (-831.842) [-827.154] (-827.748) (-829.250) * (-830.946) [-827.293] (-830.261) (-830.089) -- 0:00:33
446500 -- (-830.245) (-831.836) (-827.808) [-829.114] * [-831.791] (-828.764) (-829.164) (-827.870) -- 0:00:33
447000 -- [-827.840] (-830.508) (-828.425) (-831.106) * (-830.618) (-827.202) [-829.078] (-828.390) -- 0:00:33
447500 -- [-829.098] (-827.699) (-829.155) (-828.736) * (-828.073) (-829.582) (-830.554) [-828.711] -- 0:00:33
448000 -- (-827.606) (-826.852) [-827.295] (-829.951) * (-828.507) (-828.031) [-830.828] (-827.676) -- 0:00:33
448500 -- [-829.819] (-829.966) (-827.513) (-830.150) * (-830.154) (-830.894) (-827.596) [-828.323] -- 0:00:33
449000 -- (-827.115) (-832.446) [-828.334] (-828.780) * (-829.758) [-829.594] (-828.257) (-834.709) -- 0:00:33
449500 -- (-827.420) (-833.110) (-828.045) [-829.207] * (-829.635) (-828.411) [-830.013] (-828.253) -- 0:00:33
450000 -- (-828.695) [-827.334] (-827.857) (-829.388) * (-829.548) (-831.662) (-829.599) [-830.307] -- 0:00:33
Average standard deviation of split frequencies: 0.012245
450500 -- (-829.666) (-827.699) (-827.020) [-828.562] * (-829.389) (-828.087) [-831.461] (-827.278) -- 0:00:32
451000 -- (-828.603) [-828.264] (-827.198) (-828.430) * (-827.446) (-831.089) (-828.527) [-829.337] -- 0:00:32
451500 -- (-828.718) (-828.604) (-830.510) [-828.869] * [-827.468] (-829.617) (-829.012) (-829.764) -- 0:00:32
452000 -- [-828.957] (-828.854) (-828.861) (-829.747) * (-829.987) [-827.056] (-829.228) (-830.354) -- 0:00:32
452500 -- (-829.010) (-830.072) (-830.436) [-829.936] * (-829.565) [-828.833] (-830.131) (-828.609) -- 0:00:32
453000 -- [-829.741] (-834.437) (-827.971) (-826.950) * (-834.422) [-828.308] (-831.838) (-828.506) -- 0:00:32
453500 -- (-826.834) (-829.563) (-828.336) [-826.931] * (-828.310) (-831.865) (-827.675) [-830.930] -- 0:00:32
454000 -- (-827.475) (-833.060) [-828.779] (-829.835) * (-828.311) (-828.516) (-834.443) [-829.760] -- 0:00:32
454500 -- (-830.459) [-830.050] (-830.380) (-832.318) * (-829.453) [-828.516] (-836.666) (-828.367) -- 0:00:32
455000 -- (-827.852) [-829.153] (-829.250) (-829.886) * [-827.920] (-828.711) (-830.458) (-830.093) -- 0:00:32
Average standard deviation of split frequencies: 0.012709
455500 -- (-827.197) (-829.566) [-830.256] (-829.274) * [-827.572] (-827.456) (-829.724) (-831.024) -- 0:00:32
456000 -- (-829.057) (-829.869) [-830.926] (-830.247) * (-827.267) [-827.494] (-827.576) (-828.103) -- 0:00:32
456500 -- (-836.432) (-830.237) (-827.740) [-828.544] * (-827.178) (-830.130) (-831.098) [-827.978] -- 0:00:32
457000 -- [-832.229] (-827.444) (-836.537) (-827.886) * (-826.736) (-829.110) [-830.034] (-827.409) -- 0:00:32
457500 -- [-829.628] (-832.200) (-828.938) (-829.666) * (-829.624) (-829.151) [-829.552] (-827.711) -- 0:00:32
458000 -- (-828.699) (-828.946) [-827.905] (-832.730) * (-827.115) (-828.901) (-827.906) [-828.773] -- 0:00:31
458500 -- (-829.421) (-828.309) [-829.438] (-828.405) * (-827.092) (-834.348) (-832.461) [-828.198] -- 0:00:31
459000 -- [-827.821] (-833.906) (-828.213) (-832.559) * (-830.787) (-827.500) (-829.224) [-828.226] -- 0:00:31
459500 -- (-828.180) [-829.202] (-828.273) (-829.499) * [-830.562] (-828.271) (-827.717) (-828.223) -- 0:00:32
460000 -- (-827.974) (-828.462) [-828.075] (-828.990) * (-829.910) (-829.240) (-831.352) [-831.127] -- 0:00:32
Average standard deviation of split frequencies: 0.012520
460500 -- (-827.792) [-827.962] (-830.316) (-830.908) * (-830.549) [-826.724] (-830.848) (-832.331) -- 0:00:32
461000 -- [-827.420] (-828.008) (-828.173) (-834.088) * (-828.797) (-826.725) (-830.561) [-832.873] -- 0:00:32
461500 -- (-830.526) [-829.858] (-828.337) (-828.701) * (-829.216) [-827.375] (-830.407) (-832.806) -- 0:00:32
462000 -- (-830.098) [-830.101] (-830.268) (-828.290) * (-828.829) (-831.589) (-833.909) [-828.819] -- 0:00:32
462500 -- (-835.062) (-828.614) [-829.876] (-827.481) * (-828.611) (-828.916) [-829.127] (-829.988) -- 0:00:32
463000 -- (-828.041) (-828.113) (-827.570) [-827.635] * (-828.723) (-829.166) [-829.406] (-831.032) -- 0:00:32
463500 -- (-827.559) [-827.894] (-830.048) (-827.320) * (-828.730) (-827.711) [-827.790] (-831.487) -- 0:00:32
464000 -- (-828.054) [-827.627] (-828.222) (-829.944) * (-827.496) [-830.143] (-827.053) (-831.317) -- 0:00:32
464500 -- [-828.420] (-826.917) (-828.757) (-831.765) * (-828.950) (-831.113) (-829.192) [-827.881] -- 0:00:32
465000 -- (-828.350) [-828.474] (-829.574) (-829.928) * [-828.822] (-827.850) (-829.127) (-829.085) -- 0:00:32
Average standard deviation of split frequencies: 0.012318
465500 -- [-828.579] (-828.330) (-828.993) (-830.568) * (-829.451) (-832.338) [-830.530] (-830.478) -- 0:00:32
466000 -- (-828.766) (-827.978) [-828.470] (-830.956) * (-829.459) [-828.882] (-830.110) (-829.473) -- 0:00:32
466500 -- (-829.717) [-830.400] (-831.897) (-830.412) * (-828.806) [-828.675] (-830.815) (-829.488) -- 0:00:32
467000 -- (-830.628) (-829.115) [-827.251] (-833.465) * (-829.083) (-828.046) (-828.567) [-830.118] -- 0:00:31
467500 -- (-831.421) [-827.752] (-830.101) (-828.106) * [-829.552] (-828.370) (-828.730) (-827.398) -- 0:00:31
468000 -- (-831.671) (-828.568) [-832.906] (-834.269) * (-829.784) [-829.630] (-830.059) (-828.059) -- 0:00:31
468500 -- (-830.057) (-831.900) [-829.455] (-833.826) * [-829.623] (-829.119) (-827.881) (-832.303) -- 0:00:31
469000 -- (-830.802) (-831.261) [-831.196] (-835.575) * [-829.884] (-833.135) (-833.085) (-826.793) -- 0:00:31
469500 -- (-829.354) [-829.799] (-828.890) (-829.197) * (-831.811) (-827.770) (-832.044) [-828.881] -- 0:00:31
470000 -- [-830.584] (-830.799) (-831.736) (-829.816) * [-831.631] (-828.933) (-829.950) (-827.698) -- 0:00:31
Average standard deviation of split frequencies: 0.012520
470500 -- (-827.664) (-830.985) [-831.290] (-829.795) * (-832.126) (-827.443) (-828.952) [-831.986] -- 0:00:31
471000 -- [-827.805] (-828.696) (-827.673) (-833.409) * (-827.539) (-829.158) [-831.592] (-830.133) -- 0:00:31
471500 -- (-832.294) (-828.708) (-828.588) [-827.971] * (-827.488) [-827.231] (-829.650) (-827.885) -- 0:00:31
472000 -- (-831.526) (-828.978) (-829.730) [-830.636] * (-828.649) (-831.327) [-828.895] (-830.153) -- 0:00:31
472500 -- [-828.084] (-834.490) (-830.391) (-830.596) * (-829.885) (-831.017) (-826.970) [-827.828] -- 0:00:31
473000 -- (-827.140) (-830.270) (-830.237) [-828.885] * (-828.059) (-830.089) [-829.231] (-830.401) -- 0:00:31
473500 -- (-829.564) (-834.147) [-830.205] (-828.456) * [-827.250] (-831.202) (-828.564) (-830.473) -- 0:00:31
474000 -- [-827.264] (-827.404) (-828.580) (-828.706) * (-830.658) (-833.379) (-828.221) [-829.511] -- 0:00:31
474500 -- (-829.988) (-829.181) [-829.646] (-829.754) * (-828.238) (-829.955) (-827.564) [-830.650] -- 0:00:31
475000 -- (-827.618) [-827.855] (-829.330) (-829.497) * (-829.418) (-827.303) [-827.118] (-829.658) -- 0:00:30
Average standard deviation of split frequencies: 0.012874
475500 -- (-827.636) [-828.325] (-830.241) (-827.843) * (-828.591) (-828.764) [-829.111] (-830.174) -- 0:00:31
476000 -- (-828.580) (-829.562) (-829.402) [-829.571] * (-828.132) (-833.541) [-829.608] (-829.686) -- 0:00:31
476500 -- (-834.120) (-828.577) [-828.528] (-831.954) * (-829.239) (-829.902) [-829.434] (-830.699) -- 0:00:31
477000 -- (-828.930) [-827.804] (-828.784) (-830.026) * (-833.642) (-829.838) [-828.548] (-829.209) -- 0:00:31
477500 -- [-831.048] (-828.389) (-833.993) (-827.447) * (-831.483) (-828.711) [-829.116] (-828.662) -- 0:00:31
478000 -- (-828.495) (-827.230) [-830.455] (-827.019) * (-829.467) (-827.497) [-827.000] (-830.506) -- 0:00:31
478500 -- (-829.418) (-830.458) (-831.011) [-827.016] * (-828.843) (-829.410) [-827.874] (-829.787) -- 0:00:31
479000 -- (-827.822) (-835.169) (-827.226) [-828.409] * (-828.329) (-829.673) (-827.161) [-827.305] -- 0:00:31
479500 -- (-827.437) (-828.380) [-830.153] (-827.523) * [-828.345] (-828.927) (-827.548) (-829.546) -- 0:00:31
480000 -- [-829.460] (-828.064) (-828.330) (-829.690) * [-828.607] (-832.416) (-827.263) (-830.981) -- 0:00:31
Average standard deviation of split frequencies: 0.012749
480500 -- (-829.857) [-830.141] (-828.484) (-830.864) * [-827.462] (-834.105) (-827.342) (-829.874) -- 0:00:31
481000 -- (-827.800) (-829.187) [-828.792] (-830.723) * (-832.778) (-829.002) (-828.109) [-830.235] -- 0:00:31
481500 -- (-827.225) [-828.133] (-832.084) (-827.835) * (-830.349) [-828.788] (-826.697) (-830.696) -- 0:00:31
482000 -- (-827.728) [-829.112] (-834.432) (-829.702) * (-829.819) (-833.229) [-827.588] (-828.325) -- 0:00:31
482500 -- (-827.709) (-828.641) [-827.834] (-831.680) * (-829.823) (-829.083) [-829.763] (-827.879) -- 0:00:31
483000 -- [-827.307] (-829.458) (-830.481) (-831.435) * (-830.055) (-831.702) (-827.386) [-827.311] -- 0:00:31
483500 -- (-828.233) (-829.461) (-828.405) [-829.711] * (-830.940) (-828.498) (-829.418) [-829.115] -- 0:00:30
484000 -- [-827.289] (-826.794) (-828.878) (-830.614) * (-830.366) (-827.685) [-829.942] (-829.075) -- 0:00:30
484500 -- (-827.540) [-827.778] (-827.829) (-833.353) * (-828.148) (-838.711) (-828.482) [-830.950] -- 0:00:30
485000 -- (-829.038) (-836.547) [-831.175] (-831.299) * (-828.463) (-833.911) [-828.637] (-828.770) -- 0:00:30
Average standard deviation of split frequencies: 0.012610
485500 -- (-829.378) [-828.044] (-831.817) (-829.094) * (-829.856) (-829.598) (-828.723) [-828.008] -- 0:00:30
486000 -- (-827.858) (-833.107) [-828.945] (-828.978) * [-829.060] (-829.296) (-827.104) (-827.650) -- 0:00:30
486500 -- (-831.039) [-827.603] (-829.630) (-832.465) * (-828.301) (-829.562) (-827.816) [-831.041] -- 0:00:30
487000 -- [-830.343] (-828.509) (-828.366) (-830.251) * (-828.118) [-827.584] (-829.761) (-830.602) -- 0:00:30
487500 -- (-832.455) [-830.863] (-829.151) (-830.331) * (-829.189) (-827.942) [-828.734] (-830.714) -- 0:00:30
488000 -- (-827.328) (-828.020) [-828.839] (-829.850) * (-828.377) (-832.688) [-828.485] (-828.966) -- 0:00:30
488500 -- (-827.339) (-827.922) [-828.260] (-829.464) * (-828.285) (-827.915) (-828.853) [-827.094] -- 0:00:30
489000 -- (-828.532) (-828.872) [-827.982] (-827.253) * (-828.251) [-828.146] (-830.667) (-826.992) -- 0:00:30
489500 -- (-827.877) (-829.910) (-830.244) [-827.107] * (-831.440) (-828.789) (-830.812) [-829.137] -- 0:00:30
490000 -- (-830.281) (-830.433) (-829.508) [-829.748] * (-828.892) [-830.896] (-827.922) (-829.437) -- 0:00:30
Average standard deviation of split frequencies: 0.012490
490500 -- (-829.529) (-828.222) (-829.064) [-830.062] * (-827.151) (-827.693) (-828.297) [-831.266] -- 0:00:30
491000 -- (-831.233) (-828.595) (-830.651) [-829.555] * [-829.313] (-827.692) (-830.234) (-830.480) -- 0:00:30
491500 -- (-828.959) [-830.432] (-832.535) (-830.639) * (-830.047) (-829.184) (-827.925) [-827.628] -- 0:00:30
492000 -- (-831.321) (-829.918) (-833.047) [-828.950] * (-828.126) [-828.038] (-829.392) (-831.730) -- 0:00:29
492500 -- (-830.582) (-832.080) (-829.770) [-827.911] * (-827.416) [-828.044] (-829.564) (-830.185) -- 0:00:30
493000 -- (-827.941) (-830.940) (-829.889) [-827.997] * [-827.708] (-828.034) (-829.094) (-829.906) -- 0:00:30
493500 -- (-828.192) (-830.988) [-827.851] (-828.498) * [-828.342] (-829.206) (-827.985) (-834.795) -- 0:00:30
494000 -- (-826.870) (-828.085) (-829.447) [-833.955] * [-827.947] (-830.585) (-827.248) (-827.810) -- 0:00:30
494500 -- [-828.163] (-829.218) (-826.907) (-829.644) * (-829.213) [-829.354] (-827.233) (-833.876) -- 0:00:30
495000 -- (-827.254) (-828.201) [-827.672] (-829.651) * (-827.112) (-828.878) [-827.143] (-832.401) -- 0:00:30
Average standard deviation of split frequencies: 0.012415
495500 -- (-828.539) [-830.942] (-831.030) (-830.496) * (-831.163) (-827.984) [-828.911] (-829.478) -- 0:00:30
496000 -- [-827.909] (-830.189) (-830.864) (-827.778) * [-834.117] (-827.647) (-831.352) (-827.203) -- 0:00:30
496500 -- (-827.697) [-827.084] (-828.008) (-831.244) * (-829.937) (-829.892) (-827.592) [-831.132] -- 0:00:30
497000 -- (-827.465) [-831.505] (-828.946) (-829.749) * (-829.926) (-827.618) [-827.475] (-828.347) -- 0:00:30
497500 -- (-828.187) [-829.547] (-829.315) (-828.290) * (-830.139) [-828.301] (-830.531) (-827.534) -- 0:00:30
498000 -- (-827.456) (-826.889) (-830.243) [-829.724] * (-830.421) (-829.768) (-828.592) [-829.738] -- 0:00:30
498500 -- (-830.266) (-829.011) (-831.982) [-828.644] * (-828.804) (-829.512) (-829.135) [-833.961] -- 0:00:30
499000 -- [-827.502] (-828.500) (-832.461) (-829.356) * [-827.865] (-829.033) (-829.308) (-834.527) -- 0:00:30
499500 -- (-828.134) [-828.748] (-828.298) (-830.185) * (-830.921) (-830.142) [-829.535] (-829.976) -- 0:00:30
500000 -- (-830.925) (-828.481) [-829.204] (-831.442) * (-830.911) [-829.250] (-828.357) (-827.767) -- 0:00:30
Average standard deviation of split frequencies: 0.012181
500500 -- (-826.931) [-827.828] (-828.758) (-830.002) * (-829.256) [-829.414] (-829.993) (-832.540) -- 0:00:29
501000 -- (-828.150) [-827.490] (-830.403) (-830.767) * (-828.322) (-827.436) (-832.080) [-827.957] -- 0:00:29
501500 -- [-828.939] (-827.049) (-831.663) (-828.909) * (-828.135) (-828.221) (-830.712) [-830.679] -- 0:00:29
502000 -- (-827.631) [-828.174] (-827.925) (-828.715) * (-832.206) [-829.853] (-830.135) (-830.109) -- 0:00:29
502500 -- (-831.751) (-829.112) (-829.208) [-829.842] * [-829.406] (-828.547) (-833.629) (-827.893) -- 0:00:29
503000 -- (-827.801) (-827.341) (-829.513) [-827.768] * (-828.119) (-829.900) (-831.352) [-829.334] -- 0:00:29
503500 -- [-827.127] (-828.959) (-827.291) (-827.966) * (-832.504) [-829.147] (-830.506) (-829.389) -- 0:00:29
504000 -- (-830.649) (-829.352) (-827.944) [-827.054] * (-831.326) (-828.112) (-830.481) [-830.072] -- 0:00:29
504500 -- (-830.072) (-830.657) [-829.104] (-834.491) * (-835.194) (-829.746) (-831.140) [-828.766] -- 0:00:29
505000 -- (-827.588) [-831.182] (-831.620) (-829.701) * (-829.376) (-834.683) (-829.576) [-833.407] -- 0:00:29
Average standard deviation of split frequencies: 0.011937
505500 -- (-829.299) (-834.741) (-830.110) [-828.096] * [-828.224] (-828.840) (-832.573) (-829.260) -- 0:00:29
506000 -- (-827.707) (-829.799) (-827.675) [-831.422] * (-828.039) (-829.126) (-829.516) [-827.698] -- 0:00:29
506500 -- (-828.555) [-830.838] (-828.783) (-827.801) * (-832.392) (-828.924) [-827.044] (-828.896) -- 0:00:29
507000 -- [-829.486] (-828.078) (-831.753) (-831.625) * (-827.631) (-829.260) [-827.963] (-830.267) -- 0:00:29
507500 -- [-828.621] (-832.365) (-827.922) (-830.333) * (-828.016) [-828.158] (-828.477) (-829.076) -- 0:00:29
508000 -- [-829.479] (-827.851) (-829.723) (-829.736) * (-828.048) (-829.263) (-828.587) [-829.074] -- 0:00:29
508500 -- (-828.563) (-828.058) [-830.050] (-829.286) * [-828.722] (-832.551) (-828.595) (-836.194) -- 0:00:28
509000 -- (-827.416) (-829.299) (-829.728) [-827.978] * (-834.444) (-830.558) [-830.901] (-828.165) -- 0:00:29
509500 -- (-833.357) (-827.544) [-828.106] (-827.145) * (-832.925) (-830.776) (-828.021) [-829.659] -- 0:00:29
510000 -- (-829.691) (-828.425) [-827.209] (-826.851) * (-834.092) [-827.584] (-828.567) (-830.382) -- 0:00:29
Average standard deviation of split frequencies: 0.012174
510500 -- (-830.342) (-829.429) (-826.890) [-829.212] * [-827.621] (-829.163) (-828.884) (-829.800) -- 0:00:29
511000 -- (-829.250) [-827.881] (-827.818) (-830.011) * [-828.977] (-830.195) (-829.729) (-830.495) -- 0:00:29
511500 -- (-832.544) [-827.999] (-827.483) (-832.493) * (-827.522) (-829.247) [-828.962] (-829.415) -- 0:00:29
512000 -- (-830.345) (-830.784) (-833.572) [-827.553] * (-828.200) (-828.488) (-829.552) [-829.497] -- 0:00:29
512500 -- (-829.084) [-828.784] (-829.719) (-834.696) * (-827.995) (-828.907) (-828.735) [-827.789] -- 0:00:29
513000 -- (-827.782) (-829.883) [-831.921] (-827.204) * (-829.716) (-828.677) (-827.648) [-827.600] -- 0:00:29
513500 -- (-829.715) (-829.261) (-828.036) [-827.449] * (-826.946) (-828.665) [-828.176] (-828.313) -- 0:00:29
514000 -- (-830.862) (-835.681) (-832.300) [-831.103] * (-830.172) (-829.163) [-828.627] (-827.430) -- 0:00:29
514500 -- (-831.683) (-828.832) [-827.833] (-828.573) * (-830.949) [-829.429] (-827.798) (-828.785) -- 0:00:29
515000 -- (-833.329) (-827.552) (-831.148) [-829.927] * (-834.035) (-829.515) (-829.920) [-829.762] -- 0:00:29
Average standard deviation of split frequencies: 0.012219
515500 -- [-833.330] (-829.514) (-830.088) (-830.319) * [-830.263] (-827.856) (-834.253) (-827.217) -- 0:00:29
516000 -- [-830.210] (-830.492) (-830.197) (-832.023) * [-830.290] (-827.315) (-832.676) (-831.719) -- 0:00:29
516500 -- (-829.418) (-830.137) (-831.709) [-827.406] * [-829.485] (-829.979) (-829.460) (-829.011) -- 0:00:29
517000 -- (-828.363) (-829.843) (-831.731) [-828.595] * (-830.528) (-827.685) (-830.223) [-827.250] -- 0:00:28
517500 -- (-833.073) (-828.297) (-828.285) [-828.042] * (-827.236) (-830.005) (-828.722) [-829.058] -- 0:00:28
518000 -- (-828.020) [-827.941] (-828.586) (-828.759) * (-830.308) (-829.104) (-829.617) [-827.461] -- 0:00:28
518500 -- (-832.910) (-828.477) (-829.632) [-827.767] * (-831.539) (-828.629) [-830.219] (-827.098) -- 0:00:28
519000 -- (-828.329) (-828.887) (-830.648) [-829.106] * (-828.602) (-828.534) (-827.629) [-827.441] -- 0:00:28
519500 -- (-827.737) (-829.826) [-827.050] (-828.027) * [-832.215] (-829.257) (-831.610) (-827.404) -- 0:00:28
520000 -- (-828.512) [-831.814] (-828.178) (-828.010) * [-829.415] (-829.223) (-835.606) (-827.924) -- 0:00:28
Average standard deviation of split frequencies: 0.012166
520500 -- (-828.723) [-828.363] (-828.916) (-827.860) * (-828.665) [-829.223] (-832.200) (-827.310) -- 0:00:28
521000 -- [-827.737] (-829.024) (-827.504) (-831.337) * (-831.150) (-830.558) [-829.573] (-827.749) -- 0:00:28
521500 -- [-830.310] (-829.154) (-829.816) (-827.842) * [-827.682] (-835.915) (-829.851) (-827.604) -- 0:00:28
522000 -- (-829.464) [-829.565] (-827.623) (-829.319) * [-830.647] (-827.603) (-828.109) (-829.952) -- 0:00:28
522500 -- (-827.718) (-830.982) (-829.927) [-827.156] * (-829.693) [-827.767] (-828.544) (-829.300) -- 0:00:28
523000 -- (-829.571) (-833.493) (-828.369) [-827.638] * [-830.329] (-830.504) (-827.336) (-827.349) -- 0:00:28
523500 -- [-829.168] (-831.245) (-829.823) (-827.371) * (-831.068) (-828.008) (-830.477) [-827.277] -- 0:00:28
524000 -- (-830.455) (-837.700) [-827.626] (-827.394) * (-832.252) [-827.732] (-828.324) (-832.352) -- 0:00:28
524500 -- [-830.144] (-833.028) (-827.500) (-828.557) * (-832.099) (-827.411) [-827.814] (-830.187) -- 0:00:28
525000 -- [-830.063] (-827.896) (-829.014) (-832.595) * (-828.875) (-834.243) [-829.071] (-830.157) -- 0:00:28
Average standard deviation of split frequencies: 0.011819
525500 -- (-834.567) (-830.194) (-829.002) [-828.300] * (-830.816) [-828.926] (-828.484) (-831.082) -- 0:00:28
526000 -- (-834.611) [-832.154] (-827.640) (-830.792) * (-829.851) [-829.392] (-828.028) (-831.457) -- 0:00:28
526500 -- (-828.042) (-833.854) [-827.476] (-828.016) * (-831.163) [-829.856] (-830.001) (-833.921) -- 0:00:28
527000 -- [-828.727] (-830.070) (-828.274) (-828.566) * (-828.468) [-832.191] (-828.516) (-831.995) -- 0:00:28
527500 -- (-829.921) (-829.016) [-828.628] (-830.080) * (-827.489) [-830.016] (-827.567) (-827.693) -- 0:00:28
528000 -- (-828.769) (-828.808) (-830.407) [-828.748] * (-827.601) (-828.107) [-828.426] (-828.333) -- 0:00:28
528500 -- (-829.025) [-827.852] (-827.636) (-832.291) * (-828.320) [-828.883] (-827.982) (-829.904) -- 0:00:28
529000 -- [-827.858] (-828.488) (-829.536) (-827.343) * [-831.355] (-830.406) (-827.413) (-827.959) -- 0:00:28
529500 -- (-828.783) [-830.536] (-830.390) (-828.605) * (-830.017) (-830.271) (-830.423) [-830.000] -- 0:00:28
530000 -- [-829.262] (-830.781) (-832.028) (-830.866) * [-830.832] (-830.267) (-833.660) (-829.241) -- 0:00:28
Average standard deviation of split frequencies: 0.011548
530500 -- (-831.422) [-827.933] (-832.919) (-830.071) * (-827.330) [-829.060] (-832.014) (-830.558) -- 0:00:28
531000 -- [-828.476] (-831.407) (-828.255) (-827.833) * [-828.506] (-832.765) (-835.445) (-831.277) -- 0:00:28
531500 -- (-828.273) [-829.094] (-828.109) (-832.079) * (-828.224) [-829.162] (-828.132) (-827.584) -- 0:00:28
532000 -- (-830.970) (-827.349) (-830.459) [-829.483] * (-827.800) (-828.305) [-829.495] (-827.746) -- 0:00:28
532500 -- (-829.509) (-829.011) [-829.025] (-831.973) * (-828.457) (-829.121) (-831.482) [-829.447] -- 0:00:28
533000 -- (-827.532) (-827.168) (-827.577) [-828.243] * (-830.598) (-827.362) (-829.018) [-828.309] -- 0:00:28
533500 -- (-826.766) (-827.953) [-828.025] (-827.559) * (-827.050) [-827.539] (-829.192) (-830.869) -- 0:00:27
534000 -- (-828.420) (-828.466) (-827.092) [-828.907] * [-828.007] (-830.484) (-831.601) (-830.085) -- 0:00:27
534500 -- [-828.153] (-830.479) (-837.011) (-828.612) * [-829.742] (-830.098) (-827.268) (-828.538) -- 0:00:27
535000 -- (-828.301) (-827.807) [-833.611] (-829.175) * (-831.046) [-828.370] (-828.109) (-827.060) -- 0:00:27
Average standard deviation of split frequencies: 0.010994
535500 -- (-827.732) [-826.835] (-830.542) (-829.932) * (-830.110) [-829.404] (-828.179) (-827.618) -- 0:00:27
536000 -- (-829.475) (-829.151) [-829.821] (-827.492) * (-829.459) (-831.530) [-829.665] (-828.611) -- 0:00:27
536500 -- [-826.899] (-829.763) (-829.212) (-829.543) * (-829.459) (-831.586) (-827.927) [-827.117] -- 0:00:27
537000 -- (-827.298) (-829.868) [-830.195] (-828.000) * [-827.804] (-832.366) (-830.026) (-827.974) -- 0:00:27
537500 -- (-827.786) (-828.911) [-831.226] (-828.911) * [-832.246] (-831.846) (-830.494) (-827.515) -- 0:00:27
538000 -- (-828.286) (-828.737) [-829.914] (-830.205) * (-834.061) [-829.646] (-830.005) (-827.589) -- 0:00:27
538500 -- (-831.018) (-830.268) (-830.347) [-830.262] * (-835.505) (-829.166) [-830.393] (-828.419) -- 0:00:27
539000 -- [-829.061] (-831.638) (-828.082) (-831.621) * (-830.046) (-832.169) (-828.624) [-827.146] -- 0:00:27
539500 -- [-827.665] (-829.148) (-828.028) (-828.711) * (-827.793) (-838.403) [-828.151] (-828.673) -- 0:00:27
540000 -- (-828.846) [-831.166] (-828.214) (-827.737) * (-827.404) (-828.712) [-827.477] (-829.112) -- 0:00:27
Average standard deviation of split frequencies: 0.011280
540500 -- [-828.685] (-828.787) (-828.382) (-829.725) * [-827.951] (-829.351) (-827.231) (-830.737) -- 0:00:27
541000 -- (-830.306) (-833.206) (-830.456) [-829.291] * (-833.065) (-828.479) (-832.225) [-827.128] -- 0:00:27
541500 -- [-827.872] (-828.145) (-833.092) (-828.986) * (-829.226) (-828.138) [-829.315] (-827.164) -- 0:00:27
542000 -- [-830.591] (-829.402) (-832.096) (-827.763) * (-827.474) [-829.152] (-828.033) (-828.039) -- 0:00:27
542500 -- (-829.976) (-830.306) (-828.288) [-827.984] * (-830.076) [-826.818] (-829.062) (-827.058) -- 0:00:27
543000 -- (-829.604) [-829.922] (-828.215) (-833.946) * [-830.074] (-830.970) (-831.507) (-828.036) -- 0:00:27
543500 -- (-830.722) (-828.411) [-828.215] (-828.340) * (-830.046) [-829.617] (-830.461) (-832.491) -- 0:00:27
544000 -- (-829.797) (-828.831) (-828.805) [-829.073] * (-827.425) (-828.970) (-831.862) [-828.573] -- 0:00:27
544500 -- (-829.783) (-828.174) [-828.075] (-828.391) * (-827.788) (-829.239) [-827.793] (-827.371) -- 0:00:27
545000 -- [-827.955] (-827.884) (-830.224) (-829.312) * (-829.198) (-827.689) [-827.644] (-827.354) -- 0:00:27
Average standard deviation of split frequencies: 0.011062
545500 -- (-827.928) (-829.346) (-828.214) [-828.393] * (-828.481) (-830.684) [-827.934] (-829.532) -- 0:00:27
546000 -- (-827.659) (-831.505) (-827.204) [-830.534] * [-828.296] (-830.391) (-830.411) (-833.378) -- 0:00:27
546500 -- (-828.959) [-826.905] (-832.878) (-836.205) * (-827.606) [-827.858] (-830.307) (-832.480) -- 0:00:27
547000 -- (-829.112) [-827.238] (-830.761) (-829.293) * (-827.701) [-829.371] (-830.541) (-829.087) -- 0:00:27
547500 -- (-828.371) (-827.524) [-832.400] (-827.833) * (-829.743) [-828.886] (-828.430) (-828.181) -- 0:00:27
548000 -- [-827.924] (-827.573) (-827.230) (-828.820) * (-830.856) [-830.001] (-830.324) (-828.032) -- 0:00:27
548500 -- (-829.280) [-829.672] (-828.148) (-828.397) * [-830.866] (-828.143) (-827.522) (-827.228) -- 0:00:27
549000 -- (-829.020) [-830.404] (-827.599) (-829.592) * (-828.944) (-831.123) [-827.228] (-829.071) -- 0:00:27
549500 -- (-833.891) (-830.857) [-827.829] (-832.131) * [-829.294] (-832.304) (-830.202) (-827.468) -- 0:00:27
550000 -- (-831.998) (-830.419) (-828.515) [-829.278] * (-826.830) (-830.720) (-830.289) [-829.453] -- 0:00:27
Average standard deviation of split frequencies: 0.010915
550500 -- (-833.848) (-828.487) (-829.392) [-828.369] * (-829.870) (-829.272) (-828.232) [-831.358] -- 0:00:26
551000 -- (-827.985) (-831.156) [-828.264] (-828.856) * (-828.335) (-829.927) [-828.347] (-828.840) -- 0:00:26
551500 -- [-827.888] (-828.951) (-828.037) (-829.147) * (-829.172) (-833.256) [-829.107] (-830.356) -- 0:00:26
552000 -- (-830.763) (-827.776) (-828.237) [-831.334] * (-829.645) (-833.058) (-827.647) [-830.443] -- 0:00:26
552500 -- (-828.021) (-831.816) [-830.155] (-831.456) * (-832.719) (-830.588) [-828.263] (-831.796) -- 0:00:26
553000 -- [-828.083] (-828.405) (-829.849) (-828.383) * (-835.893) (-827.926) [-830.058] (-828.408) -- 0:00:26
553500 -- (-831.318) (-827.548) [-830.995] (-829.258) * (-831.638) (-829.292) (-833.768) [-827.380] -- 0:00:26
554000 -- (-827.240) (-828.290) (-831.215) [-828.149] * [-832.426] (-827.055) (-831.653) (-829.831) -- 0:00:26
554500 -- (-829.035) [-828.991] (-832.168) (-830.932) * (-829.119) [-828.437] (-830.137) (-828.566) -- 0:00:26
555000 -- (-829.394) [-829.753] (-827.786) (-829.885) * (-828.558) (-830.959) (-830.725) [-828.302] -- 0:00:26
Average standard deviation of split frequencies: 0.010015
555500 -- (-829.163) [-828.703] (-828.315) (-829.116) * (-827.741) (-829.931) (-830.899) [-829.456] -- 0:00:26
556000 -- [-829.735] (-829.030) (-831.001) (-830.956) * (-828.976) [-827.705] (-827.446) (-829.910) -- 0:00:26
556500 -- [-828.748] (-827.611) (-827.901) (-832.868) * [-828.878] (-832.277) (-831.768) (-831.038) -- 0:00:26
557000 -- [-830.457] (-828.814) (-828.687) (-832.710) * (-827.251) (-832.235) (-831.645) [-827.687] -- 0:00:26
557500 -- [-830.106] (-829.435) (-828.992) (-828.760) * [-827.761] (-834.500) (-838.138) (-827.704) -- 0:00:26
558000 -- (-828.954) [-830.007] (-829.379) (-827.544) * (-831.937) (-833.645) [-829.015] (-829.743) -- 0:00:26
558500 -- (-828.699) (-826.884) (-827.943) [-828.415] * (-827.655) (-830.792) [-829.557] (-831.493) -- 0:00:26
559000 -- (-830.172) (-827.407) (-827.521) [-829.310] * (-828.162) [-827.607] (-830.564) (-831.972) -- 0:00:26
559500 -- [-828.940] (-829.103) (-830.636) (-829.587) * (-828.590) (-830.088) (-829.701) [-830.490] -- 0:00:26
560000 -- (-831.157) [-830.959] (-832.223) (-828.564) * [-829.850] (-829.279) (-829.799) (-828.312) -- 0:00:26
Average standard deviation of split frequencies: 0.010247
560500 -- (-830.170) (-829.601) (-828.878) [-829.792] * (-829.944) (-830.776) [-826.809] (-829.281) -- 0:00:26
561000 -- (-830.455) (-830.060) [-829.025] (-827.809) * (-829.093) (-828.194) [-829.049] (-826.908) -- 0:00:26
561500 -- (-834.286) (-827.960) [-829.978] (-833.360) * (-827.722) [-828.198] (-829.544) (-828.052) -- 0:00:26
562000 -- (-827.902) [-828.219] (-828.624) (-827.725) * [-829.998] (-827.860) (-829.048) (-828.766) -- 0:00:26
562500 -- (-828.942) [-829.104] (-830.447) (-828.646) * [-829.467] (-828.624) (-827.902) (-829.367) -- 0:00:26
563000 -- (-829.535) (-828.480) [-829.217] (-828.701) * (-830.045) (-828.919) [-828.011] (-829.650) -- 0:00:26
563500 -- (-828.637) (-828.834) (-831.167) [-828.261] * [-828.186] (-830.418) (-826.778) (-831.271) -- 0:00:26
564000 -- (-828.032) (-829.699) (-826.658) [-829.238] * [-829.405] (-827.910) (-826.984) (-830.203) -- 0:00:26
564500 -- (-829.585) (-830.065) [-827.135] (-832.412) * (-830.578) (-827.755) [-828.514] (-829.749) -- 0:00:26
565000 -- (-832.162) (-829.385) [-829.114] (-827.276) * [-831.135] (-828.003) (-827.580) (-829.183) -- 0:00:26
Average standard deviation of split frequencies: 0.009890
565500 -- (-834.451) [-828.675] (-826.978) (-827.232) * (-828.938) [-829.249] (-829.901) (-832.946) -- 0:00:26
566000 -- (-835.154) (-829.483) (-828.080) [-827.776] * [-830.413] (-833.636) (-833.642) (-829.320) -- 0:00:26
566500 -- (-834.228) (-830.968) (-832.203) [-827.985] * (-831.453) [-832.449] (-828.392) (-828.742) -- 0:00:26
567000 -- (-828.347) [-828.868] (-827.983) (-827.526) * (-831.445) (-830.351) [-828.670] (-827.562) -- 0:00:25
567500 -- [-827.606] (-827.750) (-833.557) (-828.802) * (-829.373) [-828.691] (-827.471) (-827.359) -- 0:00:25
568000 -- (-830.005) [-827.550] (-830.860) (-829.666) * (-828.128) (-830.240) [-827.222] (-829.402) -- 0:00:25
568500 -- [-828.185] (-827.824) (-831.851) (-829.238) * [-828.674] (-829.654) (-828.528) (-828.633) -- 0:00:25
569000 -- (-829.227) (-827.080) [-830.518] (-827.574) * [-827.692] (-832.695) (-829.211) (-829.008) -- 0:00:25
569500 -- [-829.495] (-829.356) (-828.083) (-834.525) * (-830.823) (-833.645) (-831.376) [-830.821] -- 0:00:25
570000 -- [-828.015] (-828.217) (-827.794) (-829.772) * [-829.862] (-830.644) (-827.547) (-828.492) -- 0:00:25
Average standard deviation of split frequencies: 0.009913
570500 -- (-828.488) (-829.714) [-837.659] (-829.320) * (-829.344) (-833.877) [-828.189] (-827.926) -- 0:00:25
571000 -- (-831.302) (-831.427) (-831.171) [-829.553] * (-827.300) [-829.652] (-830.069) (-827.750) -- 0:00:25
571500 -- (-828.683) (-829.027) (-828.819) [-827.643] * [-827.339] (-829.704) (-829.500) (-830.935) -- 0:00:25
572000 -- (-827.955) (-833.046) [-828.721] (-827.551) * (-829.581) [-828.301] (-827.269) (-827.386) -- 0:00:25
572500 -- [-828.847] (-830.709) (-828.918) (-827.941) * (-827.412) (-830.122) [-827.484] (-828.827) -- 0:00:25
573000 -- (-827.134) (-829.120) (-831.249) [-828.020] * (-827.540) [-828.916] (-831.334) (-831.597) -- 0:00:25
573500 -- [-829.100] (-834.870) (-831.493) (-828.427) * (-828.989) (-831.594) (-828.044) [-829.674] -- 0:00:25
574000 -- (-827.536) (-830.864) [-827.171] (-827.267) * (-829.384) (-832.342) [-827.491] (-827.243) -- 0:00:25
574500 -- (-826.987) (-828.829) (-829.584) [-828.635] * (-831.523) [-828.166] (-828.741) (-828.455) -- 0:00:25
575000 -- (-828.364) (-829.040) [-829.184] (-828.782) * (-828.628) (-829.611) [-830.028] (-828.620) -- 0:00:25
Average standard deviation of split frequencies: 0.009616
575500 -- (-827.437) (-828.230) [-831.811] (-828.215) * (-828.474) [-827.634] (-827.862) (-829.815) -- 0:00:25
576000 -- [-827.491] (-828.066) (-827.996) (-833.356) * (-828.629) (-830.226) [-827.879] (-829.402) -- 0:00:25
576500 -- (-827.491) [-830.995] (-829.889) (-829.951) * (-828.405) (-829.375) [-831.083] (-828.015) -- 0:00:25
577000 -- (-828.308) (-826.821) (-827.883) [-831.238] * (-828.708) (-829.536) (-831.813) [-828.775] -- 0:00:25
577500 -- (-827.510) (-827.232) (-827.580) [-829.842] * (-829.819) (-827.161) (-828.350) [-827.375] -- 0:00:25
578000 -- [-827.750] (-828.526) (-830.145) (-827.582) * (-828.739) (-828.517) [-830.283] (-827.086) -- 0:00:25
578500 -- [-827.065] (-827.668) (-827.779) (-829.508) * (-829.648) (-829.746) (-827.482) [-828.746] -- 0:00:25
579000 -- (-829.354) (-828.542) [-827.935] (-829.242) * [-830.087] (-830.478) (-828.867) (-832.346) -- 0:00:25
579500 -- (-833.585) (-829.175) (-828.294) [-827.898] * (-831.376) (-828.102) (-827.630) [-829.871] -- 0:00:25
580000 -- (-833.754) (-828.858) [-827.963] (-828.563) * (-831.117) [-827.187] (-832.273) (-829.646) -- 0:00:25
Average standard deviation of split frequencies: 0.009133
580500 -- (-829.592) [-828.156] (-827.706) (-826.976) * (-829.795) [-828.050] (-828.650) (-828.451) -- 0:00:25
581000 -- (-827.566) (-827.279) (-827.546) [-830.961] * [-831.144] (-828.885) (-828.379) (-829.820) -- 0:00:25
581500 -- (-828.943) [-826.678] (-831.472) (-828.256) * (-829.251) [-828.529] (-826.971) (-829.325) -- 0:00:25
582000 -- (-831.672) (-826.782) [-829.045] (-828.997) * (-828.533) [-828.052] (-827.215) (-829.563) -- 0:00:25
582500 -- (-829.548) [-829.798] (-830.081) (-828.540) * (-828.654) [-826.820] (-828.573) (-831.012) -- 0:00:25
583000 -- (-834.501) (-829.279) [-830.600] (-829.123) * [-830.431] (-828.179) (-828.569) (-828.508) -- 0:00:25
583500 -- [-828.596] (-829.119) (-827.813) (-828.983) * (-829.850) [-827.528] (-828.773) (-830.194) -- 0:00:24
584000 -- (-829.774) (-830.491) (-832.817) [-829.363] * [-827.945] (-832.082) (-831.006) (-828.143) -- 0:00:24
584500 -- (-829.762) (-829.436) (-828.146) [-828.410] * (-827.584) [-828.097] (-828.549) (-829.195) -- 0:00:24
585000 -- [-828.039] (-828.118) (-827.224) (-827.577) * [-830.232] (-827.084) (-828.603) (-829.539) -- 0:00:24
Average standard deviation of split frequencies: 0.008598
585500 -- (-832.421) (-827.966) [-827.999] (-830.377) * [-829.238] (-831.024) (-828.424) (-830.174) -- 0:00:24
586000 -- (-829.181) (-828.772) [-828.517] (-827.675) * (-827.880) (-835.553) (-834.835) [-828.631] -- 0:00:24
586500 -- (-828.915) (-830.633) [-828.810] (-833.793) * (-831.483) [-828.544] (-829.228) (-827.585) -- 0:00:24
587000 -- (-829.204) (-829.948) [-827.196] (-831.176) * [-836.093] (-830.749) (-829.966) (-830.977) -- 0:00:24
587500 -- [-827.855] (-827.845) (-829.693) (-828.723) * (-831.263) (-828.315) (-834.233) [-827.576] -- 0:00:24
588000 -- (-828.869) (-832.320) [-829.528] (-829.329) * (-829.606) (-829.312) (-831.750) [-827.666] -- 0:00:24
588500 -- (-829.920) (-832.351) (-831.839) [-827.839] * [-827.670] (-829.387) (-835.724) (-828.678) -- 0:00:24
589000 -- (-832.167) [-828.612] (-833.362) (-829.544) * (-829.539) (-829.716) (-827.584) [-831.270] -- 0:00:24
589500 -- (-829.904) (-828.725) (-831.470) [-831.190] * (-827.468) (-831.201) [-828.833] (-829.025) -- 0:00:24
590000 -- (-831.340) [-828.180] (-832.043) (-828.579) * [-828.305] (-829.695) (-828.299) (-830.232) -- 0:00:24
Average standard deviation of split frequencies: 0.008081
590500 -- (-831.556) (-829.491) (-833.391) [-827.707] * [-827.631] (-830.459) (-827.880) (-828.197) -- 0:00:24
591000 -- (-832.228) (-827.794) [-828.119] (-829.317) * (-830.096) (-829.105) [-828.246] (-827.614) -- 0:00:24
591500 -- (-829.633) (-828.404) [-828.715] (-828.252) * (-830.461) (-829.851) (-828.964) [-829.098] -- 0:00:24
592000 -- (-829.333) [-828.360] (-830.364) (-827.953) * (-832.092) [-828.561] (-830.662) (-830.053) -- 0:00:24
592500 -- (-831.075) (-829.982) [-829.483] (-828.340) * [-827.068] (-827.824) (-832.589) (-829.885) -- 0:00:24
593000 -- (-833.324) (-827.976) (-828.729) [-829.912] * (-828.433) [-829.122] (-829.163) (-829.469) -- 0:00:24
593500 -- (-826.885) (-830.540) (-829.570) [-830.623] * (-829.695) (-828.928) (-830.718) [-828.003] -- 0:00:24
594000 -- (-830.448) (-828.692) (-827.948) [-827.705] * (-835.507) (-830.402) [-826.928] (-827.965) -- 0:00:24
594500 -- (-826.788) (-829.790) (-827.708) [-828.014] * (-830.130) (-831.782) (-827.155) [-832.001] -- 0:00:24
595000 -- (-830.159) (-831.579) (-829.460) [-828.593] * [-831.518] (-827.577) (-828.461) (-828.250) -- 0:00:24
Average standard deviation of split frequencies: 0.007909
595500 -- (-831.557) (-833.437) (-828.947) [-828.858] * (-829.239) (-828.955) (-830.346) [-830.299] -- 0:00:24
596000 -- (-829.023) [-829.908] (-828.399) (-828.385) * [-828.509] (-834.693) (-829.657) (-830.455) -- 0:00:24
596500 -- [-827.311] (-827.554) (-828.593) (-830.237) * [-829.474] (-828.153) (-829.010) (-832.105) -- 0:00:24
597000 -- [-828.089] (-828.749) (-829.816) (-828.121) * (-828.028) (-828.634) (-834.833) [-829.380] -- 0:00:24
597500 -- (-832.176) [-830.784] (-829.744) (-830.400) * [-829.235] (-828.058) (-832.812) (-834.998) -- 0:00:24
598000 -- [-826.988] (-830.043) (-828.715) (-833.517) * [-831.496] (-831.761) (-830.388) (-829.580) -- 0:00:24
598500 -- (-826.774) (-827.797) (-827.820) [-829.855] * (-829.271) [-827.409] (-830.051) (-830.177) -- 0:00:24
599000 -- (-828.303) (-827.509) [-829.184] (-828.735) * (-827.209) [-827.286] (-831.842) (-829.006) -- 0:00:24
599500 -- (-829.492) (-829.218) (-830.797) [-830.961] * (-827.304) [-828.220] (-828.473) (-830.625) -- 0:00:24
600000 -- [-827.321] (-829.121) (-827.819) (-829.765) * (-832.434) [-827.395] (-830.420) (-830.324) -- 0:00:24
Average standard deviation of split frequencies: 0.007946
600500 -- (-827.927) (-828.087) [-828.042] (-828.583) * (-831.229) [-829.405] (-827.003) (-829.656) -- 0:00:23
601000 -- (-829.583) (-827.818) [-827.911] (-828.187) * [-830.142] (-839.129) (-826.849) (-830.497) -- 0:00:23
601500 -- (-829.754) [-828.097] (-828.073) (-828.193) * (-827.752) (-832.085) [-830.011] (-830.360) -- 0:00:23
602000 -- [-829.301] (-830.338) (-829.841) (-827.462) * (-827.932) (-829.693) [-833.822] (-833.573) -- 0:00:23
602500 -- (-828.616) (-831.804) (-828.346) [-828.696] * (-829.604) (-828.683) (-831.952) [-828.150] -- 0:00:23
603000 -- (-827.079) (-827.881) [-829.224] (-828.225) * (-830.970) (-829.613) [-828.606] (-829.459) -- 0:00:23
603500 -- [-830.563] (-828.680) (-829.249) (-829.952) * (-830.210) (-830.909) [-828.592] (-829.586) -- 0:00:23
604000 -- (-829.562) [-829.988] (-828.782) (-828.909) * [-830.363] (-829.455) (-827.667) (-828.911) -- 0:00:23
604500 -- [-830.197] (-828.100) (-827.719) (-833.708) * (-832.539) (-827.775) (-827.344) [-827.817] -- 0:00:23
605000 -- (-827.668) (-827.541) [-827.395] (-831.322) * (-830.861) (-831.090) (-826.778) [-829.738] -- 0:00:23
Average standard deviation of split frequencies: 0.007682
605500 -- (-827.789) (-827.537) (-828.729) [-826.911] * (-828.544) (-828.579) (-826.814) [-830.504] -- 0:00:23
606000 -- (-827.834) [-828.866] (-828.055) (-826.862) * [-831.500] (-829.016) (-827.203) (-827.441) -- 0:00:23
606500 -- (-831.057) (-827.299) [-827.667] (-832.126) * (-827.564) (-827.207) [-827.149] (-830.814) -- 0:00:23
607000 -- (-830.558) (-828.346) (-827.058) [-827.133] * (-826.959) [-829.052] (-827.764) (-826.886) -- 0:00:23
607500 -- (-828.478) (-829.361) (-828.355) [-827.086] * [-828.978] (-828.959) (-829.014) (-827.375) -- 0:00:23
608000 -- [-831.955] (-830.073) (-831.282) (-830.712) * (-828.147) [-830.966] (-828.098) (-827.374) -- 0:00:23
608500 -- (-829.924) (-829.070) [-831.347] (-829.257) * (-829.322) [-830.162] (-829.314) (-829.907) -- 0:00:23
609000 -- (-832.291) (-830.482) [-832.030] (-832.046) * [-828.050] (-829.999) (-827.942) (-829.164) -- 0:00:23
609500 -- (-829.963) [-827.306] (-828.321) (-828.208) * (-826.810) (-827.813) (-827.170) [-830.540] -- 0:00:23
610000 -- [-829.499] (-827.000) (-829.583) (-828.600) * [-828.815] (-828.995) (-828.996) (-829.914) -- 0:00:23
Average standard deviation of split frequencies: 0.007478
610500 -- [-830.915] (-829.810) (-827.377) (-828.701) * [-828.311] (-831.197) (-828.479) (-828.903) -- 0:00:23
611000 -- [-826.791] (-827.538) (-828.651) (-828.545) * (-829.777) (-830.404) (-832.170) [-830.240] -- 0:00:23
611500 -- (-826.907) [-827.723] (-829.760) (-830.443) * [-830.059] (-828.667) (-834.453) (-829.213) -- 0:00:23
612000 -- (-827.553) (-831.255) [-830.054] (-828.941) * (-828.281) (-827.522) (-832.147) [-827.809] -- 0:00:23
612500 -- (-828.183) [-834.347] (-830.189) (-832.188) * [-828.437] (-827.679) (-828.691) (-829.786) -- 0:00:23
613000 -- (-827.904) (-830.331) (-830.169) [-829.057] * [-829.632] (-828.175) (-828.439) (-827.792) -- 0:00:23
613500 -- [-827.621] (-830.419) (-827.440) (-829.296) * (-827.965) (-828.810) (-827.768) [-828.352] -- 0:00:23
614000 -- (-827.735) [-832.428] (-830.022) (-827.449) * (-828.499) (-829.991) [-829.323] (-831.389) -- 0:00:23
614500 -- (-829.006) (-827.929) [-828.058] (-828.609) * (-829.786) [-828.608] (-827.922) (-829.794) -- 0:00:23
615000 -- (-827.732) (-828.373) (-827.869) [-830.080] * [-828.586] (-828.763) (-832.196) (-828.453) -- 0:00:23
Average standard deviation of split frequencies: 0.007318
615500 -- [-827.824] (-827.471) (-835.086) (-832.805) * (-828.248) [-828.637] (-830.269) (-829.585) -- 0:00:23
616000 -- (-828.301) (-830.187) (-833.563) [-829.303] * (-826.701) (-826.872) [-827.690] (-829.137) -- 0:00:23
616500 -- (-830.591) (-831.233) (-830.010) [-828.044] * (-831.137) (-826.904) [-828.642] (-827.896) -- 0:00:23
617000 -- (-827.760) (-830.085) [-831.795] (-829.152) * [-828.239] (-830.057) (-828.095) (-828.050) -- 0:00:22
617500 -- (-827.654) (-829.735) (-829.614) [-828.329] * (-829.221) (-829.909) (-828.492) [-826.745] -- 0:00:22
618000 -- (-830.437) [-829.370] (-828.180) (-830.300) * (-828.504) (-829.010) [-829.649] (-827.907) -- 0:00:22
618500 -- [-832.852] (-827.972) (-828.523) (-828.627) * (-832.406) [-829.437] (-833.585) (-831.940) -- 0:00:22
619000 -- (-828.828) (-828.020) [-830.683] (-830.292) * [-833.340] (-828.500) (-832.250) (-830.267) -- 0:00:22
619500 -- (-829.200) (-827.102) [-827.868] (-832.452) * [-830.408] (-830.185) (-828.889) (-828.466) -- 0:00:22
620000 -- (-829.025) (-827.080) (-829.150) [-832.184] * [-829.386] (-833.004) (-828.509) (-829.567) -- 0:00:22
Average standard deviation of split frequencies: 0.007595
620500 -- (-833.210) (-827.716) (-827.915) [-829.365] * (-832.257) (-829.673) (-830.033) [-828.524] -- 0:00:22
621000 -- [-831.402] (-829.693) (-830.691) (-827.598) * (-832.598) [-827.695] (-829.980) (-826.972) -- 0:00:22
621500 -- (-829.993) [-828.536] (-828.422) (-828.021) * (-834.380) [-831.212] (-827.637) (-827.857) -- 0:00:22
622000 -- (-832.362) (-829.330) [-827.182] (-827.619) * (-827.928) [-827.892] (-827.281) (-830.974) -- 0:00:22
622500 -- [-829.180] (-829.838) (-829.264) (-826.957) * (-829.078) (-828.455) [-828.929] (-831.215) -- 0:00:22
623000 -- (-829.155) (-830.035) (-830.831) [-827.403] * (-828.702) [-827.742] (-829.425) (-827.615) -- 0:00:22
623500 -- [-829.390] (-827.212) (-830.207) (-827.145) * (-829.699) (-832.043) (-828.362) [-831.591] -- 0:00:22
624000 -- (-830.567) [-828.788] (-834.172) (-827.492) * (-829.541) (-827.842) [-833.846] (-829.538) -- 0:00:22
624500 -- (-830.727) (-831.755) [-829.814] (-830.710) * (-833.445) [-828.928] (-840.217) (-833.994) -- 0:00:22
625000 -- (-829.895) (-830.302) [-829.374] (-828.291) * [-829.292] (-827.920) (-830.076) (-829.395) -- 0:00:22
Average standard deviation of split frequencies: 0.007625
625500 -- [-829.987] (-829.171) (-833.752) (-830.080) * (-829.439) [-828.218] (-829.007) (-829.149) -- 0:00:22
626000 -- (-827.629) [-826.762] (-830.647) (-829.992) * (-827.726) [-828.334] (-828.822) (-829.547) -- 0:00:22
626500 -- (-828.291) (-827.275) [-830.770] (-827.963) * (-833.286) (-828.698) [-829.711] (-828.537) -- 0:00:22
627000 -- (-828.928) [-828.459] (-830.575) (-828.209) * (-829.761) (-827.393) (-829.907) [-830.103] -- 0:00:22
627500 -- (-827.811) (-828.669) (-827.055) [-827.743] * (-828.748) (-828.875) (-828.778) [-828.272] -- 0:00:22
628000 -- (-832.041) (-827.344) [-830.314] (-831.575) * [-828.725] (-828.172) (-828.953) (-829.798) -- 0:00:22
628500 -- (-830.498) (-829.352) [-828.775] (-831.060) * (-829.173) (-828.222) [-827.760] (-828.075) -- 0:00:22
629000 -- (-828.815) (-835.015) (-829.979) [-828.659] * [-831.182] (-829.900) (-835.837) (-828.933) -- 0:00:22
629500 -- (-829.902) (-829.137) [-827.830] (-829.062) * (-831.919) (-828.617) [-829.710] (-830.545) -- 0:00:22
630000 -- (-828.213) (-830.147) [-831.441] (-828.043) * (-831.987) (-829.186) (-826.920) [-829.986] -- 0:00:22
Average standard deviation of split frequencies: 0.007615
630500 -- (-828.601) [-832.040] (-828.994) (-829.772) * (-832.958) (-827.304) [-827.724] (-829.854) -- 0:00:22
631000 -- (-829.278) [-829.395] (-831.885) (-827.996) * (-826.681) (-827.163) (-832.546) [-828.407] -- 0:00:22
631500 -- [-827.615] (-828.238) (-831.255) (-828.176) * (-830.069) [-828.651] (-831.274) (-829.068) -- 0:00:22
632000 -- (-828.169) (-828.723) [-830.032] (-827.249) * (-826.926) [-833.285] (-827.322) (-829.873) -- 0:00:22
632500 -- (-827.957) (-830.231) [-828.523] (-828.295) * (-833.360) [-828.163] (-829.808) (-829.329) -- 0:00:22
633000 -- (-830.164) (-827.731) (-828.886) [-828.497] * (-834.685) [-829.015] (-827.052) (-829.885) -- 0:00:22
633500 -- (-829.162) (-827.020) (-828.155) [-828.458] * [-831.515] (-834.058) (-828.527) (-830.562) -- 0:00:21
634000 -- [-828.649] (-829.761) (-828.422) (-829.789) * (-834.513) [-831.065] (-827.466) (-828.463) -- 0:00:21
634500 -- (-830.327) (-831.199) (-828.599) [-829.443] * (-830.732) [-828.854] (-829.127) (-827.619) -- 0:00:21
635000 -- (-832.042) (-828.032) (-828.183) [-828.791] * (-833.427) [-828.269] (-827.572) (-831.745) -- 0:00:21
Average standard deviation of split frequencies: 0.007968
635500 -- [-828.278] (-839.131) (-827.684) (-830.762) * (-833.184) (-832.302) [-831.204] (-830.314) -- 0:00:21
636000 -- [-828.748] (-828.976) (-828.788) (-828.567) * (-828.016) (-828.035) (-828.670) [-830.284] -- 0:00:21
636500 -- (-827.487) (-828.702) (-831.003) [-827.396] * (-828.059) (-830.733) [-829.200] (-828.072) -- 0:00:21
637000 -- (-829.761) (-827.505) (-831.512) [-827.058] * (-827.533) (-829.110) [-829.870] (-829.062) -- 0:00:21
637500 -- [-828.130] (-827.902) (-830.805) (-829.494) * [-828.534] (-829.451) (-827.753) (-827.757) -- 0:00:21
638000 -- [-827.870] (-831.456) (-830.528) (-830.019) * (-828.991) (-829.351) (-827.436) [-827.723] -- 0:00:21
638500 -- (-828.923) (-833.718) (-829.594) [-829.928] * (-829.617) (-828.994) [-831.248] (-830.448) -- 0:00:21
639000 -- (-827.828) [-829.771] (-832.223) (-828.358) * (-829.846) (-827.260) [-828.926] (-830.400) -- 0:00:21
639500 -- (-828.412) (-827.926) [-826.991] (-829.071) * (-828.660) (-830.529) (-827.789) [-829.413] -- 0:00:21
640000 -- (-827.436) [-827.210] (-828.348) (-831.666) * (-828.423) [-831.378] (-833.192) (-828.784) -- 0:00:21
Average standard deviation of split frequencies: 0.007864
640500 -- (-829.561) (-828.490) (-831.306) [-831.549] * (-831.634) (-827.513) (-831.099) [-828.456] -- 0:00:21
641000 -- [-828.900] (-827.665) (-830.834) (-832.308) * (-829.715) [-828.911] (-828.733) (-826.803) -- 0:00:21
641500 -- (-827.798) (-827.909) (-837.265) [-828.613] * (-829.782) (-829.531) [-828.439] (-828.193) -- 0:00:21
642000 -- (-831.060) (-828.142) (-830.866) [-828.817] * (-831.192) (-831.486) (-829.247) [-829.319] -- 0:00:21
642500 -- [-827.443] (-832.041) (-827.544) (-829.907) * [-830.059] (-829.337) (-831.771) (-828.611) -- 0:00:21
643000 -- [-827.192] (-827.154) (-828.058) (-827.492) * (-827.904) (-829.456) [-827.703] (-828.935) -- 0:00:21
643500 -- (-827.729) (-828.519) [-828.888] (-827.629) * (-831.287) (-827.692) (-829.663) [-827.836] -- 0:00:21
644000 -- [-827.688] (-828.418) (-827.604) (-827.120) * (-828.937) [-827.467] (-832.433) (-835.290) -- 0:00:21
644500 -- (-827.959) [-829.632] (-829.051) (-827.355) * (-828.819) (-826.910) (-829.277) [-828.534] -- 0:00:21
645000 -- (-829.361) [-831.044] (-829.702) (-830.137) * (-830.274) [-827.495] (-829.902) (-830.848) -- 0:00:21
Average standard deviation of split frequencies: 0.008209
645500 -- (-829.772) (-828.189) [-828.170] (-830.840) * (-829.979) (-830.000) (-828.436) [-827.902] -- 0:00:21
646000 -- (-831.418) (-828.218) [-827.465] (-828.414) * (-830.758) [-828.741] (-828.970) (-829.418) -- 0:00:21
646500 -- (-829.228) (-829.408) (-827.114) [-828.568] * (-834.197) [-828.805] (-829.485) (-829.582) -- 0:00:21
647000 -- [-827.362] (-828.706) (-828.597) (-829.751) * [-832.779] (-829.846) (-831.566) (-827.728) -- 0:00:21
647500 -- (-828.199) (-829.320) [-831.387] (-828.544) * (-828.751) (-828.425) [-829.278] (-828.525) -- 0:00:21
648000 -- (-830.882) (-828.775) [-827.991] (-827.977) * (-828.378) [-827.740] (-830.855) (-832.292) -- 0:00:21
648500 -- (-831.325) (-829.039) [-827.602] (-830.690) * (-830.651) (-827.686) (-831.942) [-830.801] -- 0:00:21
649000 -- (-828.892) [-827.284] (-830.676) (-829.768) * (-828.758) [-828.417] (-830.578) (-832.677) -- 0:00:21
649500 -- [-830.208] (-827.188) (-827.940) (-829.206) * [-827.262] (-836.910) (-827.655) (-828.111) -- 0:00:21
650000 -- (-831.973) (-827.087) [-829.201] (-828.753) * (-831.951) (-830.813) [-828.120] (-830.185) -- 0:00:21
Average standard deviation of split frequencies: 0.008332
650500 -- [-830.091] (-832.454) (-828.088) (-828.792) * (-830.628) (-831.432) (-829.083) [-827.380] -- 0:00:20
651000 -- (-829.102) (-831.447) (-830.581) [-831.082] * [-827.624] (-828.781) (-828.797) (-828.455) -- 0:00:20
651500 -- [-829.362] (-829.513) (-833.836) (-828.255) * [-828.754] (-827.521) (-832.118) (-830.369) -- 0:00:20
652000 -- (-827.326) (-829.091) (-828.300) [-827.334] * (-829.784) [-827.806] (-827.115) (-827.011) -- 0:00:20
652500 -- (-829.944) (-829.279) [-827.289] (-831.731) * (-827.784) (-828.615) [-828.687] (-829.620) -- 0:00:20
653000 -- (-830.084) (-832.222) (-829.921) [-831.232] * (-827.920) (-829.637) [-828.717] (-831.584) -- 0:00:20
653500 -- (-827.943) (-828.815) [-829.148] (-831.519) * (-827.223) (-831.184) [-828.391] (-831.290) -- 0:00:20
654000 -- (-828.702) [-830.909] (-827.034) (-828.181) * (-827.605) (-827.425) (-827.256) [-830.096] -- 0:00:20
654500 -- (-827.705) (-827.293) (-831.315) [-827.913] * (-829.598) (-829.910) (-833.505) [-830.853] -- 0:00:20
655000 -- (-828.300) (-828.619) [-827.519] (-829.101) * [-832.170] (-833.427) (-828.273) (-831.884) -- 0:00:20
Average standard deviation of split frequencies: 0.008309
655500 -- [-827.856] (-827.110) (-826.904) (-828.829) * (-828.161) (-827.025) (-829.758) [-829.495] -- 0:00:20
656000 -- (-830.642) [-828.075] (-827.277) (-830.034) * [-828.685] (-829.873) (-830.199) (-833.088) -- 0:00:20
656500 -- (-831.608) [-828.286] (-828.066) (-830.442) * [-828.801] (-829.904) (-828.374) (-828.657) -- 0:00:20
657000 -- [-828.896] (-828.713) (-828.415) (-828.463) * (-831.481) (-827.852) [-831.947] (-829.152) -- 0:00:20
657500 -- (-828.588) (-836.724) [-828.876] (-827.488) * (-831.170) [-826.967] (-828.656) (-828.465) -- 0:00:20
658000 -- (-828.439) (-828.732) (-827.832) [-830.301] * (-829.887) (-827.012) [-828.572] (-829.564) -- 0:00:20
658500 -- [-828.891] (-827.198) (-831.548) (-830.457) * (-829.252) [-829.843] (-833.614) (-828.852) -- 0:00:20
659000 -- (-831.216) (-827.568) [-833.408] (-828.136) * (-828.467) [-830.750] (-830.171) (-829.902) -- 0:00:20
659500 -- (-827.617) (-828.809) [-828.755] (-828.323) * [-829.132] (-828.290) (-833.025) (-829.960) -- 0:00:20
660000 -- [-828.675] (-829.186) (-827.659) (-829.069) * (-829.033) (-829.181) [-829.773] (-831.448) -- 0:00:20
Average standard deviation of split frequencies: 0.008206
660500 -- (-827.602) (-833.996) [-828.306] (-830.964) * (-831.006) (-827.837) [-830.916] (-827.758) -- 0:00:20
661000 -- (-829.891) [-830.429] (-828.539) (-828.235) * (-827.830) (-832.391) (-828.856) [-829.519] -- 0:00:20
661500 -- [-828.484] (-834.721) (-831.421) (-829.304) * [-827.676] (-830.018) (-830.457) (-830.093) -- 0:00:20
662000 -- (-830.091) [-830.756] (-829.451) (-833.884) * (-826.775) (-830.015) [-829.829] (-831.867) -- 0:00:20
662500 -- (-828.104) [-827.882] (-830.370) (-830.235) * (-828.660) (-827.239) [-830.677] (-828.544) -- 0:00:20
663000 -- (-830.227) (-827.916) [-828.843] (-827.471) * [-829.367] (-827.246) (-829.432) (-827.863) -- 0:00:20
663500 -- [-827.421] (-827.147) (-827.197) (-828.555) * (-828.101) (-827.409) (-829.202) [-826.940] -- 0:00:20
664000 -- (-828.064) [-828.365] (-829.254) (-830.378) * [-827.952] (-832.512) (-827.374) (-827.660) -- 0:00:20
664500 -- (-827.932) [-827.280] (-834.498) (-830.151) * (-830.288) [-827.361] (-827.615) (-829.508) -- 0:00:20
665000 -- (-829.008) (-831.689) (-827.851) [-831.109] * (-827.929) (-827.800) [-828.819] (-830.100) -- 0:00:20
Average standard deviation of split frequencies: 0.008007
665500 -- (-827.573) (-828.270) [-827.846] (-827.327) * [-827.077] (-827.936) (-830.255) (-833.387) -- 0:00:20
666000 -- [-827.693] (-829.387) (-828.123) (-830.579) * (-826.984) [-828.498] (-827.509) (-833.690) -- 0:00:20
666500 -- (-833.084) (-829.022) [-828.661] (-827.607) * (-827.052) (-831.672) (-831.150) [-828.576] -- 0:00:20
667000 -- (-832.508) (-828.452) [-830.028] (-827.605) * (-829.924) [-830.461] (-829.352) (-830.463) -- 0:00:19
667500 -- (-832.943) (-828.554) (-830.792) [-827.929] * [-828.712] (-828.589) (-832.036) (-827.917) -- 0:00:19
668000 -- [-832.961] (-826.824) (-829.255) (-827.097) * (-828.942) (-833.234) [-828.623] (-827.758) -- 0:00:19
668500 -- (-829.198) [-828.794] (-830.993) (-827.640) * (-827.188) (-833.873) (-829.035) [-826.777] -- 0:00:19
669000 -- (-827.953) (-829.668) (-830.442) [-836.083] * (-830.510) (-829.348) [-828.988] (-828.481) -- 0:00:19
669500 -- (-827.388) (-831.259) [-830.336] (-828.344) * (-830.055) (-828.658) (-829.236) [-830.758] -- 0:00:19
670000 -- (-828.300) (-827.970) (-829.497) [-831.328] * (-830.292) (-828.579) (-828.523) [-828.595] -- 0:00:19
Average standard deviation of split frequencies: 0.008039
670500 -- (-831.836) [-827.119] (-829.407) (-834.153) * (-829.366) [-829.057] (-832.303) (-828.572) -- 0:00:19
671000 -- [-827.483] (-833.087) (-828.813) (-828.428) * (-829.189) [-829.020] (-828.362) (-829.710) -- 0:00:19
671500 -- (-832.759) (-831.426) [-827.759] (-828.032) * (-829.789) [-829.775] (-828.654) (-827.464) -- 0:00:19
672000 -- (-836.138) [-829.337] (-833.567) (-827.630) * (-827.418) (-826.770) (-831.394) [-829.363] -- 0:00:19
672500 -- (-836.108) [-831.183] (-827.875) (-827.254) * [-827.979] (-828.129) (-831.290) (-830.226) -- 0:00:19
673000 -- (-829.886) [-829.331] (-827.467) (-827.629) * (-827.654) (-827.967) [-828.230] (-827.919) -- 0:00:19
673500 -- [-831.256] (-833.627) (-829.965) (-827.951) * (-828.563) (-830.881) (-831.079) [-827.767] -- 0:00:19
674000 -- (-830.657) (-828.774) [-832.103] (-831.042) * (-827.799) (-829.810) (-831.806) [-827.915] -- 0:00:19
674500 -- (-829.109) [-829.727] (-832.722) (-828.704) * (-827.525) (-828.951) (-827.863) [-827.338] -- 0:00:19
675000 -- [-826.895] (-832.396) (-831.006) (-827.057) * [-827.925] (-832.197) (-831.005) (-828.142) -- 0:00:19
Average standard deviation of split frequencies: 0.008237
675500 -- [-827.773] (-828.309) (-830.191) (-827.412) * [-829.832] (-833.017) (-827.188) (-828.292) -- 0:00:19
676000 -- (-828.164) [-828.424] (-829.548) (-827.418) * [-829.909] (-832.756) (-827.186) (-830.235) -- 0:00:19
676500 -- (-828.184) (-831.256) [-828.442] (-831.247) * (-832.799) (-829.492) [-827.297] (-832.965) -- 0:00:19
677000 -- (-828.289) (-830.556) (-829.822) [-828.500] * (-831.654) (-831.661) [-829.638] (-829.274) -- 0:00:19
677500 -- (-831.594) (-832.719) [-827.310] (-830.705) * (-827.544) [-828.363] (-827.637) (-829.086) -- 0:00:19
678000 -- [-829.364] (-828.370) (-827.120) (-828.885) * (-828.623) [-829.182] (-830.788) (-830.726) -- 0:00:19
678500 -- (-827.732) (-828.226) (-828.718) [-829.987] * (-828.410) [-827.822] (-827.492) (-830.970) -- 0:00:19
679000 -- (-829.372) (-829.643) (-829.820) [-829.901] * (-830.661) [-829.048] (-827.367) (-833.495) -- 0:00:19
679500 -- (-829.696) (-827.166) [-833.636] (-828.240) * (-831.065) (-831.640) [-830.695] (-828.001) -- 0:00:19
680000 -- (-828.862) (-827.662) (-830.805) [-827.496] * (-833.003) (-829.606) [-832.045] (-833.637) -- 0:00:19
Average standard deviation of split frequencies: 0.008354
680500 -- (-830.055) [-827.423] (-829.791) (-828.185) * [-826.878] (-829.478) (-828.744) (-827.236) -- 0:00:19
681000 -- (-828.952) [-827.266] (-829.391) (-828.499) * (-827.412) [-830.523] (-829.586) (-832.519) -- 0:00:19
681500 -- (-828.880) [-828.269] (-827.521) (-830.219) * [-829.209] (-829.003) (-828.125) (-829.168) -- 0:00:19
682000 -- (-829.617) [-827.750] (-828.877) (-828.899) * (-835.333) (-829.255) (-829.140) [-828.732] -- 0:00:19
682500 -- (-828.123) (-831.315) [-832.647] (-829.709) * [-829.345] (-827.702) (-827.431) (-832.714) -- 0:00:19
683000 -- [-827.898] (-828.766) (-829.680) (-830.691) * (-828.012) (-830.251) [-828.556] (-833.867) -- 0:00:19
683500 -- (-827.169) [-827.962] (-827.102) (-827.783) * (-831.239) (-829.353) [-828.425] (-831.088) -- 0:00:18
684000 -- (-830.681) (-830.454) (-829.393) [-829.764] * (-829.050) (-830.977) (-828.087) [-829.154] -- 0:00:18
684500 -- (-828.714) [-827.936] (-827.023) (-828.566) * [-829.138] (-836.086) (-827.984) (-827.866) -- 0:00:18
685000 -- [-828.643] (-829.792) (-831.308) (-827.691) * (-830.077) (-828.853) [-828.572] (-829.229) -- 0:00:18
Average standard deviation of split frequencies: 0.008547
685500 -- [-829.145] (-831.083) (-837.035) (-830.443) * (-831.358) [-826.787] (-828.243) (-828.724) -- 0:00:18
686000 -- (-832.378) (-830.576) (-827.996) [-830.034] * [-827.615] (-834.012) (-829.398) (-828.729) -- 0:00:18
686500 -- (-829.764) (-828.796) (-827.621) [-827.794] * [-828.484] (-828.215) (-828.340) (-828.862) -- 0:00:18
687000 -- (-830.459) (-831.378) [-826.815] (-827.384) * [-830.377] (-829.172) (-831.402) (-830.224) -- 0:00:18
687500 -- (-832.928) [-827.163] (-830.798) (-830.638) * [-831.087] (-832.529) (-830.402) (-830.823) -- 0:00:18
688000 -- (-833.292) (-827.518) [-828.499] (-829.363) * (-828.274) (-829.954) (-830.366) [-827.868] -- 0:00:18
688500 -- [-828.660] (-829.386) (-828.294) (-828.299) * [-827.069] (-830.269) (-828.382) (-830.256) -- 0:00:18
689000 -- [-827.450] (-828.864) (-828.188) (-828.951) * [-828.096] (-828.892) (-829.373) (-826.945) -- 0:00:18
689500 -- (-827.421) (-829.410) [-827.602] (-830.024) * (-828.320) (-829.659) (-827.439) [-827.408] -- 0:00:18
690000 -- (-829.653) (-827.523) (-830.688) [-829.089] * (-829.859) [-830.042] (-831.195) (-827.764) -- 0:00:18
Average standard deviation of split frequencies: 0.008574
690500 -- (-827.932) (-828.319) (-835.262) [-829.072] * (-836.570) [-827.871] (-829.845) (-827.304) -- 0:00:18
691000 -- (-827.580) [-828.056] (-831.356) (-828.211) * (-834.751) [-827.937] (-828.180) (-827.447) -- 0:00:18
691500 -- (-829.901) (-827.015) [-830.698] (-833.012) * (-833.162) [-828.754] (-829.853) (-828.898) -- 0:00:18
692000 -- [-828.321] (-828.746) (-831.955) (-829.765) * (-828.165) [-830.404] (-830.648) (-829.248) -- 0:00:18
692500 -- (-829.733) (-830.694) (-828.273) [-828.869] * [-827.399] (-829.294) (-831.287) (-832.186) -- 0:00:18
693000 -- [-829.452] (-832.914) (-827.237) (-828.410) * (-828.654) (-829.039) (-829.529) [-829.304] -- 0:00:18
693500 -- (-828.205) (-837.005) [-829.268] (-831.534) * [-830.018] (-829.780) (-827.970) (-829.720) -- 0:00:18
694000 -- [-828.466] (-829.299) (-828.002) (-829.173) * [-830.240] (-827.916) (-827.958) (-831.496) -- 0:00:18
694500 -- (-828.447) (-829.665) (-830.010) [-830.299] * [-832.713] (-832.473) (-829.631) (-830.408) -- 0:00:18
695000 -- [-828.475] (-828.153) (-828.923) (-826.958) * [-829.090] (-830.434) (-826.666) (-831.659) -- 0:00:18
Average standard deviation of split frequencies: 0.009144
695500 -- (-828.938) (-827.747) (-829.133) [-827.287] * (-831.030) [-828.940] (-828.535) (-829.695) -- 0:00:18
696000 -- [-828.763] (-828.641) (-828.270) (-829.027) * (-831.106) (-828.663) (-834.434) [-830.520] -- 0:00:18
696500 -- (-830.090) [-829.156] (-828.804) (-828.401) * (-828.870) [-827.362] (-830.784) (-832.468) -- 0:00:18
697000 -- [-830.322] (-829.349) (-830.922) (-826.744) * (-829.406) [-826.995] (-832.214) (-829.745) -- 0:00:18
697500 -- [-830.624] (-828.286) (-830.363) (-829.643) * (-830.748) (-827.382) (-830.476) [-827.827] -- 0:00:18
698000 -- (-831.048) [-828.106] (-830.126) (-830.366) * (-830.814) (-827.948) [-829.138] (-827.348) -- 0:00:18
698500 -- (-831.950) (-831.374) (-826.815) [-829.165] * [-829.055] (-829.465) (-830.716) (-828.207) -- 0:00:18
699000 -- [-830.402] (-830.225) (-827.935) (-827.373) * [-833.227] (-829.095) (-829.745) (-827.337) -- 0:00:18
699500 -- (-829.555) (-828.206) [-827.839] (-829.051) * (-828.518) (-831.839) [-828.387] (-831.486) -- 0:00:18
700000 -- (-829.725) (-828.062) (-827.100) [-832.836] * (-829.650) [-829.966] (-828.357) (-829.683) -- 0:00:18
Average standard deviation of split frequencies: 0.008662
700500 -- (-829.144) (-828.693) [-830.259] (-829.195) * [-830.048] (-828.646) (-827.888) (-829.108) -- 0:00:17
701000 -- (-828.202) (-828.545) [-827.159] (-829.481) * (-832.845) [-829.410] (-827.439) (-828.902) -- 0:00:17
701500 -- (-828.230) (-830.750) [-829.065] (-830.899) * (-830.976) (-827.218) [-828.211] (-830.084) -- 0:00:17
702000 -- (-828.698) [-829.104] (-829.076) (-830.966) * [-832.798] (-827.618) (-833.610) (-828.332) -- 0:00:17
702500 -- (-830.517) [-827.779] (-831.961) (-830.472) * (-829.686) (-828.126) [-833.754] (-827.347) -- 0:00:17
703000 -- (-830.379) (-827.448) (-827.597) [-831.413] * [-828.792] (-830.056) (-827.573) (-829.763) -- 0:00:17
703500 -- (-829.358) (-829.435) [-828.315] (-830.945) * [-832.491] (-828.847) (-827.967) (-829.097) -- 0:00:17
704000 -- (-830.513) (-829.565) [-828.547] (-831.071) * (-827.501) [-831.753] (-828.186) (-828.591) -- 0:00:17
704500 -- (-829.443) (-827.660) [-827.776] (-830.949) * (-828.934) [-831.681] (-827.702) (-833.125) -- 0:00:17
705000 -- (-829.477) [-830.957] (-829.068) (-832.212) * (-827.198) (-827.951) [-827.702] (-829.318) -- 0:00:17
Average standard deviation of split frequencies: 0.009056
705500 -- (-827.606) (-831.695) (-827.145) [-830.603] * [-827.258] (-826.869) (-827.195) (-830.116) -- 0:00:17
706000 -- [-828.619] (-830.455) (-827.211) (-829.836) * (-831.056) [-826.876] (-828.485) (-830.435) -- 0:00:17
706500 -- [-829.726] (-830.174) (-827.330) (-832.126) * (-828.202) [-827.282] (-828.205) (-829.608) -- 0:00:17
707000 -- (-829.998) (-832.679) (-827.701) [-829.299] * (-833.209) [-828.341] (-828.018) (-831.503) -- 0:00:17
707500 -- (-830.718) (-828.844) [-827.710] (-829.901) * (-831.901) (-827.856) (-827.772) [-827.751] -- 0:00:17
708000 -- (-829.013) [-828.829] (-830.629) (-827.351) * (-832.384) (-831.639) (-828.546) [-828.627] -- 0:00:17
708500 -- (-829.706) (-828.216) (-829.148) [-827.738] * [-832.615] (-829.118) (-829.042) (-829.450) -- 0:00:17
709000 -- (-827.694) (-827.221) [-828.505] (-828.686) * (-829.338) (-828.001) (-829.492) [-827.069] -- 0:00:17
709500 -- [-828.714] (-826.844) (-830.547) (-831.210) * (-833.467) (-827.545) (-828.314) [-832.775] -- 0:00:17
710000 -- (-827.141) (-828.600) (-831.403) [-829.143] * (-831.559) (-829.812) (-828.279) [-830.094] -- 0:00:17
Average standard deviation of split frequencies: 0.009452
710500 -- (-827.869) (-828.832) (-829.564) [-831.921] * (-831.026) (-829.761) (-827.344) [-829.683] -- 0:00:17
711000 -- (-827.153) (-827.549) [-829.517] (-830.138) * (-830.020) (-829.028) (-833.135) [-833.789] -- 0:00:17
711500 -- (-831.880) [-827.117] (-840.412) (-830.299) * [-828.125] (-830.086) (-834.121) (-827.889) -- 0:00:17
712000 -- (-832.751) (-827.340) (-830.136) [-829.295] * (-837.171) (-829.263) [-829.216] (-828.229) -- 0:00:17
712500 -- (-828.558) (-831.353) (-831.252) [-827.954] * (-828.129) (-828.844) (-829.690) [-828.967] -- 0:00:17
713000 -- (-827.792) [-826.922] (-831.457) (-834.202) * (-827.391) (-830.611) (-826.999) [-829.104] -- 0:00:17
713500 -- (-828.517) (-828.079) [-832.784] (-829.518) * (-826.779) [-829.226] (-827.265) (-828.832) -- 0:00:17
714000 -- (-829.935) [-829.270] (-831.074) (-828.263) * (-829.240) [-830.911] (-828.670) (-829.319) -- 0:00:17
714500 -- (-827.654) (-827.260) [-830.004] (-828.620) * (-828.817) [-828.001] (-831.267) (-827.566) -- 0:00:17
715000 -- [-827.144] (-829.027) (-830.533) (-829.031) * (-830.981) (-827.779) [-828.355] (-828.609) -- 0:00:17
Average standard deviation of split frequencies: 0.009670
715500 -- [-829.737] (-834.787) (-829.590) (-831.536) * [-828.527] (-826.810) (-828.966) (-827.619) -- 0:00:17
716000 -- [-832.397] (-829.349) (-829.301) (-827.528) * (-829.996) (-827.580) (-828.753) [-831.114] -- 0:00:17
716500 -- (-829.196) [-827.370] (-830.281) (-829.087) * [-828.179] (-830.271) (-827.255) (-831.937) -- 0:00:17
717000 -- (-831.836) (-828.612) (-827.757) [-829.140] * [-828.132] (-835.051) (-828.817) (-831.886) -- 0:00:16
717500 -- (-832.899) (-829.774) [-828.882] (-830.226) * (-826.927) (-829.480) [-828.472] (-828.933) -- 0:00:16
718000 -- (-827.947) (-833.919) [-829.478] (-830.798) * (-826.881) [-829.554] (-827.768) (-828.412) -- 0:00:16
718500 -- (-827.071) (-834.951) (-828.651) [-827.748] * [-827.923] (-829.826) (-827.937) (-831.177) -- 0:00:16
719000 -- (-834.340) (-832.663) (-829.178) [-827.033] * (-827.210) (-829.359) [-828.143] (-832.705) -- 0:00:16
719500 -- (-829.229) (-829.030) (-830.346) [-829.524] * (-830.777) (-831.066) (-828.277) [-829.789] -- 0:00:16
720000 -- (-832.081) (-829.545) (-827.834) [-827.810] * [-828.270] (-828.281) (-832.833) (-839.513) -- 0:00:16
Average standard deviation of split frequencies: 0.009689
720500 -- (-831.714) (-830.125) (-828.532) [-827.537] * (-831.494) (-827.751) [-829.342] (-827.550) -- 0:00:16
721000 -- (-830.569) (-829.328) (-834.784) [-828.606] * (-828.816) (-830.311) [-832.477] (-829.517) -- 0:00:16
721500 -- (-828.922) (-829.645) (-830.175) [-828.340] * [-830.430] (-828.474) (-827.209) (-831.712) -- 0:00:16
722000 -- (-828.478) [-828.490] (-828.670) (-833.779) * (-832.494) [-828.889] (-828.710) (-827.877) -- 0:00:16
722500 -- [-828.221] (-828.000) (-828.392) (-829.235) * (-828.677) [-828.041] (-832.675) (-829.412) -- 0:00:16
723000 -- [-830.403] (-831.355) (-827.265) (-832.404) * (-830.006) (-831.086) (-830.099) [-829.076] -- 0:00:16
723500 -- (-827.886) (-833.357) [-828.843] (-841.499) * [-829.118] (-830.065) (-828.742) (-827.558) -- 0:00:16
724000 -- (-830.082) [-829.422] (-827.123) (-829.597) * (-829.309) (-829.710) (-828.662) [-827.734] -- 0:00:16
724500 -- (-827.448) (-828.097) [-827.594] (-832.801) * (-829.781) [-827.658] (-828.171) (-828.161) -- 0:00:16
725000 -- [-828.566] (-832.534) (-828.722) (-832.151) * (-831.073) (-827.205) (-829.518) [-827.432] -- 0:00:16
Average standard deviation of split frequencies: 0.009618
725500 -- (-829.831) (-828.168) (-829.762) [-832.138] * [-828.449] (-830.164) (-830.618) (-827.606) -- 0:00:16
726000 -- [-828.478] (-829.121) (-828.586) (-827.606) * (-829.216) (-830.480) [-830.335] (-830.076) -- 0:00:16
726500 -- (-827.444) [-827.644] (-830.160) (-828.905) * (-827.386) (-828.707) [-829.408] (-832.374) -- 0:00:16
727000 -- [-827.245] (-832.498) (-828.721) (-829.080) * (-827.487) (-829.123) (-829.233) [-830.661] -- 0:00:16
727500 -- [-827.624] (-830.768) (-827.228) (-829.288) * (-827.902) (-833.579) (-829.790) [-830.107] -- 0:00:16
728000 -- (-827.621) (-829.567) (-830.490) [-828.186] * (-828.661) (-833.624) [-828.362] (-828.706) -- 0:00:16
728500 -- (-829.449) (-829.573) (-829.896) [-828.127] * (-829.517) (-827.437) [-829.116] (-828.574) -- 0:00:16
729000 -- [-828.427] (-833.999) (-827.778) (-831.395) * (-831.493) (-827.210) [-828.032] (-827.906) -- 0:00:16
729500 -- (-831.184) (-830.272) [-828.620] (-832.957) * (-828.010) (-827.185) (-829.467) [-829.857] -- 0:00:16
730000 -- (-830.165) (-829.210) (-827.857) [-826.794] * (-828.983) [-826.898] (-828.314) (-831.099) -- 0:00:16
Average standard deviation of split frequencies: 0.009355
730500 -- (-827.262) (-835.466) (-830.718) [-830.539] * (-829.363) (-827.894) [-827.600] (-827.432) -- 0:00:16
731000 -- (-831.217) (-830.970) (-831.229) [-827.339] * (-829.925) [-827.616] (-829.749) (-830.689) -- 0:00:16
731500 -- (-832.483) (-830.163) (-830.831) [-828.300] * (-830.457) [-827.300] (-828.159) (-829.674) -- 0:00:16
732000 -- (-827.138) (-827.961) [-830.429] (-828.158) * (-830.926) [-828.851] (-827.496) (-828.346) -- 0:00:16
732500 -- (-829.403) (-832.749) (-831.527) [-829.054] * (-833.719) (-827.398) (-832.152) [-827.420] -- 0:00:16
733000 -- (-829.028) (-831.366) (-827.851) [-830.343] * [-829.854] (-829.499) (-827.592) (-827.460) -- 0:00:16
733500 -- [-828.559] (-826.830) (-835.518) (-830.117) * (-828.223) (-828.003) (-827.435) [-829.654] -- 0:00:15
734000 -- [-828.439] (-828.655) (-828.347) (-829.792) * (-827.950) [-832.072] (-827.194) (-827.968) -- 0:00:15
734500 -- (-827.701) (-828.410) (-830.238) [-832.989] * (-826.721) [-828.505] (-827.118) (-827.556) -- 0:00:15
735000 -- (-829.160) (-834.106) (-832.562) [-829.539] * (-828.772) (-828.507) (-828.266) [-828.068] -- 0:00:15
Average standard deviation of split frequencies: 0.009167
735500 -- [-829.123] (-830.658) (-829.525) (-830.615) * (-827.890) (-830.608) [-830.717] (-829.863) -- 0:00:15
736000 -- (-827.338) [-828.933] (-828.513) (-829.285) * (-831.669) (-830.335) [-833.743] (-829.572) -- 0:00:15
736500 -- (-828.879) [-829.306] (-829.014) (-828.706) * (-829.533) (-831.111) (-828.200) [-831.348] -- 0:00:15
737000 -- (-829.934) [-827.008] (-830.508) (-829.416) * (-829.449) (-829.253) (-828.395) [-830.344] -- 0:00:15
737500 -- [-828.318] (-830.043) (-828.255) (-829.224) * [-829.364] (-828.609) (-831.072) (-829.945) -- 0:00:15
738000 -- (-828.816) (-829.688) (-831.954) [-828.695] * [-827.484] (-828.165) (-829.093) (-831.140) -- 0:00:15
738500 -- (-828.043) (-832.679) [-828.865] (-828.086) * (-828.661) (-828.587) [-827.186] (-832.399) -- 0:00:15
739000 -- (-831.595) [-829.360] (-828.229) (-828.424) * [-827.517] (-827.154) (-831.184) (-830.692) -- 0:00:15
739500 -- [-827.771] (-828.896) (-826.853) (-832.997) * (-828.795) (-827.984) (-828.807) [-827.990] -- 0:00:15
740000 -- [-830.091] (-831.520) (-827.944) (-829.806) * (-832.072) (-828.951) [-828.788] (-829.465) -- 0:00:15
Average standard deviation of split frequencies: 0.008712
740500 -- (-827.054) [-829.274] (-827.158) (-830.510) * (-827.895) [-830.077] (-831.552) (-835.208) -- 0:00:15
741000 -- [-831.412] (-828.879) (-827.836) (-829.670) * (-829.289) (-831.146) [-832.676] (-831.471) -- 0:00:15
741500 -- (-830.146) (-832.136) (-828.986) [-828.054] * (-829.049) (-829.056) (-834.022) [-828.493] -- 0:00:15
742000 -- (-828.610) (-828.837) [-827.832] (-830.245) * (-829.414) [-828.907] (-832.081) (-828.046) -- 0:00:15
742500 -- (-828.554) (-829.567) (-827.383) [-832.969] * [-827.939] (-828.937) (-833.400) (-827.982) -- 0:00:15
743000 -- [-832.307] (-828.741) (-826.603) (-828.500) * [-827.357] (-830.004) (-827.986) (-828.302) -- 0:00:15
743500 -- (-831.533) [-829.285] (-832.721) (-832.187) * (-827.161) (-829.771) [-829.153] (-832.601) -- 0:00:15
744000 -- (-831.695) [-826.946] (-829.124) (-832.232) * (-827.118) [-831.401] (-830.203) (-831.522) -- 0:00:15
744500 -- (-833.891) (-830.673) [-827.429] (-829.797) * (-831.095) (-829.968) (-828.061) [-834.932] -- 0:00:15
745000 -- (-831.011) [-828.802] (-828.648) (-828.882) * (-830.000) (-828.741) (-830.423) [-827.476] -- 0:00:15
Average standard deviation of split frequencies: 0.008689
745500 -- (-830.511) (-831.593) [-829.417] (-831.830) * (-830.703) (-829.451) [-828.340] (-827.312) -- 0:00:15
746000 -- (-828.304) (-832.134) [-827.440] (-830.482) * [-828.861] (-827.756) (-829.422) (-827.481) -- 0:00:15
746500 -- (-828.313) (-826.779) (-828.146) [-828.540] * [-831.095] (-826.986) (-828.958) (-834.250) -- 0:00:15
747000 -- (-831.335) (-826.825) [-829.699] (-831.503) * (-829.988) (-829.997) (-828.027) [-827.734] -- 0:00:15
747500 -- (-829.412) [-828.170] (-829.847) (-828.913) * (-828.141) (-833.141) (-828.114) [-828.958] -- 0:00:15
748000 -- (-829.674) (-827.542) (-827.747) [-831.323] * (-828.604) [-829.297] (-830.993) (-829.835) -- 0:00:15
748500 -- [-828.631] (-827.888) (-830.172) (-829.157) * (-828.601) (-829.104) [-828.013] (-828.288) -- 0:00:15
749000 -- (-827.144) (-828.767) [-830.001] (-830.841) * (-827.494) (-827.667) [-827.220] (-827.707) -- 0:00:15
749500 -- [-826.783] (-829.466) (-828.274) (-828.449) * (-829.507) (-831.261) [-827.465] (-828.799) -- 0:00:15
750000 -- (-827.467) (-829.215) [-828.708] (-826.943) * [-829.902] (-827.412) (-831.162) (-828.902) -- 0:00:15
Average standard deviation of split frequencies: 0.008988
750500 -- (-830.121) (-829.624) (-827.590) [-826.788] * (-829.369) (-828.360) (-829.301) [-828.802] -- 0:00:14
751000 -- [-830.097] (-827.319) (-827.779) (-831.092) * (-828.566) (-828.929) [-827.290] (-830.531) -- 0:00:14
751500 -- (-827.021) [-827.446] (-827.974) (-833.530) * (-828.942) (-828.538) (-827.735) [-831.309] -- 0:00:14
752000 -- (-830.373) (-829.820) [-827.494] (-828.510) * (-830.073) [-830.948] (-827.789) (-831.335) -- 0:00:14
752500 -- (-829.690) (-835.922) [-828.194] (-831.769) * (-831.038) [-829.345] (-828.618) (-828.262) -- 0:00:14
753000 -- (-834.099) (-832.420) [-831.775] (-829.934) * (-828.476) (-830.027) [-828.522] (-829.513) -- 0:00:14
753500 -- (-827.093) [-831.026] (-829.770) (-828.662) * (-828.074) (-827.002) [-826.995] (-827.026) -- 0:00:14
754000 -- (-828.277) (-829.054) (-827.861) [-829.548] * (-831.309) [-827.017] (-829.487) (-826.895) -- 0:00:14
754500 -- (-830.068) (-828.959) (-830.987) [-828.296] * (-829.648) [-826.732] (-830.933) (-828.209) -- 0:00:14
755000 -- (-828.026) (-827.856) [-829.942] (-829.264) * (-830.015) [-830.340] (-829.106) (-828.891) -- 0:00:14
Average standard deviation of split frequencies: 0.009197
755500 -- [-827.958] (-828.604) (-828.994) (-832.341) * (-830.504) (-828.316) (-828.198) [-832.836] -- 0:00:14
756000 -- [-827.653] (-828.217) (-829.792) (-827.492) * (-827.841) (-828.134) (-829.441) [-829.830] -- 0:00:14
756500 -- [-828.821] (-836.580) (-830.772) (-827.458) * [-830.605] (-828.219) (-829.453) (-827.306) -- 0:00:14
757000 -- (-827.900) (-827.986) (-829.189) [-827.584] * (-830.311) [-829.587] (-831.862) (-828.399) -- 0:00:14
757500 -- (-831.486) (-829.798) [-829.737] (-831.113) * (-829.534) (-829.729) (-828.877) [-829.657] -- 0:00:14
758000 -- [-828.519] (-833.804) (-829.824) (-828.396) * (-829.876) (-828.706) [-829.891] (-831.114) -- 0:00:14
758500 -- [-827.970] (-830.988) (-830.887) (-829.537) * (-831.796) (-828.056) (-830.392) [-828.949] -- 0:00:14
759000 -- [-827.176] (-832.398) (-829.866) (-830.391) * (-829.605) [-828.912] (-828.742) (-829.284) -- 0:00:14
759500 -- [-829.686] (-829.875) (-830.863) (-831.098) * (-831.657) (-828.561) (-827.603) [-828.722] -- 0:00:14
760000 -- (-828.293) [-828.264] (-827.548) (-827.558) * (-827.774) (-830.836) (-827.409) [-828.206] -- 0:00:14
Average standard deviation of split frequencies: 0.009257
760500 -- (-827.353) (-827.410) (-827.033) [-827.860] * [-831.454] (-827.896) (-831.159) (-827.811) -- 0:00:14
761000 -- [-829.292] (-830.624) (-834.210) (-827.126) * (-832.738) [-828.985] (-830.646) (-828.038) -- 0:00:14
761500 -- (-827.096) (-828.447) (-832.178) [-827.520] * (-829.499) [-833.099] (-829.084) (-831.331) -- 0:00:14
762000 -- (-829.346) (-828.864) [-830.229] (-827.719) * (-829.531) (-828.266) [-828.407] (-829.575) -- 0:00:14
762500 -- (-828.520) [-831.655] (-830.813) (-828.081) * (-831.723) [-828.527] (-830.461) (-832.622) -- 0:00:14
763000 -- (-828.836) (-828.961) (-831.194) [-828.085] * (-829.522) [-828.765] (-826.941) (-832.159) -- 0:00:14
763500 -- (-835.598) (-829.442) [-829.155] (-829.040) * (-827.752) [-829.661] (-827.885) (-829.117) -- 0:00:14
764000 -- (-829.580) [-827.098] (-831.508) (-829.899) * (-827.990) (-828.510) (-831.154) [-829.201] -- 0:00:14
764500 -- (-827.745) (-832.322) (-830.700) [-831.584] * (-827.663) (-828.298) (-829.076) [-830.082] -- 0:00:14
765000 -- (-830.681) (-828.166) (-829.633) [-834.290] * (-828.743) (-828.187) [-828.063] (-831.902) -- 0:00:14
Average standard deviation of split frequencies: 0.009347
765500 -- (-827.608) (-827.737) [-829.557] (-832.823) * [-829.675] (-829.490) (-827.061) (-828.572) -- 0:00:14
766000 -- (-830.159) (-828.531) [-829.361] (-827.828) * (-828.798) [-830.913] (-828.221) (-830.728) -- 0:00:14
766500 -- (-826.729) [-828.588] (-829.401) (-830.399) * [-827.955] (-830.484) (-831.789) (-829.099) -- 0:00:14
767000 -- (-829.503) (-829.817) [-829.034] (-828.523) * (-827.374) (-829.682) [-829.832] (-828.553) -- 0:00:13
767500 -- [-829.057] (-828.339) (-827.086) (-828.652) * [-828.063] (-831.416) (-833.685) (-834.144) -- 0:00:13
768000 -- (-830.294) [-827.457] (-832.088) (-829.549) * [-829.692] (-830.239) (-832.573) (-828.282) -- 0:00:13
768500 -- (-830.726) (-830.034) (-830.694) [-827.778] * [-827.063] (-829.000) (-830.954) (-827.549) -- 0:00:13
769000 -- (-826.763) (-829.819) (-829.209) [-828.718] * (-829.678) (-828.638) (-828.321) [-827.588] -- 0:00:13
769500 -- (-831.874) (-829.417) [-827.672] (-828.338) * [-832.070] (-828.018) (-827.875) (-827.354) -- 0:00:13
770000 -- [-831.269] (-828.863) (-830.279) (-827.057) * (-829.258) (-828.676) (-827.398) [-828.273] -- 0:00:13
Average standard deviation of split frequencies: 0.009137
770500 -- [-830.659] (-833.021) (-828.141) (-832.199) * [-831.447] (-827.478) (-829.658) (-828.078) -- 0:00:13
771000 -- (-832.843) [-833.365] (-829.185) (-831.274) * [-829.542] (-829.038) (-827.434) (-827.300) -- 0:00:13
771500 -- (-826.958) (-830.703) (-831.384) [-829.190] * (-827.224) (-829.268) (-827.302) [-829.045] -- 0:00:13
772000 -- (-826.681) (-830.675) (-835.395) [-828.715] * [-828.647] (-829.197) (-828.310) (-831.407) -- 0:00:13
772500 -- (-827.799) (-828.929) [-828.349] (-829.298) * (-829.714) (-830.160) (-828.172) [-829.847] -- 0:00:13
773000 -- (-829.310) [-828.270] (-829.722) (-828.185) * (-827.347) [-831.216] (-830.699) (-827.645) -- 0:00:13
773500 -- (-829.948) (-828.731) [-827.382] (-831.766) * (-827.735) (-830.208) (-830.406) [-829.823] -- 0:00:13
774000 -- (-829.053) (-828.448) (-828.041) [-828.408] * (-827.838) [-829.410] (-831.912) (-828.287) -- 0:00:13
774500 -- (-826.775) (-827.298) [-827.626] (-829.207) * (-829.630) (-831.486) (-830.594) [-829.964] -- 0:00:13
775000 -- (-827.460) (-828.654) [-827.999] (-829.152) * (-828.607) (-827.145) (-827.783) [-826.981] -- 0:00:13
Average standard deviation of split frequencies: 0.009112
775500 -- (-829.204) (-828.955) [-827.368] (-827.656) * [-828.950] (-829.589) (-827.224) (-831.618) -- 0:00:13
776000 -- (-828.163) (-828.211) (-829.530) [-832.584] * (-831.119) [-833.821] (-828.028) (-830.954) -- 0:00:13
776500 -- (-828.779) (-828.591) (-828.087) [-832.935] * (-826.856) [-827.548] (-827.253) (-829.973) -- 0:00:13
777000 -- (-827.783) [-829.673] (-828.055) (-830.742) * (-828.382) (-827.374) [-830.409] (-827.744) -- 0:00:13
777500 -- [-827.814] (-830.621) (-828.173) (-828.420) * (-833.332) [-830.097] (-832.067) (-827.365) -- 0:00:13
778000 -- [-829.945] (-831.641) (-830.777) (-831.134) * (-828.589) (-828.904) [-830.169] (-829.697) -- 0:00:13
778500 -- (-831.020) (-831.584) [-831.511] (-829.895) * (-831.079) (-828.387) (-827.670) [-831.261] -- 0:00:13
779000 -- [-830.091] (-830.238) (-830.884) (-830.259) * [-828.398] (-828.366) (-830.166) (-828.387) -- 0:00:13
779500 -- (-827.687) (-832.008) (-833.076) [-827.499] * [-830.120] (-828.818) (-827.996) (-829.662) -- 0:00:13
780000 -- (-829.984) (-827.442) (-827.153) [-828.572] * (-830.886) [-828.311] (-828.174) (-832.604) -- 0:00:13
Average standard deviation of split frequencies: 0.008680
780500 -- (-832.803) (-832.471) [-827.538] (-829.008) * (-835.502) (-832.928) (-830.971) [-829.356] -- 0:00:13
781000 -- (-830.810) (-828.314) [-827.208] (-831.685) * (-828.558) (-832.373) [-830.045] (-828.591) -- 0:00:13
781500 -- (-830.710) (-831.033) (-827.989) [-830.902] * (-827.176) [-827.476] (-831.904) (-827.964) -- 0:00:13
782000 -- [-828.556] (-829.630) (-834.234) (-834.405) * (-827.774) (-827.499) (-829.706) [-828.398] -- 0:00:13
782500 -- (-827.376) [-828.375] (-828.703) (-832.235) * (-827.821) [-831.145] (-828.412) (-834.351) -- 0:00:13
783000 -- (-827.267) [-827.580] (-826.689) (-830.159) * (-830.765) (-827.535) [-828.657] (-828.180) -- 0:00:13
783500 -- (-827.228) [-827.267] (-828.564) (-828.468) * (-828.499) (-829.427) (-829.644) [-830.651] -- 0:00:12
784000 -- (-826.911) (-829.728) [-827.575] (-826.827) * (-828.129) (-831.300) [-831.919] (-829.353) -- 0:00:12
784500 -- (-828.058) (-829.172) [-829.225] (-828.948) * (-828.500) (-827.624) (-828.920) [-827.724] -- 0:00:12
785000 -- (-828.280) (-829.751) [-828.196] (-829.610) * [-830.521] (-831.752) (-828.723) (-827.052) -- 0:00:12
Average standard deviation of split frequencies: 0.008659
785500 -- (-829.731) (-832.585) [-829.127] (-827.883) * (-834.549) (-828.588) [-827.027] (-829.476) -- 0:00:12
786000 -- [-827.589] (-828.055) (-827.282) (-828.466) * [-828.737] (-831.270) (-830.593) (-828.080) -- 0:00:12
786500 -- (-829.856) [-828.439] (-828.701) (-828.381) * (-827.580) (-828.856) (-829.557) [-828.424] -- 0:00:12
787000 -- (-829.978) (-828.121) [-828.331] (-828.173) * (-830.875) (-827.266) (-827.571) [-833.037] -- 0:00:12
787500 -- (-829.029) [-830.280] (-828.563) (-828.170) * (-829.627) (-829.138) [-830.565] (-829.480) -- 0:00:12
788000 -- [-828.926] (-830.025) (-831.166) (-828.966) * [-828.602] (-831.815) (-828.319) (-829.973) -- 0:00:12
788500 -- (-831.898) (-831.251) [-831.593] (-832.880) * (-827.492) (-831.063) (-828.469) [-830.537] -- 0:00:12
789000 -- (-829.935) [-832.293] (-832.054) (-828.677) * [-827.542] (-831.267) (-827.795) (-827.243) -- 0:00:12
789500 -- [-828.669] (-830.388) (-830.978) (-829.883) * (-830.294) (-829.102) [-828.205] (-827.778) -- 0:00:12
790000 -- [-828.564] (-827.766) (-828.759) (-832.081) * (-827.670) (-828.571) (-831.814) [-829.019] -- 0:00:12
Average standard deviation of split frequencies: 0.008198
790500 -- (-828.977) [-828.259] (-830.789) (-830.152) * (-827.926) [-827.930] (-828.544) (-830.438) -- 0:00:12
791000 -- [-828.015] (-829.834) (-830.147) (-828.417) * (-827.990) (-832.796) (-828.998) [-831.979] -- 0:00:12
791500 -- (-831.056) (-829.775) [-828.935] (-828.650) * (-828.313) (-829.691) [-830.234] (-831.603) -- 0:00:12
792000 -- (-833.119) [-830.793] (-829.462) (-829.899) * [-828.369] (-832.974) (-828.505) (-832.888) -- 0:00:12
792500 -- (-829.482) (-828.829) [-829.483] (-832.155) * (-828.432) [-830.685] (-828.977) (-827.747) -- 0:00:12
793000 -- (-828.888) [-829.203] (-831.504) (-829.167) * (-829.208) (-829.245) [-827.977] (-829.448) -- 0:00:12
793500 -- (-831.051) (-828.565) [-829.276] (-829.645) * [-827.914] (-830.093) (-831.391) (-829.678) -- 0:00:12
794000 -- (-829.533) [-827.599] (-830.053) (-828.422) * (-828.854) [-827.899] (-827.271) (-827.490) -- 0:00:12
794500 -- [-829.403] (-828.663) (-829.106) (-828.664) * [-828.095] (-828.093) (-828.396) (-827.470) -- 0:00:12
795000 -- [-829.652] (-829.819) (-832.730) (-829.257) * (-829.294) (-829.118) (-830.291) [-831.042] -- 0:00:12
Average standard deviation of split frequencies: 0.007884
795500 -- (-827.783) (-828.982) [-829.271] (-829.627) * [-828.138] (-828.210) (-830.046) (-828.562) -- 0:00:12
796000 -- [-833.329] (-828.953) (-827.577) (-826.754) * (-831.970) [-828.203] (-829.119) (-828.331) -- 0:00:12
796500 -- [-830.724] (-828.503) (-827.201) (-828.773) * (-829.483) (-828.307) [-828.805] (-827.689) -- 0:00:12
797000 -- (-829.226) (-828.182) (-828.775) [-829.778] * (-829.366) [-830.161] (-828.485) (-828.156) -- 0:00:12
797500 -- (-828.060) (-827.113) (-831.944) [-827.114] * (-829.857) [-831.621] (-827.533) (-828.427) -- 0:00:12
798000 -- [-828.878] (-829.448) (-831.438) (-828.812) * [-827.468] (-831.231) (-827.509) (-828.078) -- 0:00:12
798500 -- (-831.658) [-831.576] (-828.255) (-829.539) * [-828.288] (-830.711) (-828.077) (-828.393) -- 0:00:12
799000 -- [-828.780] (-829.172) (-827.943) (-828.756) * (-831.438) (-827.243) (-827.226) [-827.105] -- 0:00:12
799500 -- (-827.958) [-830.314] (-828.842) (-828.586) * (-828.534) (-827.592) (-829.821) [-828.079] -- 0:00:12
800000 -- (-832.784) (-831.709) [-831.086] (-828.760) * (-830.501) [-827.051] (-834.588) (-832.380) -- 0:00:12
Average standard deviation of split frequencies: 0.008022
800500 -- (-831.863) (-832.124) [-829.379] (-828.408) * (-831.525) (-827.576) (-833.028) [-829.793] -- 0:00:11
801000 -- (-833.746) [-831.611] (-829.415) (-833.927) * [-827.915] (-829.453) (-829.795) (-828.259) -- 0:00:11
801500 -- [-828.095] (-830.788) (-832.160) (-829.941) * (-832.991) [-828.289] (-828.052) (-829.326) -- 0:00:11
802000 -- (-827.332) (-827.414) (-827.809) [-828.352] * (-829.646) (-827.776) (-830.873) [-829.409] -- 0:00:11
802500 -- (-831.109) (-829.089) (-829.950) [-828.705] * (-832.148) [-827.556] (-827.411) (-829.013) -- 0:00:11
803000 -- (-828.708) [-828.965] (-833.487) (-827.628) * (-828.013) (-829.356) (-833.017) [-827.588] -- 0:00:11
803500 -- (-829.485) (-829.690) (-828.025) [-830.050] * (-828.443) (-829.214) [-828.501] (-828.531) -- 0:00:11
804000 -- (-828.872) (-827.819) (-827.757) [-828.404] * [-827.766] (-829.225) (-829.364) (-828.904) -- 0:00:11
804500 -- (-829.265) [-827.646] (-829.010) (-830.406) * (-828.402) [-829.963] (-827.782) (-831.669) -- 0:00:11
805000 -- [-829.503] (-830.754) (-829.821) (-828.820) * [-827.977] (-829.196) (-827.644) (-829.435) -- 0:00:11
Average standard deviation of split frequencies: 0.008005
805500 -- (-829.010) (-830.016) (-827.751) [-828.341] * (-827.871) [-827.334] (-829.234) (-830.226) -- 0:00:11
806000 -- [-829.409] (-829.795) (-827.195) (-827.177) * (-829.899) (-827.778) [-830.553] (-828.970) -- 0:00:11
806500 -- (-827.590) (-829.579) (-830.456) [-827.917] * (-829.023) [-835.814] (-828.524) (-830.951) -- 0:00:11
807000 -- (-827.557) (-833.580) [-828.153] (-827.528) * (-833.702) (-829.928) (-826.780) [-831.841] -- 0:00:11
807500 -- (-828.341) [-832.421] (-830.670) (-831.850) * (-829.896) (-833.087) (-829.939) [-830.577] -- 0:00:11
808000 -- [-829.079] (-834.778) (-832.801) (-828.001) * (-829.824) (-829.629) (-830.297) [-829.741] -- 0:00:11
808500 -- (-827.635) (-826.827) (-830.414) [-831.316] * (-828.632) (-827.901) (-828.466) [-828.631] -- 0:00:11
809000 -- (-828.085) [-826.896] (-829.117) (-829.184) * [-830.025] (-828.832) (-831.537) (-828.552) -- 0:00:11
809500 -- [-827.984] (-827.233) (-829.909) (-828.284) * (-829.933) [-827.953] (-829.643) (-828.836) -- 0:00:11
810000 -- [-828.009] (-826.744) (-828.143) (-830.548) * [-827.214] (-828.445) (-833.045) (-829.264) -- 0:00:11
Average standard deviation of split frequencies: 0.007923
810500 -- [-828.680] (-826.922) (-827.871) (-829.600) * (-827.958) (-827.426) (-832.981) [-833.875] -- 0:00:11
811000 -- (-830.729) (-827.673) (-827.146) [-829.600] * [-828.940] (-827.761) (-827.535) (-832.818) -- 0:00:11
811500 -- [-827.937] (-829.423) (-827.570) (-829.036) * (-827.833) (-830.904) [-828.362] (-833.646) -- 0:00:11
812000 -- (-829.033) [-826.645] (-829.894) (-826.696) * (-829.550) (-833.425) [-828.474] (-830.544) -- 0:00:11
812500 -- (-826.948) [-827.599] (-830.860) (-828.765) * [-830.470] (-828.927) (-828.386) (-829.247) -- 0:00:11
813000 -- (-828.234) (-828.711) (-831.914) [-828.495] * (-832.398) [-828.622] (-828.165) (-831.770) -- 0:00:11
813500 -- [-834.075] (-829.405) (-829.027) (-829.884) * [-828.659] (-830.902) (-828.524) (-830.796) -- 0:00:11
814000 -- (-834.957) (-829.712) [-828.678] (-828.124) * (-829.323) (-828.733) (-828.484) [-828.436] -- 0:00:11
814500 -- (-828.554) [-828.957] (-831.224) (-830.459) * (-829.276) (-828.013) [-827.846] (-828.032) -- 0:00:11
815000 -- (-831.153) (-830.905) [-828.308] (-830.315) * (-831.823) (-831.487) (-827.721) [-826.886] -- 0:00:11
Average standard deviation of split frequencies: 0.007655
815500 -- (-828.366) (-829.597) [-827.454] (-827.382) * (-830.411) (-829.844) (-830.627) [-827.628] -- 0:00:11
816000 -- (-828.757) (-832.321) [-828.941] (-827.835) * (-831.183) [-831.780] (-827.191) (-829.297) -- 0:00:11
816500 -- (-829.347) (-829.389) (-829.036) [-827.835] * (-827.366) [-828.853] (-827.522) (-827.932) -- 0:00:11
817000 -- (-828.813) [-827.839] (-831.129) (-830.775) * [-830.044] (-827.284) (-827.940) (-831.109) -- 0:00:10
817500 -- (-827.601) (-833.121) (-830.697) [-830.298] * (-831.289) [-829.969] (-828.289) (-830.641) -- 0:00:10
818000 -- [-829.175] (-832.725) (-829.670) (-829.367) * (-829.332) (-829.080) (-828.428) [-828.735] -- 0:00:10
818500 -- [-827.862] (-832.327) (-828.542) (-832.574) * (-828.784) [-830.533] (-836.405) (-828.685) -- 0:00:10
819000 -- (-831.182) [-832.468] (-828.922) (-828.326) * (-827.163) [-830.661] (-832.763) (-829.377) -- 0:00:10
819500 -- [-829.899] (-829.969) (-828.535) (-828.373) * (-828.220) (-830.623) (-832.082) [-830.276] -- 0:00:10
820000 -- (-832.439) (-828.764) [-829.325] (-829.727) * (-832.242) (-828.670) [-828.113] (-829.525) -- 0:00:10
Average standard deviation of split frequencies: 0.007539
820500 -- [-829.390] (-827.509) (-829.080) (-828.278) * (-834.926) [-832.794] (-829.059) (-831.415) -- 0:00:10
821000 -- (-828.896) (-827.355) (-827.996) [-828.075] * [-829.781] (-833.691) (-829.697) (-834.740) -- 0:00:10
821500 -- (-827.722) (-831.858) (-827.397) [-828.716] * [-827.741] (-827.985) (-829.511) (-828.229) -- 0:00:10
822000 -- (-829.058) [-830.452] (-831.397) (-828.788) * (-828.822) (-829.859) [-830.471] (-827.568) -- 0:00:10
822500 -- (-827.805) (-828.546) (-829.831) [-828.218] * (-830.006) [-828.026] (-828.139) (-827.931) -- 0:00:10
823000 -- [-828.632] (-827.358) (-828.420) (-829.198) * (-831.470) (-832.677) (-827.334) [-829.662] -- 0:00:10
823500 -- [-827.465] (-827.866) (-828.842) (-829.027) * (-832.999) (-831.406) [-827.977] (-833.162) -- 0:00:10
824000 -- (-827.859) (-829.263) [-829.370] (-831.568) * [-830.145] (-828.262) (-830.679) (-830.170) -- 0:00:10
824500 -- (-829.561) [-828.871] (-829.684) (-832.565) * (-828.308) [-828.270] (-831.985) (-827.649) -- 0:00:10
825000 -- (-831.966) (-828.794) (-828.237) [-827.799] * (-827.855) [-828.043] (-830.810) (-827.424) -- 0:00:10
Average standard deviation of split frequencies: 0.007419
825500 -- [-831.246] (-830.842) (-832.371) (-831.668) * (-829.275) [-829.214] (-832.501) (-827.877) -- 0:00:10
826000 -- (-827.220) (-827.523) (-831.693) [-831.250] * (-829.705) (-828.120) [-829.672] (-827.619) -- 0:00:10
826500 -- [-828.008] (-828.266) (-829.526) (-830.944) * (-828.071) (-829.803) (-828.050) [-827.446] -- 0:00:10
827000 -- (-829.236) [-831.155] (-829.656) (-833.164) * [-827.757] (-832.182) (-828.554) (-829.431) -- 0:00:10
827500 -- (-830.154) [-828.591] (-833.934) (-831.014) * [-828.625] (-827.360) (-830.931) (-832.304) -- 0:00:10
828000 -- [-827.334] (-827.211) (-828.405) (-829.752) * [-827.118] (-828.064) (-832.417) (-831.180) -- 0:00:10
828500 -- (-827.915) (-827.903) [-829.179] (-834.718) * (-827.120) (-828.959) [-828.556] (-829.353) -- 0:00:10
829000 -- [-826.962] (-828.935) (-829.399) (-830.621) * (-827.119) (-833.745) [-829.113] (-830.510) -- 0:00:10
829500 -- [-827.914] (-828.537) (-832.468) (-828.591) * (-828.441) (-832.722) [-827.030] (-828.672) -- 0:00:10
830000 -- (-830.607) [-828.256] (-829.613) (-830.193) * [-827.077] (-828.550) (-827.174) (-828.558) -- 0:00:10
Average standard deviation of split frequencies: 0.007732
830500 -- (-829.000) (-828.269) (-831.683) [-830.414] * (-827.643) [-829.501] (-827.779) (-828.873) -- 0:00:10
831000 -- [-828.024] (-829.553) (-829.889) (-829.347) * (-828.796) [-829.107] (-827.049) (-832.178) -- 0:00:10
831500 -- (-828.143) (-827.716) [-828.982] (-828.991) * (-827.159) (-827.868) [-829.250] (-836.272) -- 0:00:10
832000 -- (-829.204) (-828.117) [-827.992] (-827.127) * (-827.160) (-828.867) [-828.329] (-830.391) -- 0:00:10
832500 -- (-831.309) (-827.227) [-828.350] (-826.697) * (-828.879) (-827.673) (-833.770) [-829.708] -- 0:00:10
833000 -- (-829.273) [-828.901] (-827.848) (-828.274) * (-827.682) (-830.503) (-830.271) [-829.901] -- 0:00:10
833500 -- [-831.434] (-829.601) (-829.508) (-828.062) * (-827.840) (-830.891) (-828.874) [-829.556] -- 0:00:09
834000 -- (-828.723) [-829.745] (-828.588) (-828.309) * (-829.304) (-830.292) [-828.578] (-829.046) -- 0:00:09
834500 -- [-831.724] (-830.974) (-830.200) (-828.282) * [-828.388] (-828.252) (-828.678) (-828.978) -- 0:00:09
835000 -- (-830.734) (-829.787) [-827.977] (-828.948) * (-829.488) [-828.410] (-831.331) (-830.679) -- 0:00:09
Average standard deviation of split frequencies: 0.008176
835500 -- (-829.830) [-827.601] (-829.349) (-830.081) * (-829.770) (-827.248) [-829.147] (-830.235) -- 0:00:09
836000 -- (-831.031) (-828.561) [-827.561] (-828.271) * [-827.681] (-828.234) (-827.124) (-829.992) -- 0:00:09
836500 -- (-829.066) [-829.428] (-829.982) (-830.430) * (-829.276) (-827.585) [-832.882] (-828.863) -- 0:00:09
837000 -- [-830.283] (-830.056) (-828.974) (-830.400) * (-828.405) [-827.781] (-835.220) (-828.910) -- 0:00:09
837500 -- (-828.860) [-829.563] (-832.257) (-828.782) * (-834.181) [-829.120] (-828.819) (-828.941) -- 0:00:09
838000 -- (-828.478) (-830.608) [-828.841] (-828.229) * (-830.398) (-827.729) [-827.993] (-827.551) -- 0:00:09
838500 -- (-829.941) (-829.811) [-831.193] (-835.239) * [-827.660] (-831.222) (-828.933) (-828.460) -- 0:00:09
839000 -- (-830.060) (-827.918) (-828.714) [-829.701] * (-829.014) (-829.721) (-829.407) [-828.218] -- 0:00:09
839500 -- (-832.344) (-829.835) [-828.753] (-828.222) * [-828.867] (-828.393) (-827.726) (-832.513) -- 0:00:09
840000 -- (-829.922) (-834.154) (-828.391) [-829.319] * (-829.681) [-828.327] (-828.359) (-828.405) -- 0:00:09
Average standard deviation of split frequencies: 0.008341
840500 -- (-829.552) (-831.256) (-829.012) [-829.952] * (-828.117) (-829.000) [-829.165] (-830.599) -- 0:00:09
841000 -- [-827.607] (-831.020) (-833.276) (-828.264) * (-828.283) [-829.398] (-828.778) (-832.940) -- 0:00:09
841500 -- (-828.358) (-829.508) (-829.029) [-828.108] * (-829.039) [-827.623] (-828.360) (-834.740) -- 0:00:09
842000 -- [-826.828] (-828.267) (-829.398) (-827.776) * (-829.871) (-829.557) [-829.133] (-827.729) -- 0:00:09
842500 -- (-831.600) (-829.191) [-827.556] (-829.412) * (-829.626) [-831.979] (-829.696) (-828.521) -- 0:00:09
843000 -- [-833.123] (-830.107) (-827.482) (-829.087) * (-828.160) (-828.911) (-828.701) [-830.725] -- 0:00:09
843500 -- (-828.298) (-833.248) (-830.012) [-827.997] * (-828.405) (-828.813) [-828.942] (-830.187) -- 0:00:09
844000 -- (-828.711) [-831.528] (-830.274) (-829.783) * (-829.753) (-827.532) (-827.283) [-831.599] -- 0:00:09
844500 -- (-833.128) (-830.658) (-829.428) [-831.725] * (-830.646) [-828.087] (-828.855) (-830.517) -- 0:00:09
845000 -- (-833.149) (-831.499) (-828.042) [-830.711] * (-827.023) (-831.244) (-835.267) [-828.218] -- 0:00:09
Average standard deviation of split frequencies: 0.008289
845500 -- [-829.017] (-832.753) (-828.192) (-830.091) * (-832.329) [-827.867] (-833.039) (-828.287) -- 0:00:09
846000 -- [-832.261] (-830.798) (-836.158) (-833.511) * [-831.342] (-827.874) (-829.321) (-829.953) -- 0:00:09
846500 -- (-829.938) [-831.217] (-835.061) (-827.907) * (-832.325) (-827.580) [-830.328] (-830.108) -- 0:00:09
847000 -- (-827.976) (-828.161) (-827.277) [-829.202] * (-832.515) (-827.962) (-829.346) [-831.001] -- 0:00:09
847500 -- (-832.538) (-828.827) [-828.556] (-829.233) * (-830.919) (-828.916) (-830.715) [-829.738] -- 0:00:09
848000 -- [-831.545] (-832.006) (-829.905) (-829.781) * (-828.841) (-830.546) (-831.565) [-829.766] -- 0:00:09
848500 -- (-830.287) (-830.714) (-827.618) [-829.453] * [-830.785] (-833.594) (-828.846) (-828.056) -- 0:00:09
849000 -- (-827.137) [-829.831] (-832.451) (-829.965) * [-829.831] (-828.477) (-828.324) (-826.864) -- 0:00:09
849500 -- (-829.760) (-829.787) [-830.559] (-830.713) * (-830.277) (-829.570) [-828.492] (-827.354) -- 0:00:09
850000 -- [-828.908] (-830.291) (-827.387) (-829.154) * (-830.269) (-828.309) [-827.951] (-827.717) -- 0:00:09
Average standard deviation of split frequencies: 0.008624
850500 -- (-830.728) (-831.155) [-829.950] (-829.676) * [-832.086] (-831.084) (-828.823) (-831.219) -- 0:00:08
851000 -- (-827.713) (-830.928) (-827.074) [-829.139] * [-830.787] (-828.673) (-829.179) (-827.097) -- 0:00:08
851500 -- (-827.900) [-832.492] (-827.680) (-829.356) * (-829.026) (-832.435) [-827.235] (-827.321) -- 0:00:08
852000 -- (-828.406) (-827.315) [-829.439] (-830.873) * (-829.823) (-829.033) (-832.951) [-828.541] -- 0:00:08
852500 -- (-827.795) [-831.621] (-831.300) (-827.865) * (-834.054) (-828.602) (-827.737) [-827.107] -- 0:00:08
853000 -- (-831.395) (-832.649) [-830.623] (-830.885) * (-829.542) (-828.463) [-827.021] (-828.161) -- 0:00:08
853500 -- [-828.390] (-828.367) (-827.858) (-836.135) * (-828.675) (-830.481) (-830.225) [-829.086] -- 0:00:08
854000 -- (-828.119) [-827.656] (-827.881) (-828.943) * (-827.875) [-830.141] (-829.979) (-828.869) -- 0:00:08
854500 -- (-828.763) (-830.590) [-827.748] (-829.594) * (-828.591) [-830.147] (-827.854) (-831.110) -- 0:00:08
855000 -- (-828.469) [-828.109] (-830.165) (-828.477) * (-828.864) (-828.628) [-827.808] (-829.819) -- 0:00:08
Average standard deviation of split frequencies: 0.008467
855500 -- (-831.095) [-829.871] (-829.039) (-829.054) * (-829.214) [-835.079] (-827.737) (-831.106) -- 0:00:08
856000 -- (-831.555) (-829.077) (-828.894) [-827.913] * [-830.054] (-828.418) (-829.244) (-827.963) -- 0:00:08
856500 -- (-828.184) (-829.901) (-827.529) [-826.618] * (-829.405) (-828.472) [-828.263] (-828.935) -- 0:00:08
857000 -- (-828.054) (-827.203) (-829.243) [-828.012] * (-830.746) (-828.525) (-831.188) [-827.955] -- 0:00:08
857500 -- (-830.235) (-832.296) (-827.932) [-830.042] * (-830.550) (-827.727) [-830.436] (-831.700) -- 0:00:08
858000 -- [-830.356] (-830.396) (-827.140) (-830.075) * (-829.116) (-827.693) (-829.351) [-827.241] -- 0:00:08
858500 -- (-828.916) (-828.572) [-827.569] (-829.087) * (-829.071) [-828.867] (-826.773) (-828.444) -- 0:00:08
859000 -- (-828.865) (-831.481) [-827.942] (-828.828) * (-829.066) (-827.384) (-829.922) [-826.971] -- 0:00:08
859500 -- (-831.504) [-828.556] (-829.206) (-829.934) * (-828.963) (-830.875) [-826.864] (-827.869) -- 0:00:08
860000 -- (-827.953) (-828.388) (-829.645) [-827.241] * [-826.916] (-830.733) (-829.368) (-830.462) -- 0:00:08
Average standard deviation of split frequencies: 0.008045
860500 -- (-834.395) (-830.784) [-829.771] (-829.917) * (-826.840) (-830.753) (-826.960) [-828.485] -- 0:00:08
861000 -- (-828.343) (-827.346) [-830.147] (-829.191) * (-827.968) (-829.921) [-826.967] (-830.211) -- 0:00:08
861500 -- [-828.345] (-829.929) (-829.187) (-829.412) * (-828.678) (-829.133) [-828.207] (-828.783) -- 0:00:08
862000 -- (-829.392) (-828.908) [-828.518] (-832.218) * (-826.820) (-829.594) (-830.422) [-832.822] -- 0:00:08
862500 -- (-828.923) [-828.991] (-831.239) (-831.341) * (-827.202) (-828.386) (-831.163) [-828.020] -- 0:00:08
863000 -- [-827.058] (-827.998) (-833.483) (-836.419) * (-828.006) (-828.715) (-828.501) [-829.680] -- 0:00:08
863500 -- (-831.981) (-827.299) [-830.234] (-828.329) * [-827.907] (-827.924) (-829.042) (-827.571) -- 0:00:08
864000 -- [-833.409] (-830.221) (-827.658) (-828.983) * (-829.143) [-827.316] (-832.108) (-828.209) -- 0:00:08
864500 -- [-830.173] (-827.195) (-827.020) (-827.786) * (-830.278) (-828.285) (-828.514) [-827.557] -- 0:00:08
865000 -- (-829.889) [-830.714] (-829.727) (-833.200) * (-832.819) (-828.289) [-827.207] (-828.496) -- 0:00:08
Average standard deviation of split frequencies: 0.008131
865500 -- (-830.136) (-829.870) [-829.031] (-829.831) * (-832.040) [-829.376] (-831.059) (-830.393) -- 0:00:08
866000 -- (-829.339) [-830.946] (-829.046) (-829.716) * (-831.162) (-828.489) [-828.900] (-829.133) -- 0:00:08
866500 -- (-831.276) (-828.351) (-829.051) [-827.330] * [-833.301] (-827.515) (-829.129) (-829.753) -- 0:00:08
867000 -- (-828.802) [-827.625] (-829.210) (-828.914) * (-838.074) [-829.713] (-827.543) (-832.855) -- 0:00:07
867500 -- (-827.616) (-827.945) (-829.133) [-832.429] * (-832.038) [-829.516] (-827.735) (-828.598) -- 0:00:07
868000 -- (-831.361) (-829.845) (-829.088) [-828.561] * [-827.200] (-828.603) (-830.277) (-828.291) -- 0:00:07
868500 -- (-829.580) [-830.420] (-829.434) (-828.528) * [-827.380] (-828.783) (-828.940) (-828.873) -- 0:00:07
869000 -- [-827.933] (-827.279) (-827.056) (-828.659) * (-827.203) (-828.941) [-828.348] (-827.642) -- 0:00:07
869500 -- (-826.633) (-828.632) [-826.678] (-828.427) * (-828.601) (-827.463) [-829.000] (-827.938) -- 0:00:07
870000 -- (-828.314) (-831.899) [-828.724] (-831.681) * (-828.582) (-831.983) (-830.762) [-828.154] -- 0:00:07
Average standard deviation of split frequencies: 0.008291
870500 -- (-829.284) (-828.807) (-829.889) [-829.535] * (-830.674) [-830.189] (-829.744) (-828.032) -- 0:00:07
871000 -- (-827.864) (-828.325) (-829.126) [-830.006] * (-829.080) [-827.091] (-827.995) (-829.135) -- 0:00:07
871500 -- (-831.519) [-832.989] (-828.481) (-827.603) * (-830.939) (-827.433) (-828.964) [-832.860] -- 0:00:07
872000 -- [-829.998] (-830.106) (-827.752) (-827.604) * (-830.164) [-828.297] (-828.545) (-829.809) -- 0:00:07
872500 -- (-828.509) (-828.935) [-828.181] (-829.935) * (-827.679) [-829.370] (-829.621) (-827.843) -- 0:00:07
873000 -- [-832.346] (-832.409) (-833.188) (-832.859) * (-827.344) [-833.937] (-829.860) (-829.093) -- 0:00:07
873500 -- [-827.520] (-830.324) (-829.672) (-832.137) * (-828.438) [-829.246] (-829.690) (-828.140) -- 0:00:07
874000 -- [-827.242] (-832.287) (-827.435) (-830.382) * (-830.435) (-828.450) (-829.548) [-828.229] -- 0:00:07
874500 -- (-829.280) (-830.087) (-827.511) [-829.255] * (-828.653) [-827.635] (-829.230) (-829.521) -- 0:00:07
875000 -- (-829.055) (-828.494) (-827.588) [-828.941] * [-832.698] (-827.785) (-829.690) (-830.270) -- 0:00:07
Average standard deviation of split frequencies: 0.008106
875500 -- (-827.660) (-832.232) (-832.607) [-827.982] * [-828.073] (-828.058) (-828.207) (-828.789) -- 0:00:07
876000 -- (-827.569) (-829.544) [-828.113] (-828.848) * (-830.446) [-830.433] (-831.045) (-829.059) -- 0:00:07
876500 -- (-828.801) [-827.677] (-832.113) (-827.333) * [-828.014] (-827.665) (-831.019) (-832.921) -- 0:00:07
877000 -- (-834.556) [-827.568] (-836.325) (-827.804) * [-829.811] (-829.498) (-831.367) (-834.687) -- 0:00:07
877500 -- (-830.203) (-826.862) (-829.877) [-829.796] * [-828.610] (-830.454) (-829.516) (-831.802) -- 0:00:07
878000 -- (-831.798) (-829.126) (-829.485) [-829.940] * (-831.020) (-828.790) (-832.147) [-830.490] -- 0:00:07
878500 -- [-828.794] (-827.834) (-828.269) (-828.055) * (-828.182) [-829.136] (-830.273) (-829.548) -- 0:00:07
879000 -- (-827.747) (-828.533) [-832.568] (-827.952) * (-832.906) (-828.802) (-829.423) [-827.604] -- 0:00:07
879500 -- (-830.571) (-828.970) [-828.834] (-830.792) * (-827.551) [-832.569] (-829.547) (-828.438) -- 0:00:07
880000 -- (-830.636) (-827.054) [-827.432] (-829.934) * [-828.438] (-828.636) (-828.507) (-827.017) -- 0:00:07
Average standard deviation of split frequencies: 0.007962
880500 -- (-829.445) [-828.124] (-829.646) (-829.092) * (-830.174) (-827.735) [-831.123] (-827.780) -- 0:00:07
881000 -- (-829.752) (-828.940) [-828.147] (-829.731) * (-829.838) (-829.044) (-830.918) [-829.637] -- 0:00:07
881500 -- (-826.892) (-830.406) [-828.711] (-828.797) * (-829.339) (-829.421) (-828.222) [-830.530] -- 0:00:07
882000 -- (-830.714) (-828.504) [-828.393] (-827.998) * (-830.972) [-827.697] (-831.094) (-829.047) -- 0:00:07
882500 -- (-829.210) (-830.004) [-832.033] (-829.149) * (-831.982) (-829.366) (-832.287) [-828.012] -- 0:00:07
883000 -- (-828.410) (-829.893) [-829.653] (-832.804) * (-831.516) (-829.716) (-833.136) [-828.678] -- 0:00:07
883500 -- [-827.005] (-828.112) (-831.050) (-834.306) * (-827.035) (-828.582) (-827.423) [-832.312] -- 0:00:06
884000 -- [-828.197] (-829.791) (-828.615) (-827.022) * [-827.902] (-829.881) (-827.653) (-834.857) -- 0:00:06
884500 -- (-829.290) (-829.832) (-831.754) [-827.573] * (-830.507) (-829.974) [-827.809] (-828.242) -- 0:00:06
885000 -- (-828.769) [-828.093] (-829.405) (-827.761) * (-830.551) (-828.954) (-828.364) [-827.180] -- 0:00:06
Average standard deviation of split frequencies: 0.007815
885500 -- [-830.241] (-827.763) (-828.411) (-827.405) * [-829.562] (-832.754) (-828.524) (-827.768) -- 0:00:06
886000 -- [-831.915] (-829.523) (-829.951) (-828.833) * (-830.670) [-830.415] (-835.874) (-831.812) -- 0:00:06
886500 -- (-829.255) (-827.772) [-830.137] (-827.724) * [-828.362] (-828.631) (-827.290) (-828.836) -- 0:00:06
887000 -- (-828.671) [-828.132] (-827.086) (-827.416) * (-835.857) (-834.410) (-828.865) [-829.845] -- 0:00:06
887500 -- (-828.359) (-830.556) [-828.502] (-827.869) * (-829.999) (-829.021) [-828.103] (-827.752) -- 0:00:06
888000 -- (-829.655) [-827.240] (-826.869) (-828.961) * (-829.222) [-834.405] (-829.812) (-828.616) -- 0:00:06
888500 -- (-830.529) (-829.486) [-826.884] (-827.702) * (-828.635) (-831.024) (-829.622) [-828.100] -- 0:00:06
889000 -- (-828.538) (-832.095) (-828.976) [-829.440] * [-828.207] (-829.655) (-835.456) (-829.632) -- 0:00:06
889500 -- (-829.612) (-829.875) (-829.732) [-827.573] * [-831.901] (-831.456) (-832.026) (-826.996) -- 0:00:06
890000 -- (-827.699) (-829.826) [-827.863] (-828.896) * (-833.674) (-834.577) [-828.032] (-829.098) -- 0:00:06
Average standard deviation of split frequencies: 0.007708
890500 -- (-828.319) [-830.740] (-829.271) (-829.603) * (-830.704) (-833.364) (-828.021) [-828.228] -- 0:00:06
891000 -- (-831.880) (-829.316) [-827.578] (-830.225) * (-828.627) (-828.740) [-829.054] (-828.394) -- 0:00:06
891500 -- (-827.859) (-827.797) [-829.778] (-826.877) * [-831.089] (-829.426) (-829.602) (-829.123) -- 0:00:06
892000 -- (-828.383) (-829.616) [-828.218] (-829.492) * [-828.311] (-829.700) (-828.976) (-826.810) -- 0:00:06
892500 -- (-829.207) (-829.898) [-828.694] (-828.678) * (-830.107) (-829.313) [-827.004] (-829.654) -- 0:00:06
893000 -- [-828.397] (-827.746) (-830.872) (-830.067) * (-829.828) [-828.142] (-828.830) (-829.071) -- 0:00:06
893500 -- (-833.629) (-827.234) (-828.067) [-829.492] * (-831.613) (-828.296) [-828.677] (-831.398) -- 0:00:06
894000 -- [-829.182] (-828.163) (-828.221) (-830.808) * (-830.384) [-836.525] (-829.131) (-828.641) -- 0:00:06
894500 -- (-831.254) (-827.797) [-827.662] (-829.163) * (-832.198) (-830.496) (-829.254) [-827.444] -- 0:00:06
895000 -- (-829.413) (-827.168) [-831.739] (-829.942) * [-828.997] (-830.937) (-828.661) (-829.476) -- 0:00:06
Average standard deviation of split frequencies: 0.007695
895500 -- (-828.063) [-832.451] (-829.558) (-830.539) * (-828.448) [-830.801] (-827.570) (-830.519) -- 0:00:06
896000 -- (-828.769) [-828.176] (-829.133) (-830.459) * (-831.394) [-827.643] (-828.685) (-833.348) -- 0:00:06
896500 -- (-827.636) (-826.730) (-828.573) [-830.412] * [-827.517] (-827.039) (-829.561) (-829.230) -- 0:00:06
897000 -- (-828.311) (-827.396) [-828.530] (-827.774) * (-827.484) (-828.079) (-834.070) [-828.201] -- 0:00:06
897500 -- (-830.203) [-827.693] (-829.378) (-828.024) * (-828.190) (-827.761) (-830.162) [-829.325] -- 0:00:06
898000 -- (-827.283) (-829.021) (-830.456) [-827.908] * (-831.970) (-830.666) (-828.726) [-828.167] -- 0:00:06
898500 -- (-832.805) (-828.698) [-834.466] (-827.201) * [-829.006] (-833.470) (-829.069) (-831.730) -- 0:00:06
899000 -- (-830.101) (-828.258) [-832.317] (-827.824) * (-828.916) (-829.474) (-829.058) [-831.470] -- 0:00:06
899500 -- [-830.125] (-828.845) (-830.763) (-830.240) * (-830.918) [-827.653] (-828.557) (-828.089) -- 0:00:06
900000 -- (-828.435) (-829.787) [-831.784] (-828.128) * [-828.118] (-827.659) (-828.557) (-827.861) -- 0:00:06
Average standard deviation of split frequencies: 0.007851
900500 -- (-831.292) (-828.877) [-832.184] (-829.675) * (-827.316) (-829.484) [-831.197] (-827.954) -- 0:00:05
901000 -- (-831.574) [-827.853] (-827.774) (-830.217) * (-827.102) [-827.916] (-830.059) (-830.758) -- 0:00:05
901500 -- (-831.193) [-831.679] (-831.097) (-832.386) * (-831.683) [-827.405] (-829.372) (-828.447) -- 0:00:05
902000 -- (-830.990) (-829.005) (-828.563) [-829.919] * [-828.297] (-827.892) (-832.975) (-830.560) -- 0:00:05
902500 -- (-829.691) [-828.325] (-828.590) (-829.082) * (-827.459) (-831.306) [-828.273] (-827.846) -- 0:00:05
903000 -- (-829.644) [-829.471] (-829.309) (-827.868) * (-827.678) (-830.623) [-828.784] (-829.397) -- 0:00:05
903500 -- (-829.926) (-828.505) [-831.551] (-831.438) * (-828.040) [-828.681] (-828.133) (-830.364) -- 0:00:05
904000 -- [-829.164] (-827.966) (-828.020) (-827.702) * (-828.854) (-827.719) (-827.020) [-830.139] -- 0:00:05
904500 -- (-828.434) (-828.886) (-831.156) [-826.645] * (-828.963) (-831.840) (-830.419) [-829.300] -- 0:00:05
905000 -- [-828.171] (-831.623) (-829.421) (-827.103) * [-830.334] (-829.415) (-829.900) (-829.116) -- 0:00:05
Average standard deviation of split frequencies: 0.007935
905500 -- (-827.909) [-829.881] (-828.500) (-829.289) * (-827.538) [-828.409] (-831.412) (-828.106) -- 0:00:05
906000 -- [-828.845] (-829.954) (-828.712) (-828.902) * [-827.687] (-831.625) (-827.540) (-830.586) -- 0:00:05
906500 -- (-831.338) (-829.273) [-830.184] (-828.540) * (-828.460) [-829.414] (-833.462) (-829.606) -- 0:00:05
907000 -- (-828.180) (-830.907) (-828.953) [-828.120] * [-831.322] (-834.979) (-832.791) (-830.269) -- 0:00:05
907500 -- (-829.543) (-833.273) (-828.812) [-832.756] * (-839.561) (-832.698) [-830.151] (-829.337) -- 0:00:05
908000 -- [-830.010] (-828.042) (-827.861) (-829.608) * [-830.310] (-833.868) (-829.281) (-828.487) -- 0:00:05
908500 -- (-827.304) [-827.240] (-827.834) (-831.138) * (-827.353) (-830.973) [-828.954] (-827.233) -- 0:00:05
909000 -- [-830.090] (-830.412) (-827.140) (-829.790) * (-827.379) (-827.890) (-828.323) [-828.615] -- 0:00:05
909500 -- (-829.852) [-829.976] (-827.775) (-829.809) * (-828.681) [-827.617] (-827.461) (-830.957) -- 0:00:05
910000 -- [-828.275] (-828.311) (-827.328) (-831.240) * [-828.422] (-827.617) (-828.052) (-831.143) -- 0:00:05
Average standard deviation of split frequencies: 0.007732
910500 -- (-828.581) (-835.125) [-833.084] (-829.244) * (-829.908) (-827.831) (-827.955) [-828.527] -- 0:00:05
911000 -- (-828.718) (-830.367) [-830.925] (-828.751) * (-829.021) [-829.748] (-828.885) (-828.223) -- 0:00:05
911500 -- (-829.188) (-829.166) (-830.095) [-827.685] * (-829.932) (-828.005) (-827.947) [-827.060] -- 0:00:05
912000 -- (-831.956) (-830.199) [-830.815] (-831.334) * [-828.319] (-827.789) (-831.646) (-831.143) -- 0:00:05
912500 -- (-829.430) (-827.592) [-828.199] (-827.144) * [-829.074] (-829.036) (-827.782) (-829.344) -- 0:00:05
913000 -- (-829.270) (-829.365) (-828.545) [-830.157] * [-830.164] (-834.155) (-833.203) (-831.416) -- 0:00:05
913500 -- (-834.078) (-830.665) [-827.353] (-828.301) * (-831.395) [-829.199] (-836.514) (-827.237) -- 0:00:05
914000 -- (-829.035) (-830.603) (-828.353) [-830.474] * [-831.948] (-829.063) (-830.957) (-828.546) -- 0:00:05
914500 -- (-826.839) (-832.404) (-831.936) [-827.600] * (-830.741) [-828.142] (-827.805) (-830.188) -- 0:00:05
915000 -- [-827.066] (-829.484) (-828.933) (-833.762) * (-830.971) [-828.939] (-828.149) (-832.248) -- 0:00:05
Average standard deviation of split frequencies: 0.007655
915500 -- (-828.883) (-831.893) [-829.106] (-829.938) * [-827.583] (-831.051) (-828.824) (-828.943) -- 0:00:05
916000 -- (-827.392) [-829.187] (-828.459) (-829.430) * (-827.685) (-829.985) [-828.336] (-827.864) -- 0:00:05
916500 -- (-828.750) [-827.844] (-833.614) (-832.082) * (-833.923) (-831.317) [-827.720] (-828.765) -- 0:00:05
917000 -- (-828.137) [-827.113] (-831.965) (-828.270) * (-831.935) [-828.489] (-828.671) (-830.086) -- 0:00:04
917500 -- (-827.708) (-826.938) (-829.246) [-829.260] * [-832.291] (-829.716) (-829.557) (-830.653) -- 0:00:04
918000 -- (-829.487) [-830.135] (-828.191) (-829.232) * (-831.561) (-828.783) (-830.326) [-830.042] -- 0:00:04
918500 -- (-829.984) (-829.309) [-828.257] (-827.464) * (-830.763) (-829.761) [-831.176] (-829.565) -- 0:00:04
919000 -- [-827.267] (-831.507) (-827.724) (-845.377) * [-828.735] (-829.371) (-831.453) (-830.519) -- 0:00:04
919500 -- [-829.837] (-830.652) (-827.715) (-838.239) * (-828.672) (-828.947) [-832.036] (-826.571) -- 0:00:04
920000 -- (-831.874) (-829.924) [-828.201] (-831.943) * (-828.014) (-828.916) (-830.501) [-828.443] -- 0:00:04
Average standard deviation of split frequencies: 0.008064
920500 -- (-832.860) (-829.768) (-827.657) [-833.666] * (-834.598) [-829.181] (-829.734) (-829.738) -- 0:00:04
921000 -- (-828.189) [-829.049] (-829.192) (-832.161) * [-830.722] (-829.453) (-827.483) (-829.438) -- 0:00:04
921500 -- (-828.397) (-831.606) [-826.869] (-828.389) * (-835.668) [-830.392] (-827.263) (-827.077) -- 0:00:04
922000 -- (-828.761) [-829.504] (-828.257) (-828.255) * [-828.349] (-828.758) (-828.570) (-828.271) -- 0:00:04
922500 -- (-835.699) (-829.803) [-827.294] (-830.250) * (-827.303) (-828.176) (-828.228) [-827.681] -- 0:00:04
923000 -- (-830.157) [-828.637] (-827.119) (-827.506) * (-830.129) [-828.612] (-828.353) (-833.416) -- 0:00:04
923500 -- [-830.131] (-826.990) (-828.089) (-829.638) * (-829.342) (-829.492) [-828.651] (-827.988) -- 0:00:04
924000 -- (-828.160) [-828.349] (-828.181) (-829.094) * (-828.168) (-830.537) [-831.154] (-827.910) -- 0:00:04
924500 -- (-828.975) (-827.805) [-829.173] (-828.445) * (-829.016) (-830.537) (-829.657) [-829.196] -- 0:00:04
925000 -- (-830.209) (-828.107) [-828.565] (-828.941) * (-830.000) [-828.336] (-828.310) (-828.214) -- 0:00:04
Average standard deviation of split frequencies: 0.008622
925500 -- (-829.269) (-829.524) [-828.234] (-828.539) * (-827.783) (-827.783) [-828.162] (-829.075) -- 0:00:04
926000 -- [-828.509] (-827.927) (-833.713) (-827.396) * [-828.857] (-830.182) (-830.994) (-828.934) -- 0:00:04
926500 -- (-827.950) (-829.288) [-831.566] (-831.530) * [-827.588] (-829.324) (-829.524) (-827.610) -- 0:00:04
927000 -- [-827.246] (-829.146) (-831.979) (-830.833) * (-830.308) [-828.337] (-828.960) (-828.890) -- 0:00:04
927500 -- [-827.565] (-830.416) (-832.096) (-833.771) * (-830.474) [-829.620] (-827.119) (-829.171) -- 0:00:04
928000 -- (-827.464) (-827.763) [-832.287] (-827.799) * [-830.026] (-829.860) (-829.183) (-829.011) -- 0:00:04
928500 -- [-827.587] (-827.756) (-833.410) (-832.830) * (-828.134) [-828.854] (-828.921) (-831.245) -- 0:00:04
929000 -- [-828.336] (-829.871) (-829.378) (-828.044) * (-828.476) (-827.370) [-827.711] (-828.410) -- 0:00:04
929500 -- (-829.947) (-829.411) (-828.136) [-828.199] * [-828.968] (-829.393) (-830.370) (-830.534) -- 0:00:04
930000 -- [-829.426] (-833.718) (-827.498) (-828.428) * (-829.892) (-832.507) (-836.511) [-828.896] -- 0:00:04
Average standard deviation of split frequencies: 0.008927
930500 -- (-830.245) [-826.957] (-827.773) (-829.094) * (-829.040) [-828.392] (-832.097) (-827.375) -- 0:00:04
931000 -- (-830.887) (-827.605) (-838.509) [-828.127] * (-832.167) (-832.741) [-829.470] (-828.082) -- 0:00:04
931500 -- [-830.606] (-827.728) (-830.188) (-829.059) * (-827.698) (-827.977) [-828.701] (-829.791) -- 0:00:04
932000 -- (-830.388) (-827.608) [-829.015] (-827.966) * (-827.474) [-829.740] (-829.746) (-828.098) -- 0:00:04
932500 -- (-828.597) (-830.190) (-828.781) [-827.760] * (-828.118) [-829.633] (-828.121) (-829.887) -- 0:00:04
933000 -- (-826.887) (-826.891) (-831.494) [-828.344] * (-828.456) [-828.870] (-828.461) (-830.445) -- 0:00:04
933500 -- (-828.396) [-827.969] (-828.672) (-829.928) * (-829.799) [-829.739] (-830.345) (-829.074) -- 0:00:03
934000 -- [-828.703] (-828.061) (-829.124) (-831.158) * (-827.707) (-832.292) (-828.621) [-829.964] -- 0:00:03
934500 -- (-827.653) [-826.657] (-829.925) (-829.024) * [-830.697] (-830.063) (-829.593) (-830.784) -- 0:00:03
935000 -- (-827.505) (-827.246) [-830.040] (-827.670) * [-827.286] (-829.699) (-829.890) (-829.550) -- 0:00:03
Average standard deviation of split frequencies: 0.008971
935500 -- (-833.727) (-827.097) [-827.934] (-830.951) * (-829.784) [-828.867] (-827.198) (-831.611) -- 0:00:03
936000 -- (-827.422) [-827.110] (-827.594) (-833.056) * [-830.354] (-832.156) (-828.156) (-832.168) -- 0:00:03
936500 -- [-827.367] (-831.274) (-829.534) (-829.768) * (-833.706) (-828.305) (-831.013) [-827.859] -- 0:00:03
937000 -- [-828.835] (-827.369) (-831.415) (-831.849) * (-828.830) (-830.678) [-831.361] (-830.260) -- 0:00:03
937500 -- (-828.829) [-828.642] (-826.855) (-829.941) * (-830.255) [-834.746] (-828.129) (-831.707) -- 0:00:03
938000 -- (-829.672) (-827.993) [-826.879] (-829.934) * (-831.603) (-830.773) [-828.133] (-828.075) -- 0:00:03
938500 -- [-827.365] (-827.563) (-829.971) (-828.958) * (-831.778) (-836.534) [-826.977] (-827.104) -- 0:00:03
939000 -- (-828.954) [-830.744] (-830.032) (-829.902) * (-828.666) (-830.970) (-828.476) [-827.769] -- 0:00:03
939500 -- (-828.935) [-829.068] (-829.062) (-830.852) * [-830.345] (-830.261) (-828.592) (-827.700) -- 0:00:03
940000 -- (-830.431) (-828.305) (-827.552) [-830.443] * (-829.211) (-827.770) (-829.833) [-829.344] -- 0:00:03
Average standard deviation of split frequencies: 0.008801
940500 -- [-829.461] (-829.786) (-829.098) (-829.118) * (-827.752) [-831.427] (-830.127) (-828.131) -- 0:00:03
941000 -- (-829.269) (-829.221) (-828.227) [-828.240] * (-829.344) (-828.690) [-828.726] (-830.702) -- 0:00:03
941500 -- (-829.190) (-829.763) (-837.771) [-828.737] * [-828.525] (-833.501) (-826.807) (-827.655) -- 0:00:03
942000 -- (-828.982) (-833.846) [-829.520] (-828.299) * (-829.128) (-828.718) [-829.312] (-827.750) -- 0:00:03
942500 -- (-828.919) (-828.590) (-833.294) [-828.568] * (-828.686) (-828.949) [-828.230] (-829.485) -- 0:00:03
943000 -- [-829.563] (-826.912) (-831.441) (-827.960) * (-831.735) (-828.269) [-827.705] (-829.821) -- 0:00:03
943500 -- (-830.679) (-827.420) [-831.953] (-828.315) * [-828.105] (-828.374) (-827.874) (-831.881) -- 0:00:03
944000 -- (-832.060) (-827.414) (-833.984) [-828.315] * [-828.810] (-831.759) (-828.838) (-833.663) -- 0:00:03
944500 -- (-829.280) [-827.914] (-832.351) (-830.757) * [-828.040] (-830.858) (-828.420) (-834.760) -- 0:00:03
945000 -- [-828.544] (-830.540) (-829.252) (-828.156) * (-827.752) (-835.198) [-827.093] (-828.905) -- 0:00:03
Average standard deviation of split frequencies: 0.009375
945500 -- [-835.744] (-829.136) (-831.384) (-829.481) * [-828.095] (-829.426) (-827.121) (-831.720) -- 0:00:03
946000 -- (-829.436) (-829.735) (-828.872) [-829.946] * (-828.391) (-828.223) (-835.124) [-826.989] -- 0:00:03
946500 -- [-827.575] (-830.556) (-828.835) (-829.821) * (-827.946) [-828.327] (-832.011) (-830.061) -- 0:00:03
947000 -- (-829.119) (-832.457) [-827.766] (-831.251) * [-830.299] (-828.625) (-829.205) (-827.887) -- 0:00:03
947500 -- (-836.900) (-829.950) (-827.879) [-827.742] * [-827.816] (-834.611) (-827.871) (-828.302) -- 0:00:03
948000 -- (-836.638) (-831.848) [-827.368] (-834.494) * (-829.515) (-831.509) (-827.023) [-827.652] -- 0:00:03
948500 -- (-833.871) (-829.719) (-827.418) [-829.508] * (-828.719) (-828.058) (-829.721) [-827.773] -- 0:00:03
949000 -- (-830.858) (-826.703) [-828.008] (-829.670) * (-829.638) [-826.811] (-828.726) (-829.019) -- 0:00:03
949500 -- (-831.034) (-828.026) [-827.331] (-827.596) * (-829.736) (-827.112) (-828.366) [-828.596] -- 0:00:03
950000 -- (-831.181) (-832.824) (-827.586) [-829.104] * [-829.070] (-827.212) (-830.021) (-831.356) -- 0:00:03
Average standard deviation of split frequencies: 0.009607
950500 -- [-830.935] (-827.206) (-828.719) (-829.640) * (-828.513) [-831.078] (-829.366) (-828.428) -- 0:00:02
951000 -- (-829.565) (-830.379) (-827.365) [-828.675] * (-829.004) (-829.741) (-828.864) [-829.895] -- 0:00:02
951500 -- (-828.752) (-829.145) (-827.044) [-830.335] * (-828.548) (-828.047) [-826.772] (-828.577) -- 0:00:02
952000 -- (-829.025) [-828.536] (-828.641) (-831.684) * (-831.169) [-827.461] (-829.058) (-831.543) -- 0:00:02
952500 -- (-828.178) (-828.399) [-828.018] (-828.792) * (-832.228) [-828.869] (-831.526) (-827.263) -- 0:00:02
953000 -- [-828.917] (-829.370) (-828.302) (-829.834) * (-827.826) (-830.278) [-832.511] (-827.608) -- 0:00:02
953500 -- (-832.221) (-829.898) [-828.961] (-828.577) * [-827.596] (-831.637) (-827.771) (-827.044) -- 0:00:02
954000 -- (-828.569) (-827.109) [-827.229] (-827.613) * (-828.161) (-828.785) [-832.394] (-828.905) -- 0:00:02
954500 -- [-829.822] (-831.397) (-826.954) (-827.351) * (-833.937) (-836.669) [-830.092] (-827.598) -- 0:00:02
955000 -- [-832.034] (-835.170) (-829.331) (-827.353) * (-828.555) [-831.267] (-828.154) (-828.640) -- 0:00:02
Average standard deviation of split frequencies: 0.010123
955500 -- (-830.021) [-831.568] (-830.577) (-830.849) * (-832.299) (-829.489) [-827.419] (-830.013) -- 0:00:02
956000 -- [-828.077] (-828.549) (-834.676) (-830.262) * (-830.838) [-829.605] (-827.573) (-827.792) -- 0:00:02
956500 -- (-826.835) (-831.398) (-831.032) [-828.949] * (-827.663) (-829.965) (-829.021) [-831.124] -- 0:00:02
957000 -- (-828.875) (-831.054) (-827.906) [-827.979] * (-828.504) (-829.926) [-827.999] (-828.968) -- 0:00:02
957500 -- (-828.917) (-829.453) [-830.199] (-827.183) * (-828.011) (-830.372) [-828.348] (-828.222) -- 0:00:02
958000 -- (-831.322) (-827.588) [-828.439] (-827.334) * (-828.506) (-828.629) (-830.784) [-829.827] -- 0:00:02
958500 -- [-829.608] (-829.859) (-828.052) (-827.434) * (-828.142) (-828.123) (-832.863) [-827.357] -- 0:00:02
959000 -- [-830.749] (-829.310) (-828.379) (-827.422) * [-829.152] (-828.042) (-828.329) (-827.649) -- 0:00:02
959500 -- (-827.087) (-829.847) [-827.935] (-828.090) * (-828.229) (-827.605) [-829.041] (-829.217) -- 0:00:02
960000 -- (-828.812) [-829.516] (-830.345) (-828.812) * [-828.126] (-829.236) (-829.554) (-827.725) -- 0:00:02
Average standard deviation of split frequencies: 0.009843
960500 -- (-828.536) (-829.233) [-829.671] (-827.815) * [-828.488] (-828.671) (-835.493) (-832.564) -- 0:00:02
961000 -- (-830.088) [-828.355] (-834.721) (-830.973) * (-830.634) [-834.109] (-828.335) (-829.544) -- 0:00:02
961500 -- [-828.628] (-827.531) (-831.612) (-827.590) * (-827.055) [-836.904] (-827.218) (-831.594) -- 0:00:02
962000 -- [-827.775] (-828.816) (-828.071) (-830.276) * (-830.881) (-831.246) [-830.743] (-827.415) -- 0:00:02
962500 -- (-828.801) (-829.556) [-826.982] (-830.169) * (-830.280) (-829.904) (-830.714) [-829.722] -- 0:00:02
963000 -- (-829.619) (-831.659) (-826.995) [-827.833] * (-828.210) (-831.364) (-834.909) [-832.151] -- 0:00:02
963500 -- (-828.369) [-827.863] (-829.213) (-830.232) * [-829.825] (-830.459) (-829.687) (-831.995) -- 0:00:02
964000 -- (-828.516) [-829.404] (-828.914) (-835.921) * (-832.012) [-830.979] (-832.488) (-832.385) -- 0:00:02
964500 -- (-828.982) [-832.054] (-829.127) (-828.138) * (-827.570) [-830.141] (-828.527) (-828.845) -- 0:00:02
965000 -- [-829.270] (-828.749) (-828.734) (-828.265) * (-826.699) (-831.372) (-829.358) [-828.509] -- 0:00:02
Average standard deviation of split frequencies: 0.010018
965500 -- (-832.144) (-829.842) (-827.923) [-827.865] * (-829.059) [-829.836] (-829.159) (-831.299) -- 0:00:02
966000 -- (-829.839) [-830.686] (-828.296) (-833.206) * (-828.280) [-827.736] (-831.045) (-833.369) -- 0:00:02
966500 -- [-830.462] (-829.673) (-827.744) (-828.863) * (-829.519) (-831.175) (-831.029) [-828.262] -- 0:00:02
967000 -- [-828.787] (-829.227) (-831.253) (-827.291) * [-832.653] (-827.192) (-827.767) (-827.588) -- 0:00:01
967500 -- (-830.509) (-827.867) (-830.029) [-828.836] * (-830.108) (-827.192) (-828.586) [-830.303] -- 0:00:01
968000 -- (-831.088) (-828.247) [-828.309] (-828.881) * (-829.416) [-828.803] (-827.067) (-829.086) -- 0:00:01
968500 -- (-830.907) (-827.489) (-828.334) [-831.784] * (-828.755) [-829.224] (-827.140) (-828.382) -- 0:00:01
969000 -- (-833.881) (-828.021) (-828.152) [-829.941] * [-830.474] (-829.517) (-828.261) (-828.312) -- 0:00:01
969500 -- (-833.231) [-828.695] (-827.979) (-828.611) * (-830.250) (-827.524) [-829.379] (-827.277) -- 0:00:01
970000 -- (-828.481) (-828.484) [-827.089] (-827.105) * (-828.790) (-826.954) (-828.499) [-826.762] -- 0:00:01
Average standard deviation of split frequencies: 0.010227
970500 -- [-832.684] (-831.744) (-828.527) (-827.692) * (-829.412) (-827.046) (-827.114) [-830.250] -- 0:00:01
971000 -- (-828.924) (-833.760) (-829.602) [-831.464] * (-829.511) (-827.163) (-827.711) [-829.996] -- 0:00:01
971500 -- [-827.136] (-830.086) (-831.871) (-831.572) * (-828.688) [-827.547] (-828.986) (-828.075) -- 0:00:01
972000 -- (-828.372) [-827.158] (-828.452) (-831.425) * [-827.729] (-828.038) (-830.016) (-829.115) -- 0:00:01
972500 -- (-828.015) [-827.776] (-826.852) (-829.888) * (-826.821) (-828.288) [-827.210] (-828.017) -- 0:00:01
973000 -- (-827.644) [-829.466] (-829.404) (-831.124) * (-827.825) [-827.732] (-828.658) (-831.299) -- 0:00:01
973500 -- [-828.570] (-829.750) (-829.196) (-833.839) * (-829.242) (-829.263) [-829.049] (-829.144) -- 0:00:01
974000 -- (-832.675) (-828.833) (-829.204) [-830.877] * [-827.013] (-828.424) (-828.455) (-830.796) -- 0:00:01
974500 -- (-827.771) (-831.754) (-830.632) [-830.636] * (-829.417) (-827.869) [-828.602] (-830.212) -- 0:00:01
975000 -- (-830.271) (-833.741) (-829.414) [-833.270] * (-828.739) (-830.460) [-829.024] (-829.160) -- 0:00:01
Average standard deviation of split frequencies: 0.009944
975500 -- [-826.959] (-830.849) (-830.089) (-827.858) * [-827.985] (-828.278) (-832.211) (-828.466) -- 0:00:01
976000 -- [-828.192] (-828.393) (-827.042) (-827.937) * (-833.195) (-829.833) [-829.047] (-827.063) -- 0:00:01
976500 -- (-830.691) [-827.940] (-830.285) (-826.602) * [-833.623] (-829.579) (-831.335) (-828.151) -- 0:00:01
977000 -- (-831.901) (-828.026) (-829.243) [-826.970] * [-828.594] (-829.095) (-833.494) (-827.836) -- 0:00:01
977500 -- (-828.436) (-828.568) [-829.222] (-826.923) * (-827.829) [-827.969] (-832.837) (-828.786) -- 0:00:01
978000 -- (-835.540) (-828.286) [-828.677] (-827.121) * [-828.059] (-830.505) (-831.611) (-829.522) -- 0:00:01
978500 -- (-830.623) (-829.492) (-828.564) [-830.422] * (-827.720) (-828.947) (-828.346) [-829.649] -- 0:00:01
979000 -- (-828.724) (-829.305) [-828.103] (-829.763) * (-828.833) (-827.486) (-831.319) [-828.722] -- 0:00:01
979500 -- (-828.472) (-829.613) (-832.192) [-827.760] * (-831.335) [-829.487] (-828.856) (-828.997) -- 0:00:01
980000 -- (-829.552) (-829.213) [-829.036] (-828.763) * [-835.286] (-831.902) (-826.988) (-829.923) -- 0:00:01
Average standard deviation of split frequencies: 0.009982
980500 -- (-826.960) [-831.213] (-832.021) (-829.960) * [-828.929] (-829.451) (-827.029) (-827.559) -- 0:00:01
981000 -- (-828.167) [-832.433] (-826.767) (-830.004) * [-828.492] (-829.668) (-828.180) (-828.098) -- 0:00:01
981500 -- (-827.629) [-829.761] (-829.803) (-829.806) * [-828.730] (-828.910) (-827.639) (-829.148) -- 0:00:01
982000 -- [-827.547] (-830.734) (-828.460) (-829.254) * [-827.646] (-830.754) (-829.499) (-826.898) -- 0:00:01
982500 -- [-827.141] (-828.255) (-830.927) (-830.981) * (-829.075) (-832.096) [-828.868] (-830.458) -- 0:00:01
983000 -- (-829.159) [-827.473] (-828.246) (-828.757) * (-827.115) (-827.808) (-827.487) [-827.410] -- 0:00:01
983500 -- (-827.910) (-830.492) [-828.240] (-830.262) * (-827.066) [-827.057] (-828.496) (-829.093) -- 0:00:00
984000 -- [-828.384] (-831.310) (-828.918) (-827.210) * (-831.094) (-829.266) (-828.663) [-831.660] -- 0:00:00
984500 -- (-828.941) (-828.335) (-829.854) [-827.653] * [-828.332] (-827.997) (-827.929) (-829.845) -- 0:00:00
985000 -- (-827.538) [-827.243] (-833.360) (-831.025) * (-828.209) (-828.678) (-827.390) [-829.565] -- 0:00:00
Average standard deviation of split frequencies: 0.010265
985500 -- (-828.890) [-826.884] (-833.019) (-828.724) * (-828.162) [-827.728] (-831.882) (-830.910) -- 0:00:00
986000 -- (-828.526) [-829.423] (-829.861) (-827.979) * (-830.727) [-831.989] (-831.213) (-829.016) -- 0:00:00
986500 -- (-834.673) (-830.331) [-831.031] (-828.334) * (-831.869) (-831.115) (-828.584) [-829.554] -- 0:00:00
987000 -- [-828.182] (-828.945) (-831.886) (-835.173) * (-830.790) [-830.164] (-828.573) (-828.086) -- 0:00:00
987500 -- (-829.370) (-827.110) [-828.468] (-828.472) * (-828.810) (-827.801) (-830.130) [-828.112] -- 0:00:00
988000 -- (-827.272) (-827.700) (-828.626) [-827.434] * (-828.490) [-829.384] (-831.226) (-830.609) -- 0:00:00
988500 -- (-828.134) [-831.469] (-836.179) (-827.886) * (-828.386) [-827.305] (-833.835) (-828.498) -- 0:00:00
989000 -- (-828.208) (-831.736) [-831.157] (-829.966) * (-829.721) [-826.989] (-828.781) (-829.297) -- 0:00:00
989500 -- (-829.309) (-829.363) [-829.409] (-830.005) * (-829.156) (-826.849) [-829.664] (-829.304) -- 0:00:00
990000 -- (-829.310) (-828.403) [-828.076] (-827.081) * [-827.859] (-827.143) (-830.617) (-828.428) -- 0:00:00
Average standard deviation of split frequencies: 0.010329
990500 -- (-828.910) [-832.486] (-830.919) (-829.134) * [-829.043] (-828.761) (-828.345) (-828.092) -- 0:00:00
991000 -- [-832.420] (-835.029) (-829.034) (-831.692) * (-828.794) (-827.852) (-827.987) [-828.441] -- 0:00:00
991500 -- (-834.664) (-831.179) [-828.738] (-827.908) * (-829.370) (-830.356) [-829.317] (-828.573) -- 0:00:00
992000 -- (-830.969) (-831.767) [-829.425] (-829.697) * (-827.416) [-831.753] (-829.409) (-826.969) -- 0:00:00
992500 -- (-828.700) (-829.368) [-828.677] (-831.889) * (-828.845) [-828.183] (-828.577) (-830.051) -- 0:00:00
993000 -- (-828.258) [-829.949] (-831.679) (-829.049) * (-827.936) (-831.979) (-829.950) [-830.629] -- 0:00:00
993500 -- [-829.168] (-828.086) (-829.389) (-830.257) * (-827.644) (-832.935) [-828.284] (-830.025) -- 0:00:00
994000 -- (-829.255) (-827.457) [-826.756] (-830.333) * (-830.683) [-830.766] (-828.493) (-828.643) -- 0:00:00
994500 -- [-828.031] (-828.657) (-827.883) (-831.127) * [-828.718] (-831.858) (-830.109) (-828.524) -- 0:00:00
995000 -- (-828.559) [-827.584] (-829.038) (-831.968) * (-828.985) [-830.089] (-829.825) (-829.885) -- 0:00:00
Average standard deviation of split frequencies: 0.010468
995500 -- (-828.928) (-831.869) (-830.920) [-828.237] * [-829.047] (-828.920) (-831.043) (-829.205) -- 0:00:00
996000 -- (-829.936) (-829.262) [-829.792] (-827.713) * [-827.276] (-827.930) (-828.614) (-828.670) -- 0:00:00
996500 -- [-826.751] (-829.806) (-828.406) (-830.913) * [-828.077] (-828.828) (-834.993) (-829.988) -- 0:00:00
997000 -- (-827.679) [-830.858] (-831.766) (-830.621) * (-829.106) (-828.753) [-828.736] (-830.492) -- 0:00:00
997500 -- [-828.050] (-830.713) (-832.095) (-828.039) * (-830.270) (-829.120) [-829.256] (-828.922) -- 0:00:00
998000 -- (-830.367) (-830.872) [-828.760] (-828.979) * (-829.733) (-832.100) (-831.901) [-828.218] -- 0:00:00
998500 -- (-828.063) (-828.779) (-828.406) [-828.261] * (-831.780) (-828.008) [-827.358] (-829.569) -- 0:00:00
999000 -- (-830.367) [-830.048] (-829.078) (-828.655) * [-828.898] (-828.273) (-828.409) (-827.304) -- 0:00:00
999500 -- (-828.070) (-830.170) (-828.380) [-826.891] * (-828.520) [-828.218] (-828.605) (-827.649) -- 0:00:00
1000000 -- (-827.533) (-828.288) [-829.155] (-829.210) * (-828.413) (-827.809) (-831.031) [-833.998] -- 0:00:00
Average standard deviation of split frequencies: 0.010281
Analysis completed in 60 seconds
Analysis used 59.01 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -826.55
Likelihood of best state for "cold" chain of run 2 was -826.55
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.6 % ( 27 %) Dirichlet(Pi{all})
30.5 % ( 24 %) Slider(Pi{all})
78.7 % ( 56 %) Multiplier(Alpha{1,2})
78.1 % ( 54 %) Multiplier(Alpha{3})
22.1 % ( 28 %) Slider(Pinvar{all})
98.7 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 95 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 97 %) Nodeslider(V{all})
30.8 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 53 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
28.6 % ( 24 %) Dirichlet(Pi{all})
30.8 % ( 21 %) Slider(Pi{all})
77.8 % ( 46 %) Multiplier(Alpha{1,2})
77.7 % ( 43 %) Multiplier(Alpha{3})
22.3 % ( 27 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.5 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 94 %) ParsSPR(Tau{all},V{all})
28.1 % ( 26 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.7 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.51
2 | 166947 0.82 0.67
3 | 166907 166068 0.84
4 | 166570 166689 166819
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166467 0.82 0.67
3 | 166399 166931 0.84
4 | 167108 166573 166522
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -828.34
| 1 2 |
| 1 |
| 1 1 1 2 2 |
| 1 1 2 1 1 1 2 |
|2 2 11 1 2 2 1 1 1 |
| 1 11 2 1111 12 1 1 1 2 2 |
| 2 2 1 * 11 22 2 2 2 21 121 1 2|
| 2 1 2 2 1 *2 1 2 2 1 11 2 1|
| 2 22 2 2 2 1 12 |
| 1 1 2 1 2 1 22 * 1 |
|1 2 2 2 1 2 2 2 2 |
| 2 2 2 1 2 1 2 |
| 1 1 21 |
| 2 |
| 2 1 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -829.84
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -828.26 -831.35
2 -828.35 -833.94
--------------------------------------
TOTAL -828.30 -833.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895963 0.089910 0.361387 1.486257 0.866003 1315.08 1408.04 1.000
r(A<->C){all} 0.169357 0.020028 0.000097 0.454095 0.132689 197.76 255.52 1.000
r(A<->G){all} 0.166286 0.019854 0.000140 0.451814 0.130450 130.02 203.57 1.000
r(A<->T){all} 0.164858 0.018657 0.000023 0.433245 0.127543 230.06 232.95 1.001
r(C<->G){all} 0.166340 0.018332 0.000032 0.432645 0.133810 338.27 340.02 1.000
r(C<->T){all} 0.164775 0.019172 0.000019 0.446368 0.129512 151.49 194.21 1.000
r(G<->T){all} 0.168384 0.019266 0.000045 0.447367 0.133267 139.12 150.43 1.003
pi(A){all} 0.136666 0.000188 0.110679 0.163476 0.136383 1315.43 1328.15 1.000
pi(C){all} 0.249699 0.000306 0.215068 0.283423 0.249677 1364.21 1393.45 1.000
pi(G){all} 0.346399 0.000369 0.308879 0.383391 0.346319 1328.09 1337.15 1.000
pi(T){all} 0.267236 0.000324 0.231997 0.301127 0.267229 1031.12 1164.72 1.000
alpha{1,2} 0.435071 0.236751 0.000148 1.455342 0.266912 1320.44 1341.77 1.000
alpha{3} 0.459567 0.248955 0.000557 1.441762 0.292395 1180.33 1249.57 1.000
pinvar{all} 0.997506 0.000009 0.991931 0.999999 0.998467 1091.99 1248.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- .*.*..
9 -- ....**
10 -- .*...*
11 -- .*..*.
12 -- ...**.
13 -- ..*.*.
14 -- .***.*
15 -- ..**..
16 -- ...*.*
17 -- .**...
18 -- .**.**
19 -- .*.***
20 -- ..****
21 -- ..*..*
22 -- .***..
23 -- .**.*.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 457 0.152232 0.001413 0.151233 0.153231 2
8 446 0.148568 0.014133 0.138574 0.158561 2
9 442 0.147235 0.016959 0.135243 0.159227 2
10 441 0.146902 0.008951 0.140573 0.153231 2
11 440 0.146569 0.006595 0.141905 0.151233 2
12 437 0.145570 0.016488 0.133911 0.157229 2
13 433 0.144237 0.010835 0.136576 0.151899 2
14 431 0.143571 0.004240 0.140573 0.146569 2
15 431 0.143571 0.026852 0.124584 0.162558 2
16 430 0.143238 0.006595 0.138574 0.147901 2
17 421 0.140240 0.002355 0.138574 0.141905 2
18 415 0.138241 0.000471 0.137908 0.138574 2
19 410 0.136576 0.007537 0.131246 0.141905 2
20 407 0.135576 0.009893 0.128581 0.142572 2
21 399 0.132911 0.005182 0.129247 0.136576 2
22 273 0.090939 0.014604 0.080613 0.101266 2
23 264 0.087941 0.021670 0.072618 0.103264 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098493 0.009146 0.000005 0.298833 0.069401 1.001 2
length{all}[2] 0.098743 0.009741 0.000026 0.296938 0.068129 1.000 2
length{all}[3] 0.098591 0.009660 0.000027 0.297227 0.067754 1.000 2
length{all}[4] 0.100131 0.009215 0.000064 0.304047 0.071962 1.000 2
length{all}[5] 0.098919 0.009654 0.000023 0.298637 0.067145 1.000 2
length{all}[6] 0.098137 0.009821 0.000002 0.301509 0.066781 1.000 2
length{all}[7] 0.103384 0.008893 0.000028 0.293189 0.073687 0.998 2
length{all}[8] 0.094454 0.008576 0.000336 0.284141 0.063559 0.998 2
length{all}[9] 0.104834 0.011044 0.000681 0.319435 0.075125 1.000 2
length{all}[10] 0.105117 0.011198 0.000009 0.341110 0.070413 1.001 2
length{all}[11] 0.097850 0.008886 0.000005 0.274150 0.071552 1.000 2
length{all}[12] 0.105296 0.013495 0.000128 0.313248 0.068050 0.998 2
length{all}[13] 0.102452 0.010624 0.000083 0.289535 0.069998 1.000 2
length{all}[14] 0.099889 0.010132 0.001038 0.305770 0.069615 1.002 2
length{all}[15] 0.097542 0.008613 0.000130 0.290279 0.066224 0.999 2
length{all}[16] 0.096072 0.008087 0.000010 0.265444 0.068556 1.002 2
length{all}[17] 0.106821 0.012381 0.000444 0.339996 0.072932 0.998 2
length{all}[18] 0.099393 0.011676 0.000355 0.300047 0.070882 0.998 2
length{all}[19] 0.096215 0.009156 0.000161 0.267817 0.067232 0.998 2
length{all}[20] 0.092508 0.008622 0.000663 0.265916 0.062305 0.998 2
length{all}[21] 0.103796 0.010102 0.000700 0.311617 0.074296 0.998 2
length{all}[22] 0.096035 0.007391 0.001711 0.249284 0.071962 0.996 2
length{all}[23] 0.107610 0.011289 0.000281 0.323677 0.074463 1.008 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.010281
Maximum standard deviation of split frequencies = 0.026852
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 618
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 206 / 206 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 206 / 206 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089444 0.016703 0.069709 0.040917 0.026340 0.104201 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -862.157820
Iterating by ming2
Initial: fx= 862.157820
x= 0.08944 0.01670 0.06971 0.04092 0.02634 0.10420 0.30000 1.30000
1 h-m-p 0.0000 0.0001 495.3462 ++ 842.045761 m 0.0001 13 | 1/8
2 h-m-p 0.0013 0.0505 27.8342 -----------.. | 1/8
3 h-m-p 0.0000 0.0000 453.0378 ++ 832.323524 m 0.0000 44 | 2/8
4 h-m-p 0.0008 0.0599 23.2619 -----------.. | 2/8
5 h-m-p 0.0000 0.0001 405.1715 ++ 820.516059 m 0.0001 75 | 3/8
6 h-m-p 0.0013 0.0745 18.7879 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 351.1058 ++ 802.860226 m 0.0001 106 | 4/8
8 h-m-p 0.0028 0.0967 14.8074 ------------.. | 4/8
9 h-m-p 0.0000 0.0001 287.9553 ++ 794.691273 m 0.0001 138 | 5/8
10 h-m-p 0.0018 0.1391 11.3120 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 204.1839 ++ 791.611106 m 0.0001 170 | 6/8
12 h-m-p 0.5019 8.0000 0.0000 ++ 791.611106 m 8.0000 181 | 6/8
13 h-m-p 0.1081 8.0000 0.0002 ---Y 791.611106 0 0.0004 197 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 -C 791.611106 0 0.0010 211 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -C 791.611106 0 0.0010 225 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 C 791.611106 0 0.0040 238 | 6/8
17 h-m-p 0.0160 8.0000 0.0004 ------Y 791.611106 0 0.0000 257
Out..
lnL = -791.611106
258 lfun, 258 eigenQcodon, 1548 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082102 0.033636 0.025722 0.092590 0.045989 0.049444 0.300037 0.753539 0.194949
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.469280
np = 9
lnL0 = -854.722184
Iterating by ming2
Initial: fx= 854.722184
x= 0.08210 0.03364 0.02572 0.09259 0.04599 0.04944 0.30004 0.75354 0.19495
1 h-m-p 0.0000 0.0001 446.7065 ++ 826.213086 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 274.2524 ++ 818.404049 m 0.0001 26 | 2/9
3 h-m-p 0.0000 0.0000 1624.8272 ++ 809.436560 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 1753.6537 ++ 807.408002 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 2075.7762 ++ 794.108218 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 4643.8698 ++ 793.440239 m 0.0000 74 | 6/9
7 h-m-p 0.0003 0.0231 11.6257 ----------.. | 6/9
8 h-m-p 0.0000 0.0000 199.2659 ++ 791.611026 m 0.0000 106 | 7/9
9 h-m-p 1.2824 8.0000 0.0000 ++ 791.611026 m 8.0000 118 | 7/9
10 h-m-p 0.3250 8.0000 0.0001 +++ 791.611026 m 8.0000 133 | 7/9
11 h-m-p 0.0084 3.4995 0.0862 +++Y 791.611026 0 1.0513 150 | 7/9
12 h-m-p 1.6000 8.0000 0.0006 Y 791.611026 0 1.1000 164 | 7/9
13 h-m-p 1.6000 8.0000 0.0001 ++ 791.611026 m 8.0000 178 | 7/9
14 h-m-p 0.7814 8.0000 0.0007 +Y 791.611026 0 4.6209 193 | 7/9
15 h-m-p 1.6000 8.0000 0.0001 ++ 791.611026 m 8.0000 207 | 7/9
16 h-m-p 0.0154 7.7105 0.0992 +++Y 791.611025 0 2.3047 224 | 7/9
17 h-m-p 1.6000 8.0000 0.0097 ++ 791.611016 m 8.0000 238 | 7/9
18 h-m-p 0.1976 2.2293 0.3944 ------------Y 791.611016 0 0.0000 264 | 7/9
19 h-m-p 0.0000 0.0017 88.5709 ++++ 791.610974 m 0.0017 280 | 8/9
20 h-m-p 0.4152 3.5914 0.1449 ++ 791.610852 m 3.5914 292 | 9/9
21 h-m-p 0.0160 8.0000 0.0000 Y 791.610852 0 0.0160 305
Out..
lnL = -791.610852
306 lfun, 918 eigenQcodon, 3672 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.018473 0.051235 0.097390 0.057545 0.028778 0.077871 0.000100 1.623009 0.294828 0.160365 1.392839
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 12.724554
np = 11
lnL0 = -853.070059
Iterating by ming2
Initial: fx= 853.070059
x= 0.01847 0.05124 0.09739 0.05755 0.02878 0.07787 0.00011 1.62301 0.29483 0.16036 1.39284
1 h-m-p 0.0000 0.0000 420.4612 ++ 852.687180 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0003 293.3025 +++ 832.376384 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0001 174.8298 ++ 825.175293 m 0.0001 45 | 3/11
4 h-m-p 0.0002 0.0008 93.2205 ++ 814.593457 m 0.0008 59 | 4/11
5 h-m-p 0.0002 0.0011 77.1651 ++ 808.430764 m 0.0011 73 | 5/11
6 h-m-p 0.0000 0.0000 2531.6286 ++ 799.957260 m 0.0000 87 | 6/11
7 h-m-p 0.0002 0.0010 151.4670 ++ 795.761274 m 0.0010 101 | 7/11
8 h-m-p 0.0029 0.0145 6.1916 ++ 791.611024 m 0.0145 115 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 791.611024 m 8.0000 129 | 8/11
10 h-m-p 0.0024 1.0942 0.3678 +++++ 791.611013 m 1.0942 149 | 9/11
11 h-m-p 0.3913 8.0000 0.1905 +++ 791.610999 m 8.0000 167 | 9/11
12 h-m-p 1.6000 8.0000 0.0108 -C 791.610999 0 0.1000 184 | 9/11
13 h-m-p 1.6000 8.0000 0.0001 -----N 791.610999 0 0.0004 205 | 9/11
14 h-m-p 0.0160 8.0000 0.0053 +++++ 791.610996 m 8.0000 224 | 9/11
15 h-m-p 0.0160 8.0000 7.2852 -------------.. | 9/11
16 h-m-p 0.0160 8.0000 0.0001 +++++ 791.610996 m 8.0000 268 | 9/11
17 h-m-p 0.0160 8.0000 0.1372 ---------Y 791.610996 0 0.0000 293 | 9/11
18 h-m-p 0.0160 8.0000 0.0008 +++++ 791.610996 m 8.0000 312 | 9/11
19 h-m-p 0.0160 8.0000 6.4328 ------------C 791.610996 0 0.0000 340 | 9/11
20 h-m-p 0.0160 8.0000 0.0001 ------Y 791.610996 0 0.0000 360 | 9/11
21 h-m-p 0.0160 8.0000 0.0103 ----------N 791.610996 0 0.0000 386 | 9/11
22 h-m-p 0.0160 8.0000 4.3713 +++++ 791.610852 m 8.0000 405 | 9/11
23 h-m-p 1.6000 8.0000 0.0000 N 791.610852 0 1.6000 419 | 9/11
24 h-m-p 0.0160 8.0000 0.0000 C 791.610852 0 0.0160 435
Out..
lnL = -791.610852
436 lfun, 1744 eigenQcodon, 7848 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -791.652499 S = -791.611693 -0.015730
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:04
did 20 / 52 patterns 0:04
did 30 / 52 patterns 0:04
did 40 / 52 patterns 0:04
did 50 / 52 patterns 0:04
did 52 / 52 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017931 0.079958 0.026391 0.046289 0.052292 0.098506 0.000100 0.564390 1.030541
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.188580
np = 9
lnL0 = -852.920390
Iterating by ming2
Initial: fx= 852.920390
x= 0.01793 0.07996 0.02639 0.04629 0.05229 0.09851 0.00011 0.56439 1.03054
1 h-m-p 0.0000 0.0000 445.3386 ++ 852.510036 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0051 70.5696 +++++ 830.737745 m 0.0051 29 | 2/9
3 h-m-p 0.0000 0.0001 373.9801 ++ 827.542092 m 0.0001 41 | 3/9
4 h-m-p 0.0001 0.0004 444.8446 ++ 817.751561 m 0.0004 53 | 4/9
5 h-m-p 0.0001 0.0005 162.3618 ++ 803.918081 m 0.0005 65 | 5/9
6 h-m-p 0.0004 0.0018 53.5604 ++ 796.742814 m 0.0018 77 | 6/9
7 h-m-p 0.0005 0.0026 10.8132 -----------.. | 6/9
8 h-m-p 0.0000 0.0001 270.0124 ++ 792.149738 m 0.0001 110 | 7/9
9 h-m-p 0.0160 8.0000 0.7696 -------------.. | 7/9
10 h-m-p 0.0000 0.0000 193.5804 ++ 791.610852 m 0.0000 147 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 +C 791.610852 0 6.4000 160 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 N 791.610852 0 0.4000 173
Out..
lnL = -791.610852
174 lfun, 1914 eigenQcodon, 10440 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053432 0.085926 0.032126 0.106472 0.059837 0.101632 0.000100 0.900000 0.433655 1.300703 1.299932
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.181592
np = 11
lnL0 = -870.906687
Iterating by ming2
Initial: fx= 870.906687
x= 0.05343 0.08593 0.03213 0.10647 0.05984 0.10163 0.00011 0.90000 0.43365 1.30070 1.29993
1 h-m-p 0.0000 0.0000 400.7694 ++ 870.721206 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 208.4134 ++++ 837.307311 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0001 597.2979 ++ 817.998564 m 0.0001 46 | 3/11
4 h-m-p 0.0002 0.0008 103.0655 ++ 813.194866 m 0.0008 60 | 4/11
5 h-m-p 0.0000 0.0000 5073.5159 ++ 799.401845 m 0.0000 74 | 5/11
6 h-m-p 0.0007 0.0033 16.4971 ++ 798.618102 m 0.0033 88 | 6/11
7 h-m-p 0.0000 0.0001 126.4518 ++ 796.954057 m 0.0001 102 | 7/11
8 h-m-p 0.0002 0.0137 19.6183 +++ 791.834864 m 0.0137 117 | 8/11
9 h-m-p 0.0087 0.0786 8.6016 -------------.. | 8/11
10 h-m-p 0.0000 0.0000 193.9904 ++ 791.610852 m 0.0000 156 | 9/11
11 h-m-p 1.6000 8.0000 0.0000 N 791.610852 0 1.6000 170 | 9/11
12 h-m-p 0.0160 8.0000 0.0000 C 791.610852 0 0.0160 186
Out..
lnL = -791.610852
187 lfun, 2244 eigenQcodon, 12342 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -791.664785 S = -791.611692 -0.023552
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:10
did 20 / 52 patterns 0:10
did 30 / 52 patterns 0:10
did 40 / 52 patterns 0:10
did 50 / 52 patterns 0:10
did 52 / 52 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=206
NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
NC_002677_1_NP_302387_1_1259_pgsA2 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
**************************************************
NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
NC_002677_1_NP_302387_1_1259_pgsA2 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
**************************************************
NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
NC_002677_1_NP_302387_1_1259_pgsA2 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
**************************************************
NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
NC_002677_1_NP_302387_1_1259_pgsA2 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
**************************************************
NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 FAGKAR
NC_002677_1_NP_302387_1_1259_pgsA2 FAGKAR
NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 FAGKAR
NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 FAGKAR
NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 FAGKAR
NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 FAGKAR
******
>NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG TTTGCGGGAAAGGCCAGA >NC_002677_1_NP_302387_1_1259_pgsA2 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG TTTGCGGGAAAGGCCAGA >NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG TTTGCGGGAAAGGCCAGA >NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG TTTGCGGGAAAGGCCAGA >NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG TTTGCGGGAAAGGCCAGA >NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG TTTGCGGGAAAGGCCAGA
>NC_011896_1_WP_010908707_1_2216_MLBR_RS10490 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ FAGKAR >NC_002677_1_NP_302387_1_1259_pgsA2 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ FAGKAR >NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ FAGKAR >NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ FAGKAR >NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ FAGKAR >NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700 MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ FAGKAR
#NEXUS
[ID: 9395073317]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908707_1_2216_MLBR_RS10490
NC_002677_1_NP_302387_1_1259_pgsA2
NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755
NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150
NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385
NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908707_1_2216_MLBR_RS10490,
2 NC_002677_1_NP_302387_1_1259_pgsA2,
3 NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755,
4 NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150,
5 NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385,
6 NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06940138,2:0.06812889,3:0.06775383,4:0.07196238,5:0.06714472,6:0.06678109);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06940138,2:0.06812889,3:0.06775383,4:0.07196238,5:0.06714472,6:0.06678109);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -828.26 -831.35
2 -828.35 -833.94
--------------------------------------
TOTAL -828.30 -833.32
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895963 0.089910 0.361387 1.486257 0.866003 1315.08 1408.04 1.000
r(A<->C){all} 0.169357 0.020028 0.000097 0.454095 0.132689 197.76 255.52 1.000
r(A<->G){all} 0.166286 0.019854 0.000140 0.451814 0.130450 130.02 203.57 1.000
r(A<->T){all} 0.164858 0.018657 0.000023 0.433245 0.127543 230.06 232.95 1.001
r(C<->G){all} 0.166340 0.018332 0.000032 0.432645 0.133810 338.27 340.02 1.000
r(C<->T){all} 0.164775 0.019172 0.000019 0.446368 0.129512 151.49 194.21 1.000
r(G<->T){all} 0.168384 0.019266 0.000045 0.447367 0.133267 139.12 150.43 1.003
pi(A){all} 0.136666 0.000188 0.110679 0.163476 0.136383 1315.43 1328.15 1.000
pi(C){all} 0.249699 0.000306 0.215068 0.283423 0.249677 1364.21 1393.45 1.000
pi(G){all} 0.346399 0.000369 0.308879 0.383391 0.346319 1328.09 1337.15 1.000
pi(T){all} 0.267236 0.000324 0.231997 0.301127 0.267229 1031.12 1164.72 1.000
alpha{1,2} 0.435071 0.236751 0.000148 1.455342 0.266912 1320.44 1341.77 1.000
alpha{3} 0.459567 0.248955 0.000557 1.441762 0.292395 1180.33 1249.57 1.000
pinvar{all} 0.997506 0.000009 0.991931 0.999999 0.998467 1091.99 1248.34 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/10res/pgsA2/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 206
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 5 5 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 4 4 4 4 4 4 | Cys TGT 1 1 1 1 1 1
TTC 4 4 4 4 4 4 | TCC 0 0 0 0 0 0 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 7 7 7 7 7 7 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 11 11 11 11 11 11
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 1 1 1 1 1 1 | His CAT 1 1 1 1 1 1 | Arg CGT 3 3 3 3 3 3
CTC 1 1 1 1 1 1 | CCC 4 4 4 4 4 4 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 3 3 3 3 3 3 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 20 20 20 20 20 20 | CCG 5 5 5 5 5 5 | CAG 3 3 3 3 3 3 | CGG 5 5 5 5 5 5
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 2 2 2 2 2 2 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 3 3 3 3 3 3 | AAC 0 0 0 0 0 0 | AGC 5 5 5 5 5 5
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 0 0 0 0 0 0 | Arg AGA 1 1 1 1 1 1
Met ATG 7 7 7 7 7 7 | ACG 5 5 5 5 5 5 | AAG 5 5 5 5 5 5 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 3 3 3 3 | Gly GGT 5 5 5 5 5 5
GTC 9 9 9 9 9 9 | GCC 6 6 6 6 6 6 | GAC 5 5 5 5 5 5 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 3 3 3 3 3 3 | Glu GAA 0 0 0 0 0 0 | GGA 3 3 3 3 3 3
GTG 17 17 17 17 17 17 | GCG 9 9 9 9 9 9 | GAG 1 1 1 1 1 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908707_1_2216_MLBR_RS10490
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
#2: NC_002677_1_NP_302387_1_1259_pgsA2
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
#3: NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
#4: NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
#5: NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
#6: NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 30 | Ser S TCT 0 | Tyr Y TAT 24 | Cys C TGT 6
TTC 24 | TCC 0 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 42 | TCG 18 | TAG 0 | Trp W TGG 66
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 6 | His H CAT 6 | Arg R CGT 18
CTC 6 | CCC 24 | CAC 12 | CGC 12
CTA 18 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 120 | CCG 30 | CAG 18 | CGG 30
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 12 | Ser S AGT 6
ATC 36 | ACC 18 | AAC 0 | AGC 30
ATA 0 | ACA 6 | Lys K AAA 0 | Arg R AGA 6
Met M ATG 42 | ACG 30 | AAG 30 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 18 | Asp D GAT 18 | Gly G GGT 30
GTC 54 | GCC 36 | GAC 30 | GGC 18
GTA 0 | GCA 18 | Glu E GAA 0 | GGA 18
GTG 102 | GCG 54 | GAG 6 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19903 C:0.26214 A:0.18932 G:0.34951
position 2: T:0.42233 C:0.22330 A:0.14563 G:0.20874
position 3: T:0.17961 C:0.26214 A:0.07282 G:0.48544
Average T:0.26699 C:0.24919 A:0.13592 G:0.34790
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -791.611106 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300037 1.299932
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908707_1_2216_MLBR_RS10490: 0.000004, NC_002677_1_NP_302387_1_1259_pgsA2: 0.000004, NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755: 0.000004, NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150: 0.000004, NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385: 0.000004, NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30004
omega (dN/dS) = 1.29993
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 472.3 145.7 1.2999 0.0000 0.0000 0.0 0.0
7..2 0.000 472.3 145.7 1.2999 0.0000 0.0000 0.0 0.0
7..3 0.000 472.3 145.7 1.2999 0.0000 0.0000 0.0 0.0
7..4 0.000 472.3 145.7 1.2999 0.0000 0.0000 0.0 0.0
7..5 0.000 472.3 145.7 1.2999 0.0000 0.0000 0.0 0.0
7..6 0.000 472.3 145.7 1.2999 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -791.610852 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908707_1_2216_MLBR_RS10490: 0.000004, NC_002677_1_NP_302387_1_1259_pgsA2: 0.000004, NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755: 0.000004, NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150: 0.000004, NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385: 0.000004, NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -791.610852 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908707_1_2216_MLBR_RS10490: 0.000004, NC_002677_1_NP_302387_1_1259_pgsA2: 0.000004, NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755: 0.000004, NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150: 0.000004, NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385: 0.000004, NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908707_1_2216_MLBR_RS10490)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.009 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -791.610852 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.093597
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908707_1_2216_MLBR_RS10490: 0.000004, NC_002677_1_NP_302387_1_1259_pgsA2: 0.000004, NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755: 0.000004, NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150: 0.000004, NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385: 0.000004, NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.09360
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -791.610852 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.416192 1.567472
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908707_1_2216_MLBR_RS10490: 0.000004, NC_002677_1_NP_302387_1_1259_pgsA2: 0.000004, NZ_LVXE01000003_1_WP_010908707_1_1196_A3216_RS01755: 0.000004, NZ_LYPH01000033_1_WP_010908707_1_1278_A8144_RS06150: 0.000004, NZ_CP029543_1_WP_010908707_1_2238_DIJ64_RS11385: 0.000004, NZ_AP014567_1_WP_010908707_1_2301_JK2ML_RS11700: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.41619
(p1 = 0.00001) w = 1.56747
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.56747
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 476.7 141.3 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908707_1_2216_MLBR_RS10490)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.104 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.096
Time used: 0:10
Model 1: NearlyNeutral -791.610852 Model 2: PositiveSelection -791.610852 Model 0: one-ratio -791.611106 Model 7: beta -791.610852 Model 8: beta&w>1 -791.610852 Model 0 vs 1 5.079999998542917E-4 Model 2 vs 1 0.0 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
