--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 13:13:29 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/10res/pgsA2/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -828.26          -831.35
2       -828.35          -833.94
--------------------------------------
TOTAL     -828.30          -833.32
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895963    0.089910    0.361387    1.486257    0.866003   1315.08   1408.04    1.000
r(A<->C){all}   0.169357    0.020028    0.000097    0.454095    0.132689    197.76    255.52    1.000
r(A<->G){all}   0.166286    0.019854    0.000140    0.451814    0.130450    130.02    203.57    1.000
r(A<->T){all}   0.164858    0.018657    0.000023    0.433245    0.127543    230.06    232.95    1.001
r(C<->G){all}   0.166340    0.018332    0.000032    0.432645    0.133810    338.27    340.02    1.000
r(C<->T){all}   0.164775    0.019172    0.000019    0.446368    0.129512    151.49    194.21    1.000
r(G<->T){all}   0.168384    0.019266    0.000045    0.447367    0.133267    139.12    150.43    1.003
pi(A){all}      0.136666    0.000188    0.110679    0.163476    0.136383   1315.43   1328.15    1.000
pi(C){all}      0.249699    0.000306    0.215068    0.283423    0.249677   1364.21   1393.45    1.000
pi(G){all}      0.346399    0.000369    0.308879    0.383391    0.346319   1328.09   1337.15    1.000
pi(T){all}      0.267236    0.000324    0.231997    0.301127    0.267229   1031.12   1164.72    1.000
alpha{1,2}      0.435071    0.236751    0.000148    1.455342    0.266912   1320.44   1341.77    1.000
alpha{3}        0.459567    0.248955    0.000557    1.441762    0.292395   1180.33   1249.57    1.000
pinvar{all}     0.997506    0.000009    0.991931    0.999999    0.998467   1091.99   1248.34    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-791.610852
Model 2: PositiveSelection	-791.610852
Model 0: one-ratio	-791.611106
Model 7: beta	-791.610852
Model 8: beta&w>1	-791.610852


Model 0 vs 1	5.079999998542917E-4

Model 2 vs 1	0.0

Model 8 vs 7	0.0
>C1
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C2
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C3
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C4
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C5
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C6
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=206 

C1              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C2              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C3              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C4              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C5              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C6              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
                **************************************************

C1              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C2              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C3              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C4              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C5              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C6              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
                **************************************************

C1              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C2              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C3              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C4              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C5              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C6              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
                **************************************************

C1              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C2              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C3              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C4              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C5              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C6              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
                **************************************************

C1              FAGKAR
C2              FAGKAR
C3              FAGKAR
C4              FAGKAR
C5              FAGKAR
C6              FAGKAR
                ******




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  206 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  206 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [6180]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [6180]--->[6180]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.477 Mb, Max= 30.745 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C2              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C3              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C4              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C5              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
C6              MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
                **************************************************

C1              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C2              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C3              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C4              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C5              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
C6              SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
                **************************************************

C1              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C2              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C3              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C4              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C5              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
C6              ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
                **************************************************

C1              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C2              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C3              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C4              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C5              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
C6              TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
                **************************************************

C1              FAGKAR
C2              FAGKAR
C3              FAGKAR
C4              FAGKAR
C5              FAGKAR
C6              FAGKAR
                ******




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C2              ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C3              ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C4              ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C5              ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
C6              ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
                **************************************************

C1              CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C2              CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C3              CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C4              CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C5              CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
C6              CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
                **************************************************

C1              TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C2              TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C3              TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C4              TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C5              TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
C6              TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
                **************************************************

C1              TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C2              TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C3              TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C4              TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C5              TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
C6              TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
                **************************************************

C1              GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C2              GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C3              GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C4              GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C5              GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
C6              GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
                **************************************************

C1              TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C2              TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C3              TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C4              TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C5              TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
C6              TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
                **************************************************

C1              GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C2              GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C3              GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C4              GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C5              GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
C6              GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
                **************************************************

C1              GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C2              GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C3              GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C4              GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C5              GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
C6              GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
                **************************************************

C1              CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C2              CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C3              CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C4              CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C5              CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
C6              CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
                **************************************************

C1              ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C2              ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C3              ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C4              ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C5              ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
C6              ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
                **************************************************

C1              GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C2              GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C3              GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C4              GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C5              GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
C6              GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
                **************************************************

C1              CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C2              CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C3              CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C4              CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C5              CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
C6              CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
                **************************************************

C1              TTTGCGGGAAAGGCCAGA
C2              TTTGCGGGAAAGGCCAGA
C3              TTTGCGGGAAAGGCCAGA
C4              TTTGCGGGAAAGGCCAGA
C5              TTTGCGGGAAAGGCCAGA
C6              TTTGCGGGAAAGGCCAGA
                ******************



>C1
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C2
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C3
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C4
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C5
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C6
ATGGAGTCGGTGTGTCCGCCCAATCGGGTGCTGACAGTGCCCAATTTGCT
CAGCGCTGTCCGCCTGGCGCTGATCCCGGCGTTTGTCTACGTTCTGCTGG
TCATGCACGCCGATGGCTGGGCGGTGGTGATTCTGGTGTTCAGCGGTGTC
TCGGACTGGGCCGACGGCAAGATTGCCCGGCTGCTGGATCAGTATTCGCG
GTTGGGTGTGCTGCTTGACCCCGCTGTCGATCGGCTGTACATGGTGACGA
TCCCCGTCGTGTTGGCGTTGAGCGGGATCGTGCCGTGGTGGTTTGTCGTC
GCTCTACTGGCACGTGACGTGCTACTGACCGCAACGCTGCCGTTGCTGTG
GAGTCGCGGACTGCTGTCATTACCGGTGACCTATATCGGTAAGGCGGCGA
CGTTCAGCTTGATGGTCGGCTTTCCATTCGTTCTTCTAGGAACTTGGGAC
ACGTTGTGGAGCCGTGTTCTGGGGGCCTGCGGTTGGGCGTTTCTGATCTG
GGGTACCTATGCGTACCTGTGGGCATTCGTGCTGTATGTGGTGCAGATGA
CGATGGTGGTGCGGTGGATGCCTAAGATCAAGCACCAAGCCCATCGTCAG
TTTGCGGGAAAGGCCAGA
>C1
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C2
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C3
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C4
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C5
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR
>C6
MESVCPPNRVLTVPNLLSAVRLALIPAFVYVLLVMHADGWAVVILVFSGV
SDWADGKIARLLDQYSRLGVLLDPAVDRLYMVTIPVVLALSGIVPWWFVV
ALLARDVLLTATLPLLWSRGLLSLPVTYIGKAATFSLMVGFPFVLLGTWD
TLWSRVLGACGWAFLIWGTYAYLWAFVLYVVQMTMVVRWMPKIKHQAHRQ
FAGKAR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 618 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579785135
      Setting output file names to "/data/10res/pgsA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 928828474
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 9395073317
      Seed = 313649239
      Swapseed = 1579785135
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1383.113619 -- -24.965149
         Chain 2 -- -1383.113538 -- -24.965149
         Chain 3 -- -1383.113409 -- -24.965149
         Chain 4 -- -1383.113538 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1383.113619 -- -24.965149
         Chain 2 -- -1383.113619 -- -24.965149
         Chain 3 -- -1383.113538 -- -24.965149
         Chain 4 -- -1383.113619 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1383.114] (-1383.114) (-1383.113) (-1383.114) * [-1383.114] (-1383.114) (-1383.114) (-1383.114) 
        500 -- (-863.228) (-857.529) [-844.392] (-861.525) * (-838.074) (-866.368) [-838.458] (-862.943) -- 0:00:00
       1000 -- (-842.420) (-846.383) (-840.321) [-843.042] * [-833.393] (-865.291) (-835.934) (-833.253) -- 0:00:00
       1500 -- [-839.006] (-843.062) (-841.037) (-836.064) * [-840.739] (-857.348) (-836.568) (-834.576) -- 0:00:00
       2000 -- (-838.367) [-835.030] (-839.777) (-843.131) * (-855.464) (-843.179) [-836.867] (-836.463) -- 0:00:00
       2500 -- [-833.675] (-837.066) (-847.496) (-840.735) * (-835.523) (-839.785) [-831.545] (-835.581) -- 0:00:00
       3000 -- [-835.024] (-840.870) (-836.827) (-838.510) * (-844.439) (-842.287) (-844.310) [-838.457] -- 0:00:00
       3500 -- (-841.184) (-841.561) [-835.391] (-839.697) * (-841.471) [-837.651] (-835.930) (-845.722) -- 0:00:00
       4000 -- (-841.655) (-838.858) [-835.831] (-842.436) * (-838.523) [-835.058] (-835.547) (-834.000) -- 0:00:00
       4500 -- (-841.354) (-837.473) [-836.323] (-838.593) * (-834.294) (-844.323) [-837.955] (-834.280) -- 0:00:00
       5000 -- [-836.490] (-841.369) (-849.251) (-835.776) * [-832.429] (-838.376) (-839.312) (-835.886) -- 0:00:00

      Average standard deviation of split frequencies: 0.107137

       5500 -- (-840.452) (-843.206) [-843.318] (-841.544) * (-839.016) (-831.771) [-834.277] (-843.048) -- 0:00:00
       6000 -- (-845.001) (-836.884) [-833.905] (-837.444) * [-839.092] (-851.293) (-835.969) (-831.319) -- 0:00:00
       6500 -- (-842.813) (-836.926) [-835.912] (-844.980) * (-841.993) [-830.953] (-847.777) (-841.195) -- 0:00:00
       7000 -- (-833.875) (-844.372) [-839.748] (-835.361) * (-835.978) (-833.103) [-837.377] (-846.593) -- 0:00:00
       7500 -- [-840.104] (-839.496) (-840.861) (-845.068) * (-834.115) (-837.577) (-837.260) [-837.560] -- 0:00:00
       8000 -- [-834.723] (-834.641) (-843.934) (-839.306) * (-834.986) (-838.018) (-840.811) [-841.353] -- 0:00:00
       8500 -- [-833.276] (-838.792) (-834.235) (-844.769) * (-834.330) (-839.926) (-832.165) [-841.400] -- 0:00:00
       9000 -- [-834.680] (-843.606) (-837.444) (-832.641) * [-840.612] (-839.290) (-835.875) (-833.249) -- 0:00:00
       9500 -- (-837.533) (-842.901) (-843.349) [-837.132] * (-836.647) (-835.741) [-836.519] (-834.565) -- 0:00:00
      10000 -- (-836.349) (-842.534) [-836.712] (-837.526) * (-832.066) (-840.089) (-843.814) [-838.471] -- 0:00:00

      Average standard deviation of split frequencies: 0.077340

      10500 -- (-836.537) (-836.143) [-836.438] (-836.044) * [-837.772] (-836.533) (-841.220) (-834.273) -- 0:00:00
      11000 -- (-835.883) [-838.382] (-837.049) (-841.664) * [-834.382] (-836.720) (-837.829) (-849.230) -- 0:00:00
      11500 -- (-836.082) [-835.960] (-840.541) (-836.286) * (-837.040) [-833.823] (-837.654) (-845.945) -- 0:00:00
      12000 -- [-836.364] (-837.158) (-839.182) (-839.526) * [-834.798] (-836.583) (-835.594) (-838.458) -- 0:00:00
      12500 -- (-836.961) (-831.946) [-840.665] (-838.578) * (-839.647) [-838.671] (-835.644) (-840.375) -- 0:01:19
      13000 -- [-837.389] (-839.346) (-830.781) (-852.676) * [-840.423] (-838.611) (-844.263) (-845.464) -- 0:01:15
      13500 -- (-839.522) (-843.136) [-831.717] (-831.145) * (-845.106) (-835.129) (-840.042) [-833.691] -- 0:01:13
      14000 -- (-842.198) (-837.441) [-829.758] (-828.244) * (-850.716) (-835.319) (-838.237) [-837.313] -- 0:01:10
      14500 -- (-835.670) (-832.553) (-829.738) [-828.833] * [-843.285] (-836.621) (-857.541) (-840.277) -- 0:01:07
      15000 -- (-841.791) [-836.233] (-834.340) (-828.351) * (-849.613) (-836.679) [-828.580] (-835.098) -- 0:01:05

      Average standard deviation of split frequencies: 0.070149

      15500 -- [-841.372] (-835.630) (-834.488) (-829.784) * (-843.276) [-836.652] (-832.456) (-834.899) -- 0:01:03
      16000 -- (-846.963) [-840.939] (-831.627) (-828.493) * (-852.753) [-832.754] (-831.465) (-834.621) -- 0:01:01
      16500 -- (-836.909) (-844.741) (-829.474) [-832.142] * (-836.927) [-832.889] (-828.727) (-836.844) -- 0:00:59
      17000 -- [-840.700] (-859.212) (-829.613) (-827.690) * (-830.390) (-836.465) [-831.081] (-838.716) -- 0:00:57
      17500 -- (-834.776) (-837.501) (-830.648) [-827.031] * (-828.173) [-839.330] (-831.868) (-840.752) -- 0:00:56
      18000 -- (-838.322) (-835.920) (-830.098) [-829.069] * [-827.518] (-838.768) (-828.734) (-836.659) -- 0:00:54
      18500 -- (-843.328) [-837.872] (-832.213) (-829.065) * [-827.479] (-841.624) (-830.654) (-840.369) -- 0:00:53
      19000 -- (-837.225) (-839.770) [-828.830] (-831.075) * (-828.244) [-840.930] (-828.707) (-841.745) -- 0:00:51
      19500 -- (-839.747) [-827.828] (-828.087) (-831.602) * [-829.339] (-840.347) (-827.762) (-841.666) -- 0:00:50
      20000 -- (-840.133) [-829.438] (-830.346) (-830.924) * [-826.978] (-837.879) (-828.763) (-836.631) -- 0:00:49

      Average standard deviation of split frequencies: 0.054951

      20500 -- (-848.713) (-831.610) [-830.608] (-830.517) * (-829.697) (-843.189) (-833.008) [-836.517] -- 0:00:47
      21000 -- [-838.865] (-829.758) (-827.575) (-827.035) * [-829.902] (-838.100) (-827.964) (-834.073) -- 0:00:46
      21500 -- [-835.982] (-827.757) (-826.938) (-828.330) * (-828.572) [-837.641] (-829.204) (-833.317) -- 0:00:45
      22000 -- (-835.652) (-830.130) [-826.982] (-827.419) * [-828.871] (-840.105) (-829.107) (-834.557) -- 0:00:44
      22500 -- (-839.585) [-831.956] (-830.137) (-827.868) * (-830.988) (-848.180) (-829.883) [-838.509] -- 0:00:43
      23000 -- (-843.091) (-829.637) [-827.307] (-828.992) * (-831.068) (-858.446) [-829.824] (-833.082) -- 0:00:42
      23500 -- (-841.529) (-827.767) [-826.989] (-829.049) * (-828.049) [-842.811] (-829.250) (-837.047) -- 0:00:41
      24000 -- (-835.393) (-831.382) (-827.605) [-827.129] * [-827.426] (-837.638) (-829.034) (-839.185) -- 0:00:40
      24500 -- (-837.140) [-830.742] (-827.978) (-828.824) * (-828.125) (-827.930) (-828.795) [-833.743] -- 0:00:39
      25000 -- (-838.006) (-831.047) (-828.568) [-831.172] * (-831.380) [-828.141] (-829.344) (-832.823) -- 0:00:39

      Average standard deviation of split frequencies: 0.046151

      25500 -- (-828.417) [-830.708] (-828.594) (-828.707) * [-830.017] (-828.428) (-833.913) (-845.300) -- 0:00:38
      26000 -- (-827.004) (-827.592) [-827.290] (-832.977) * (-828.696) (-830.659) (-828.630) [-835.531] -- 0:00:37
      26500 -- [-828.588] (-827.723) (-828.174) (-836.228) * [-827.415] (-828.354) (-831.114) (-831.583) -- 0:00:36
      27000 -- (-827.706) (-827.522) (-830.087) [-831.278] * [-827.465] (-827.992) (-835.175) (-828.384) -- 0:00:36
      27500 -- (-829.446) (-830.394) [-827.452] (-830.351) * (-831.304) [-828.445] (-832.127) (-828.045) -- 0:00:35
      28000 -- (-832.024) (-829.325) (-830.096) [-829.985] * [-827.989] (-828.333) (-831.335) (-829.569) -- 0:00:34
      28500 -- [-829.132] (-830.147) (-828.743) (-829.781) * (-828.161) (-828.936) (-829.684) [-831.455] -- 0:00:34
      29000 -- (-827.449) (-829.115) [-827.383] (-829.775) * (-830.516) [-828.167] (-829.593) (-827.629) -- 0:01:06
      29500 -- (-829.491) (-828.343) [-827.909] (-828.170) * (-829.910) (-831.168) [-828.087] (-827.623) -- 0:01:05
      30000 -- (-827.739) (-828.770) [-830.474] (-827.979) * (-827.175) (-829.507) [-830.001] (-835.784) -- 0:01:04

      Average standard deviation of split frequencies: 0.036600

      30500 -- (-832.798) [-828.983] (-833.588) (-827.934) * (-831.253) [-829.682] (-829.703) (-831.970) -- 0:01:03
      31000 -- (-830.989) (-830.259) [-830.361] (-827.530) * [-828.634] (-829.552) (-831.880) (-831.546) -- 0:01:02
      31500 -- (-829.651) [-827.573] (-827.664) (-828.980) * (-829.271) (-828.088) [-828.063] (-828.783) -- 0:01:01
      32000 -- [-831.153] (-829.012) (-832.113) (-828.530) * (-828.662) (-828.259) [-828.445] (-827.454) -- 0:01:00
      32500 -- (-829.179) [-830.475] (-831.020) (-829.888) * (-830.084) (-828.852) (-830.156) [-828.203] -- 0:00:59
      33000 -- (-828.636) (-828.797) [-827.542] (-833.962) * (-829.906) (-829.782) [-829.391] (-828.735) -- 0:00:58
      33500 -- (-828.208) [-828.877] (-827.597) (-830.431) * (-829.055) (-830.342) [-829.252] (-827.572) -- 0:00:57
      34000 -- (-831.022) (-829.215) [-830.403] (-829.992) * (-827.701) [-828.980] (-830.911) (-828.351) -- 0:00:56
      34500 -- (-828.696) [-827.913] (-830.423) (-829.147) * (-828.560) (-830.626) (-830.367) [-828.951] -- 0:00:55
      35000 -- (-830.729) [-827.331] (-830.150) (-830.300) * (-828.076) (-829.656) (-829.059) [-830.292] -- 0:00:55

      Average standard deviation of split frequencies: 0.033048

      35500 -- (-828.866) [-827.102] (-833.050) (-827.961) * (-827.711) (-829.335) [-831.142] (-829.764) -- 0:00:54
      36000 -- (-828.273) (-828.168) (-834.313) [-828.589] * (-827.365) (-829.504) [-829.700] (-829.066) -- 0:00:53
      36500 -- (-829.777) [-828.334] (-836.444) (-831.269) * (-828.853) (-829.699) (-828.426) [-829.617] -- 0:00:52
      37000 -- (-828.767) [-829.564] (-828.694) (-831.282) * (-830.678) [-829.863] (-827.985) (-831.480) -- 0:00:52
      37500 -- (-828.455) (-827.515) (-829.032) [-830.977] * (-829.725) (-829.443) [-828.628] (-830.462) -- 0:00:51
      38000 -- (-835.203) (-835.011) (-833.018) [-827.151] * [-829.964] (-828.833) (-831.167) (-831.528) -- 0:00:50
      38500 -- (-830.101) (-828.342) [-829.076] (-828.307) * (-831.998) (-830.873) [-834.197] (-831.595) -- 0:00:49
      39000 -- (-828.877) (-831.130) [-829.182] (-829.167) * (-829.197) (-827.791) [-829.184] (-836.174) -- 0:00:49
      39500 -- (-829.624) [-832.768] (-828.572) (-827.732) * (-831.109) (-828.880) (-828.845) [-829.445] -- 0:00:48
      40000 -- (-830.550) (-828.852) [-829.371] (-827.112) * (-828.848) [-827.217] (-828.167) (-832.408) -- 0:00:48

      Average standard deviation of split frequencies: 0.032945

      40500 -- (-834.804) (-827.574) (-828.944) [-829.225] * [-829.328] (-827.736) (-827.488) (-832.051) -- 0:00:47
      41000 -- [-830.748] (-828.281) (-829.283) (-829.247) * (-827.142) (-827.773) [-830.503] (-828.076) -- 0:00:46
      41500 -- (-831.941) (-829.937) [-830.875] (-831.173) * (-828.397) [-829.755] (-828.844) (-828.288) -- 0:00:46
      42000 -- (-833.858) (-827.518) [-830.614] (-827.829) * (-830.041) [-831.029] (-828.691) (-831.051) -- 0:00:45
      42500 -- (-828.554) (-828.839) (-826.937) [-830.256] * (-829.996) [-830.022] (-832.898) (-830.583) -- 0:00:45
      43000 -- (-832.253) (-829.179) [-826.885] (-832.266) * (-828.699) [-829.485] (-829.932) (-829.518) -- 0:00:44
      43500 -- (-831.056) (-831.151) [-828.017] (-828.129) * (-829.591) (-829.722) (-827.280) [-827.658] -- 0:00:43
      44000 -- (-830.815) (-828.158) (-828.460) [-828.050] * (-830.525) (-828.254) (-828.697) [-830.773] -- 0:00:43
      44500 -- (-826.999) (-827.263) (-829.157) [-828.609] * (-829.601) (-829.626) [-828.111] (-827.689) -- 0:00:42
      45000 -- [-828.587] (-827.838) (-828.967) (-828.977) * (-830.846) (-830.460) (-832.019) [-830.088] -- 0:01:03

      Average standard deviation of split frequencies: 0.029407

      45500 -- (-827.961) [-830.505] (-828.043) (-827.897) * (-829.278) [-826.713] (-831.195) (-828.715) -- 0:01:02
      46000 -- (-827.789) (-836.520) (-827.703) [-830.877] * [-827.588] (-827.523) (-828.433) (-829.463) -- 0:01:02
      46500 -- [-827.800] (-832.227) (-830.516) (-829.711) * (-827.503) (-826.937) [-829.019] (-831.185) -- 0:01:01
      47000 -- [-832.002] (-827.773) (-829.937) (-828.063) * [-828.280] (-829.782) (-828.220) (-829.547) -- 0:01:00
      47500 -- (-830.374) (-828.568) (-830.867) [-828.926] * (-827.406) (-827.878) [-827.542] (-828.991) -- 0:01:00
      48000 -- [-827.121] (-832.054) (-832.475) (-832.774) * [-829.516] (-827.736) (-828.170) (-827.742) -- 0:00:59
      48500 -- (-829.261) (-832.266) [-829.929] (-828.077) * [-828.585] (-828.376) (-830.458) (-828.447) -- 0:00:58
      49000 -- [-829.711] (-830.494) (-830.643) (-830.059) * (-834.931) [-828.860] (-832.075) (-827.501) -- 0:00:58
      49500 -- [-830.856] (-829.314) (-831.085) (-828.603) * (-831.307) (-830.068) [-827.119] (-827.752) -- 0:00:57
      50000 -- (-829.287) (-827.974) [-833.169] (-834.287) * [-830.328] (-831.391) (-830.134) (-826.885) -- 0:00:57

      Average standard deviation of split frequencies: 0.030027

      50500 -- (-827.162) (-829.033) [-830.613] (-834.287) * [-829.252] (-828.696) (-829.516) (-826.885) -- 0:00:56
      51000 -- [-828.671] (-828.632) (-828.588) (-832.516) * (-829.226) (-830.101) (-829.276) [-831.186] -- 0:00:55
      51500 -- [-828.338] (-828.415) (-830.581) (-831.742) * (-828.733) [-829.337] (-829.898) (-828.710) -- 0:00:55
      52000 -- (-828.719) (-829.049) (-832.925) [-835.387] * (-828.718) (-828.395) [-827.451] (-828.573) -- 0:00:54
      52500 -- (-828.997) (-829.710) [-828.956] (-831.804) * (-827.918) [-829.913] (-827.171) (-828.891) -- 0:00:54
      53000 -- (-831.107) (-829.292) (-827.735) [-829.086] * (-828.699) (-827.638) [-827.006] (-829.381) -- 0:00:53
      53500 -- (-831.610) (-828.769) [-828.901] (-828.715) * (-831.868) (-829.867) [-829.643] (-834.504) -- 0:00:53
      54000 -- (-832.202) (-829.739) (-827.935) [-828.474] * (-829.672) (-828.600) (-827.536) [-831.552] -- 0:00:52
      54500 -- (-829.453) (-827.890) (-828.010) [-830.124] * [-828.834] (-828.874) (-830.887) (-827.758) -- 0:00:52
      55000 -- [-830.910] (-830.284) (-827.701) (-830.856) * (-833.408) [-828.633] (-828.000) (-826.987) -- 0:00:51

      Average standard deviation of split frequencies: 0.030866

      55500 -- (-832.120) (-828.198) [-827.185] (-831.058) * (-834.303) [-827.998] (-830.449) (-827.123) -- 0:00:51
      56000 -- (-831.196) (-834.165) [-829.054] (-831.463) * (-829.032) (-827.487) (-829.309) [-827.203] -- 0:00:50
      56500 -- [-827.967] (-828.789) (-826.935) (-835.879) * (-829.417) [-830.124] (-833.251) (-829.795) -- 0:00:50
      57000 -- (-827.858) (-830.434) [-829.255] (-828.205) * (-830.367) [-828.029] (-828.904) (-828.479) -- 0:00:49
      57500 -- (-828.444) (-829.273) (-828.918) [-827.040] * (-829.577) [-830.761] (-829.778) (-829.171) -- 0:00:49
      58000 -- (-827.259) (-832.367) [-829.511] (-827.639) * (-828.073) [-829.067] (-828.252) (-828.586) -- 0:00:48
      58500 -- (-827.459) (-828.687) [-827.493] (-831.472) * (-830.534) (-828.537) (-827.542) [-827.868] -- 0:00:48
      59000 -- (-827.907) [-831.258] (-830.741) (-829.552) * [-833.260] (-827.926) (-827.115) (-828.205) -- 0:00:47
      59500 -- (-829.359) (-831.570) [-832.293] (-829.252) * (-828.060) (-828.432) [-827.969] (-828.610) -- 0:00:47
      60000 -- (-827.953) (-838.292) [-830.421] (-829.232) * (-830.881) [-827.201] (-828.387) (-830.412) -- 0:00:47

      Average standard deviation of split frequencies: 0.029037

      60500 -- (-827.408) (-830.692) [-831.638] (-828.674) * [-834.845] (-830.152) (-828.326) (-829.201) -- 0:00:46
      61000 -- (-828.829) (-833.809) (-832.467) [-828.649] * (-834.101) (-829.713) [-830.131] (-830.823) -- 0:00:46
      61500 -- [-827.422] (-836.625) (-832.043) (-826.959) * [-829.663] (-833.807) (-829.543) (-828.705) -- 0:00:45
      62000 -- (-830.076) [-831.636] (-829.566) (-829.619) * [-829.202] (-830.575) (-830.211) (-829.432) -- 0:01:00
      62500 -- [-828.362] (-827.351) (-829.103) (-829.644) * (-828.797) (-827.574) [-829.706] (-828.926) -- 0:01:00
      63000 -- (-832.509) (-827.559) (-827.058) [-826.992] * (-827.921) (-828.241) [-829.195] (-830.059) -- 0:00:59
      63500 -- [-838.873] (-826.757) (-827.236) (-826.997) * (-831.215) [-827.102] (-831.976) (-827.320) -- 0:00:58
      64000 -- (-828.813) (-830.581) [-828.209] (-829.933) * (-828.678) (-827.332) [-826.818] (-827.138) -- 0:00:58
      64500 -- (-830.077) (-828.582) [-827.881] (-832.094) * (-833.794) (-828.286) (-830.271) [-829.014] -- 0:00:58
      65000 -- (-829.976) [-828.325] (-829.883) (-829.357) * (-830.830) (-827.956) (-834.029) [-830.399] -- 0:00:57

      Average standard deviation of split frequencies: 0.032918

      65500 -- (-830.001) (-828.002) [-827.135] (-830.164) * (-828.460) (-827.853) (-830.100) [-832.168] -- 0:00:57
      66000 -- (-833.774) (-827.864) (-828.643) [-827.928] * (-828.174) (-829.037) (-828.682) [-829.433] -- 0:00:56
      66500 -- (-830.727) (-827.882) (-829.182) [-829.773] * (-828.307) [-830.249] (-831.470) (-831.292) -- 0:00:56
      67000 -- (-831.889) [-828.102] (-829.616) (-830.092) * (-831.609) (-830.676) (-830.000) [-829.522] -- 0:00:55
      67500 -- (-832.682) (-828.725) (-827.891) [-828.828] * (-828.991) [-829.159] (-826.720) (-828.881) -- 0:00:55
      68000 -- (-830.226) (-827.742) [-829.224] (-828.643) * [-828.415] (-828.447) (-828.453) (-828.915) -- 0:00:54
      68500 -- [-828.540] (-826.862) (-828.204) (-830.060) * (-834.951) [-827.555] (-827.275) (-833.674) -- 0:00:54
      69000 -- (-829.861) (-827.501) [-827.827] (-831.000) * (-831.155) (-827.518) [-827.317] (-834.124) -- 0:00:53
      69500 -- (-828.380) [-827.724] (-827.804) (-828.596) * (-829.434) [-830.436] (-830.202) (-832.777) -- 0:00:53
      70000 -- (-827.422) (-826.769) (-828.205) [-829.514] * (-828.606) (-828.164) (-827.697) [-829.152] -- 0:00:53

      Average standard deviation of split frequencies: 0.032719

      70500 -- (-826.803) (-826.670) (-827.084) [-827.763] * (-826.911) [-829.890] (-830.162) (-833.342) -- 0:00:52
      71000 -- [-829.728] (-829.192) (-829.001) (-828.487) * (-829.452) (-828.524) (-830.377) [-828.727] -- 0:00:52
      71500 -- (-829.466) (-828.590) (-829.305) [-828.303] * [-830.796] (-831.767) (-827.855) (-828.194) -- 0:00:51
      72000 -- [-828.906] (-828.565) (-829.203) (-829.112) * [-829.459] (-831.897) (-830.286) (-826.936) -- 0:00:51
      72500 -- (-829.163) [-831.725] (-828.728) (-827.214) * [-830.189] (-830.391) (-830.295) (-831.595) -- 0:00:51
      73000 -- [-829.548] (-828.615) (-827.628) (-827.416) * (-829.674) (-828.492) (-828.699) [-831.508] -- 0:00:50
      73500 -- (-827.532) [-834.062] (-829.215) (-829.577) * (-829.735) (-830.525) (-832.676) [-826.845] -- 0:00:50
      74000 -- (-827.955) [-831.460] (-828.091) (-827.225) * (-830.226) (-832.935) [-827.930] (-829.209) -- 0:00:50
      74500 -- (-829.111) [-830.180] (-831.482) (-828.396) * (-829.609) [-831.567] (-828.144) (-828.271) -- 0:00:49
      75000 -- (-828.395) (-832.163) (-832.422) [-828.647] * (-831.338) (-829.402) [-828.361] (-828.933) -- 0:00:49

      Average standard deviation of split frequencies: 0.029241

      75500 -- (-832.237) (-830.991) (-834.047) [-829.579] * (-828.477) (-828.873) [-829.500] (-828.947) -- 0:00:48
      76000 -- (-827.746) (-829.551) (-829.471) [-831.142] * (-828.279) (-828.157) [-834.379] (-828.968) -- 0:00:48
      76500 -- (-828.305) [-827.760] (-829.476) (-828.895) * [-834.624] (-833.616) (-831.877) (-829.886) -- 0:00:48
      77000 -- (-829.744) (-830.799) [-828.642] (-833.679) * (-833.107) (-831.403) [-830.872] (-830.361) -- 0:00:47
      77500 -- (-830.677) (-827.459) (-829.532) [-828.347] * [-829.376] (-829.018) (-830.186) (-830.610) -- 0:00:47
      78000 -- (-828.638) [-828.601] (-833.733) (-829.945) * (-827.937) [-827.183] (-828.066) (-828.107) -- 0:00:47
      78500 -- (-831.017) (-827.119) [-833.258] (-828.017) * (-830.653) (-829.772) [-827.758] (-831.502) -- 0:00:58
      79000 -- [-827.811] (-827.299) (-831.242) (-828.177) * [-833.217] (-829.527) (-827.816) (-833.946) -- 0:00:58
      79500 -- (-832.890) (-828.343) (-827.568) [-827.243] * (-833.292) [-827.198] (-829.470) (-837.017) -- 0:00:57
      80000 -- [-827.572] (-827.267) (-827.387) (-828.066) * (-827.706) (-828.638) [-831.731] (-832.882) -- 0:00:57

      Average standard deviation of split frequencies: 0.032726

      80500 -- (-827.652) (-829.273) [-826.893] (-827.004) * [-827.524] (-827.788) (-830.499) (-831.326) -- 0:00:57
      81000 -- (-830.058) (-827.296) [-828.756] (-827.211) * [-826.873] (-827.106) (-827.208) (-826.934) -- 0:00:56
      81500 -- (-829.162) (-831.047) (-829.339) [-828.416] * (-826.891) [-827.740] (-828.670) (-829.159) -- 0:00:56
      82000 -- (-828.777) (-831.647) (-828.149) [-827.724] * [-828.837] (-828.222) (-829.932) (-827.045) -- 0:00:55
      82500 -- (-827.526) (-829.897) (-827.559) [-828.354] * [-827.855] (-829.698) (-827.961) (-827.623) -- 0:00:55
      83000 -- (-829.234) (-830.970) [-827.975] (-832.354) * (-833.394) (-828.866) [-828.613] (-828.692) -- 0:00:55
      83500 -- [-828.254] (-830.996) (-827.918) (-829.636) * (-829.806) (-828.492) [-827.349] (-829.803) -- 0:00:54
      84000 -- (-830.599) (-829.521) [-828.756] (-830.685) * (-831.538) (-828.254) [-828.138] (-828.423) -- 0:00:54
      84500 -- (-831.483) (-827.366) [-827.250] (-832.618) * (-829.004) (-828.241) [-827.320] (-826.922) -- 0:00:54
      85000 -- (-827.985) (-830.467) (-827.837) [-829.199] * (-829.442) (-829.368) (-828.281) [-827.387] -- 0:00:53

      Average standard deviation of split frequencies: 0.032066

      85500 -- (-830.661) (-831.552) [-831.214] (-832.129) * (-833.187) [-828.389] (-830.023) (-828.143) -- 0:00:53
      86000 -- [-827.974] (-830.676) (-828.622) (-838.803) * (-829.874) [-832.936] (-829.202) (-829.357) -- 0:00:53
      86500 -- (-828.474) (-829.291) [-829.195] (-828.654) * [-830.231] (-831.593) (-827.865) (-833.177) -- 0:00:52
      87000 -- (-832.737) [-828.411] (-829.374) (-827.257) * (-829.748) (-831.737) [-829.676] (-836.529) -- 0:00:52
      87500 -- [-830.474] (-831.473) (-831.089) (-828.180) * (-831.988) [-827.766] (-828.059) (-830.963) -- 0:00:52
      88000 -- [-827.723] (-828.812) (-831.280) (-829.763) * [-829.521] (-830.765) (-834.121) (-829.948) -- 0:00:51
      88500 -- (-827.496) (-832.334) (-831.204) [-830.953] * (-830.318) (-827.960) [-831.124] (-829.364) -- 0:00:51
      89000 -- (-828.676) (-831.105) (-829.700) [-829.868] * (-827.819) (-830.566) [-826.905] (-829.290) -- 0:00:51
      89500 -- (-829.087) [-830.515] (-829.986) (-833.399) * (-828.055) (-829.862) [-826.737] (-830.168) -- 0:00:50
      90000 -- (-829.187) [-828.193] (-832.585) (-827.490) * (-828.024) (-829.860) (-828.190) [-828.324] -- 0:00:50

      Average standard deviation of split frequencies: 0.034206

      90500 -- (-832.656) (-828.266) [-830.296] (-827.674) * [-828.125] (-827.378) (-827.727) (-827.780) -- 0:00:50
      91000 -- (-827.993) (-828.478) [-831.246] (-828.467) * [-828.125] (-827.583) (-827.417) (-827.694) -- 0:00:49
      91500 -- (-831.779) (-830.066) [-828.540] (-828.539) * [-827.303] (-827.222) (-829.210) (-829.246) -- 0:00:49
      92000 -- [-831.414] (-828.386) (-829.030) (-829.526) * (-829.615) (-828.433) (-829.473) [-828.972] -- 0:00:49
      92500 -- (-831.821) [-828.737] (-830.602) (-829.759) * [-828.062] (-829.234) (-828.043) (-832.018) -- 0:00:49
      93000 -- (-837.903) (-831.343) (-829.502) [-828.227] * (-827.973) [-828.515] (-830.935) (-829.707) -- 0:00:48
      93500 -- (-836.211) [-830.389] (-829.472) (-830.310) * (-828.211) (-829.028) (-829.294) [-829.036] -- 0:00:48
      94000 -- (-829.073) [-828.143] (-827.824) (-832.702) * (-831.681) (-833.392) [-827.507] (-832.793) -- 0:00:48
      94500 -- (-830.184) [-829.855] (-827.313) (-833.466) * [-829.945] (-830.699) (-829.768) (-829.511) -- 0:00:47
      95000 -- (-831.053) (-827.957) [-831.029] (-828.436) * (-829.689) (-827.913) [-831.952] (-829.399) -- 0:00:57

      Average standard deviation of split frequencies: 0.030238

      95500 -- [-828.575] (-827.279) (-829.409) (-832.236) * (-827.580) (-829.695) [-833.083] (-834.988) -- 0:00:56
      96000 -- (-827.547) (-826.759) [-831.521] (-828.990) * (-829.001) [-828.962] (-829.759) (-828.977) -- 0:00:56
      96500 -- (-827.253) (-830.522) (-827.618) [-827.579] * [-828.449] (-828.415) (-828.112) (-830.526) -- 0:00:56
      97000 -- (-831.112) (-830.897) [-828.226] (-828.277) * [-827.965] (-828.565) (-828.041) (-828.839) -- 0:00:55
      97500 -- (-829.651) (-828.845) (-833.308) [-828.722] * (-828.375) [-826.876] (-830.051) (-831.570) -- 0:00:55
      98000 -- [-830.634] (-827.970) (-828.882) (-831.297) * (-829.483) [-828.218] (-829.453) (-830.498) -- 0:00:55
      98500 -- [-827.239] (-828.110) (-830.994) (-827.081) * (-827.923) (-827.166) (-830.860) [-832.018] -- 0:00:54
      99000 -- (-828.365) (-828.680) [-827.895] (-827.856) * (-829.435) (-828.965) [-830.348] (-831.141) -- 0:00:54
      99500 -- (-827.972) (-829.761) (-831.986) [-827.673] * (-828.438) (-830.171) (-836.215) [-827.281] -- 0:00:54
      100000 -- [-829.729] (-828.802) (-831.598) (-830.451) * (-830.006) [-828.439] (-832.780) (-828.662) -- 0:00:54

      Average standard deviation of split frequencies: 0.025632

      100500 -- (-828.455) (-827.292) [-831.902] (-831.153) * (-829.556) [-829.336] (-827.762) (-828.008) -- 0:00:53
      101000 -- (-827.668) (-828.480) [-828.885] (-829.404) * [-829.079] (-827.602) (-827.831) (-829.146) -- 0:00:53
      101500 -- (-826.938) (-828.782) (-827.893) [-828.365] * [-827.469] (-832.357) (-827.447) (-827.097) -- 0:00:53
      102000 -- (-827.272) (-829.069) (-829.069) [-827.266] * (-828.873) (-830.202) (-827.876) [-830.055] -- 0:00:52
      102500 -- (-828.854) (-828.534) (-827.668) [-830.008] * (-829.938) (-830.948) [-828.049] (-829.239) -- 0:00:52
      103000 -- (-830.283) (-827.507) [-828.855] (-827.330) * (-831.813) (-829.884) [-827.684] (-829.218) -- 0:00:52
      103500 -- (-827.079) (-827.350) (-829.165) [-830.460] * (-830.361) (-828.253) [-827.449] (-829.440) -- 0:00:51
      104000 -- [-828.157] (-827.966) (-829.198) (-828.480) * (-831.656) (-827.953) [-827.122] (-826.954) -- 0:00:51
      104500 -- [-826.842] (-833.811) (-827.551) (-827.815) * (-832.258) (-831.014) [-828.867] (-827.489) -- 0:00:51
      105000 -- (-829.013) [-828.611] (-831.532) (-827.435) * (-832.663) (-827.920) [-828.961] (-829.237) -- 0:00:51

      Average standard deviation of split frequencies: 0.022704

      105500 -- (-828.524) (-829.969) (-829.979) [-828.456] * [-828.472] (-827.221) (-827.348) (-829.542) -- 0:00:50
      106000 -- (-828.783) [-827.619] (-828.019) (-829.481) * [-830.177] (-828.015) (-827.557) (-832.896) -- 0:00:50
      106500 -- (-827.780) (-827.749) [-831.492] (-831.904) * [-832.953] (-828.470) (-829.224) (-830.831) -- 0:00:50
      107000 -- (-828.269) [-827.664] (-831.077) (-828.966) * (-830.207) (-828.580) (-828.718) [-828.184] -- 0:00:50
      107500 -- (-828.800) (-829.713) (-829.340) [-828.463] * (-829.785) [-828.648] (-829.174) (-828.706) -- 0:00:49
      108000 -- (-832.145) (-827.537) (-828.399) [-828.712] * (-829.759) [-827.682] (-827.820) (-826.930) -- 0:00:49
      108500 -- (-831.512) (-827.885) [-829.380] (-827.976) * [-828.244] (-830.817) (-830.641) (-827.407) -- 0:00:49
      109000 -- [-827.466] (-830.469) (-829.794) (-828.689) * (-828.043) (-836.230) (-828.705) [-828.866] -- 0:00:49
      109500 -- (-827.209) [-827.384] (-828.647) (-827.295) * (-829.842) (-833.444) (-827.883) [-831.484] -- 0:00:48
      110000 -- (-827.754) [-828.264] (-828.962) (-827.625) * [-827.697] (-829.496) (-829.125) (-827.775) -- 0:00:48

      Average standard deviation of split frequencies: 0.020850

      110500 -- (-826.894) [-827.689] (-830.586) (-829.316) * [-828.550] (-829.839) (-831.537) (-828.180) -- 0:00:48
      111000 -- (-828.879) (-829.746) (-831.721) [-829.568] * (-829.825) [-829.520] (-831.103) (-829.539) -- 0:00:48
      111500 -- (-830.424) (-834.261) [-828.014] (-828.186) * (-828.334) (-830.533) [-828.334] (-829.481) -- 0:00:47
      112000 -- (-833.018) (-829.479) (-827.451) [-826.623] * [-828.601] (-827.996) (-828.613) (-829.123) -- 0:00:55
      112500 -- (-832.870) (-829.475) [-829.609] (-827.808) * (-830.181) (-832.472) (-827.817) [-827.083] -- 0:00:55
      113000 -- (-830.070) (-834.669) (-831.771) [-828.309] * (-829.396) [-831.724] (-831.305) (-833.098) -- 0:00:54
      113500 -- (-829.897) (-829.040) (-827.649) [-828.726] * (-827.869) (-828.484) (-827.299) [-830.643] -- 0:00:54
      114000 -- (-829.486) (-831.004) (-829.094) [-830.602] * (-828.834) (-829.047) [-829.168] (-828.611) -- 0:00:54
      114500 -- (-828.087) (-827.917) (-827.861) [-829.890] * (-828.719) [-832.393] (-829.604) (-827.778) -- 0:00:54
      115000 -- (-828.238) (-828.408) (-834.850) [-827.494] * (-829.613) (-829.470) [-828.603] (-829.650) -- 0:00:53

      Average standard deviation of split frequencies: 0.020533

      115500 -- (-834.325) [-832.375] (-830.020) (-827.659) * (-828.600) (-832.033) (-828.663) [-828.489] -- 0:00:53
      116000 -- (-830.703) (-831.561) [-829.395] (-830.953) * (-827.144) (-829.235) (-827.540) [-828.128] -- 0:00:53
      116500 -- (-827.664) [-832.097] (-830.035) (-831.714) * (-830.923) [-828.505] (-828.758) (-830.269) -- 0:00:53
      117000 -- [-832.116] (-833.735) (-830.195) (-831.569) * (-831.360) (-828.301) [-828.285] (-832.881) -- 0:00:52
      117500 -- (-830.812) (-827.415) [-829.889] (-828.533) * (-828.118) (-827.954) (-828.192) [-830.543] -- 0:00:52
      118000 -- (-829.308) (-826.965) (-827.848) [-827.126] * (-829.933) [-829.105] (-828.110) (-832.045) -- 0:00:52
      118500 -- (-827.218) [-827.500] (-827.893) (-827.378) * [-829.603] (-827.811) (-828.743) (-830.334) -- 0:00:52
      119000 -- (-831.196) [-828.016] (-827.517) (-828.806) * (-831.238) [-827.606] (-831.845) (-828.180) -- 0:00:51
      119500 -- (-831.017) [-828.641] (-828.494) (-828.190) * (-827.805) [-828.005] (-828.031) (-829.185) -- 0:00:51
      120000 -- (-830.454) [-828.058] (-828.457) (-828.191) * (-830.996) [-834.367] (-830.156) (-829.536) -- 0:00:51

      Average standard deviation of split frequencies: 0.023210

      120500 -- (-828.917) (-830.809) [-831.507] (-828.405) * (-827.373) [-829.983] (-829.315) (-828.536) -- 0:00:51
      121000 -- (-828.276) (-829.720) (-828.060) [-827.650] * [-832.568] (-830.821) (-829.264) (-831.180) -- 0:00:50
      121500 -- (-830.718) [-827.860] (-829.033) (-827.966) * [-829.710] (-829.554) (-829.453) (-828.475) -- 0:00:50
      122000 -- (-833.551) [-828.812] (-829.308) (-831.633) * [-829.022] (-829.582) (-829.694) (-830.006) -- 0:00:50
      122500 -- (-831.106) (-827.719) [-832.283] (-829.268) * [-827.783] (-828.636) (-829.188) (-828.581) -- 0:00:50
      123000 -- [-831.527] (-830.872) (-828.273) (-829.772) * (-831.552) [-831.028] (-829.722) (-829.610) -- 0:00:49
      123500 -- (-828.905) (-828.409) [-829.165] (-829.288) * (-827.196) (-828.618) [-828.876] (-831.652) -- 0:00:49
      124000 -- (-828.239) (-830.441) [-829.781] (-827.478) * (-830.312) [-827.437] (-828.141) (-828.752) -- 0:00:49
      124500 -- (-829.518) (-827.369) [-830.768] (-827.914) * (-828.985) (-827.305) [-827.185] (-828.776) -- 0:00:49
      125000 -- [-826.627] (-827.843) (-830.241) (-829.339) * [-827.992] (-830.156) (-828.802) (-829.201) -- 0:00:49

      Average standard deviation of split frequencies: 0.020488

      125500 -- [-826.932] (-828.165) (-830.302) (-830.516) * [-828.425] (-832.457) (-830.843) (-827.343) -- 0:00:48
      126000 -- [-826.920] (-828.369) (-833.758) (-827.696) * [-827.491] (-829.886) (-828.099) (-828.058) -- 0:00:48
      126500 -- (-827.538) [-829.009] (-827.497) (-828.870) * (-828.503) (-829.047) [-830.096] (-827.934) -- 0:00:48
      127000 -- [-827.041] (-828.119) (-827.982) (-831.594) * (-829.388) (-828.757) (-829.927) [-833.168] -- 0:00:48
      127500 -- (-828.771) (-829.688) (-829.871) [-828.854] * (-831.673) (-828.666) [-828.605] (-832.377) -- 0:00:47
      128000 -- (-828.847) (-829.921) (-828.241) [-827.157] * (-828.810) (-830.296) [-828.562] (-827.675) -- 0:00:47
      128500 -- [-827.131] (-829.329) (-828.638) (-827.266) * (-828.840) (-830.872) (-828.946) [-827.674] -- 0:00:54
      129000 -- (-827.798) (-829.099) (-832.251) [-827.264] * [-827.587] (-827.287) (-827.853) (-830.454) -- 0:00:54
      129500 -- (-827.269) (-828.203) [-828.576] (-827.513) * (-828.635) [-828.267] (-828.369) (-829.465) -- 0:00:53
      130000 -- [-832.246] (-828.557) (-829.517) (-830.876) * [-827.901] (-830.017) (-828.102) (-831.780) -- 0:00:53

      Average standard deviation of split frequencies: 0.020787

      130500 -- (-827.151) (-830.107) (-829.425) [-836.019] * (-829.532) (-830.221) [-827.704] (-829.752) -- 0:00:53
      131000 -- (-831.467) [-831.478] (-828.255) (-832.562) * (-827.581) (-831.648) [-826.877] (-830.169) -- 0:00:53
      131500 -- (-828.663) [-830.157] (-832.270) (-829.335) * [-828.007] (-828.427) (-828.759) (-829.814) -- 0:00:52
      132000 -- (-830.812) [-829.812] (-832.102) (-829.495) * (-829.046) (-829.668) [-828.368] (-830.729) -- 0:00:52
      132500 -- [-832.169] (-830.510) (-831.396) (-827.595) * [-828.723] (-829.733) (-827.381) (-832.967) -- 0:00:52
      133000 -- (-828.823) (-828.620) [-828.659] (-826.741) * (-827.622) (-828.322) (-828.271) [-834.088] -- 0:00:52
      133500 -- (-830.329) [-828.820] (-830.465) (-828.291) * (-828.698) (-830.056) (-827.738) [-831.115] -- 0:00:51
      134000 -- [-829.514] (-827.757) (-828.382) (-832.917) * (-827.014) [-829.218] (-832.311) (-827.791) -- 0:00:51
      134500 -- (-827.523) [-828.994] (-829.499) (-830.517) * (-826.969) (-828.584) [-832.179] (-828.381) -- 0:00:51
      135000 -- (-828.048) (-829.053) (-828.163) [-828.768] * (-828.351) [-828.933] (-828.043) (-831.252) -- 0:00:51

      Average standard deviation of split frequencies: 0.019411

      135500 -- (-827.956) [-829.945] (-828.163) (-828.653) * (-829.450) [-828.821] (-828.040) (-828.048) -- 0:00:51
      136000 -- (-828.250) [-831.021] (-828.292) (-830.008) * (-829.245) (-827.023) [-828.954] (-831.711) -- 0:00:50
      136500 -- (-830.926) (-827.616) (-829.717) [-827.666] * (-829.214) (-830.587) [-827.175] (-826.786) -- 0:00:50
      137000 -- (-829.864) (-829.100) (-829.761) [-829.297] * (-828.422) [-827.149] (-826.904) (-827.666) -- 0:00:50
      137500 -- (-829.012) (-829.242) [-828.912] (-833.513) * (-827.584) (-827.921) [-829.081] (-828.872) -- 0:00:50
      138000 -- (-833.017) (-828.272) [-830.027] (-830.290) * (-830.421) [-828.114] (-827.691) (-829.139) -- 0:00:49
      138500 -- [-828.588] (-831.972) (-830.562) (-832.278) * [-829.171] (-827.248) (-832.421) (-829.567) -- 0:00:49
      139000 -- (-830.328) (-830.878) [-828.812] (-829.132) * (-835.463) (-826.985) [-830.846] (-829.175) -- 0:00:49
      139500 -- (-827.909) (-832.926) [-830.970] (-828.336) * [-834.239] (-828.063) (-828.129) (-838.110) -- 0:00:49
      140000 -- [-827.533] (-834.201) (-829.938) (-827.798) * [-829.786] (-831.090) (-828.930) (-829.772) -- 0:00:49

      Average standard deviation of split frequencies: 0.020813

      140500 -- [-829.321] (-828.092) (-836.044) (-827.872) * [-827.125] (-829.121) (-831.379) (-827.289) -- 0:00:48
      141000 -- (-832.617) [-827.408] (-828.467) (-829.529) * [-828.842] (-829.534) (-827.935) (-827.776) -- 0:00:48
      141500 -- (-834.177) [-829.736] (-828.495) (-831.100) * (-828.974) (-828.594) (-830.643) [-829.233] -- 0:00:48
      142000 -- (-828.527) (-829.895) (-829.108) [-830.480] * (-831.015) (-827.223) [-829.950] (-830.032) -- 0:00:48
      142500 -- [-829.130] (-828.176) (-827.487) (-828.744) * (-828.524) (-829.823) (-829.541) [-830.776] -- 0:00:48
      143000 -- (-828.859) (-831.422) [-827.193] (-830.350) * [-829.369] (-828.364) (-831.593) (-827.614) -- 0:00:47
      143500 -- (-827.872) [-828.854] (-827.754) (-829.359) * (-829.459) (-829.996) [-827.822] (-829.325) -- 0:00:47
      144000 -- (-830.123) (-827.105) (-828.153) [-829.306] * (-829.488) (-833.129) (-827.873) [-829.997] -- 0:00:47
      144500 -- (-827.891) (-832.045) [-828.570] (-828.900) * (-829.586) [-827.693] (-830.156) (-832.012) -- 0:00:47
      145000 -- (-832.474) (-828.495) [-827.703] (-830.968) * [-827.480] (-830.647) (-830.465) (-827.716) -- 0:00:53

      Average standard deviation of split frequencies: 0.020449

      145500 -- (-830.695) (-827.647) (-827.815) [-827.870] * [-827.246] (-830.015) (-831.539) (-828.224) -- 0:00:52
      146000 -- [-830.034] (-827.943) (-828.215) (-827.667) * [-828.299] (-830.291) (-830.915) (-830.081) -- 0:00:52
      146500 -- (-829.090) (-832.087) (-830.311) [-827.290] * (-829.758) [-828.060] (-835.843) (-835.925) -- 0:00:52
      147000 -- (-828.432) [-827.560] (-829.540) (-828.838) * [-829.621] (-828.635) (-832.832) (-830.178) -- 0:00:52
      147500 -- (-829.093) (-827.798) (-827.228) [-827.475] * (-828.544) [-829.224] (-828.093) (-833.447) -- 0:00:52
      148000 -- [-827.580] (-830.165) (-828.837) (-828.639) * [-827.578] (-830.310) (-829.634) (-831.730) -- 0:00:51
      148500 -- (-827.787) [-827.495] (-827.864) (-830.369) * [-830.149] (-829.046) (-830.502) (-828.436) -- 0:00:51
      149000 -- [-827.093] (-828.673) (-830.127) (-831.553) * (-831.353) (-831.678) [-829.838] (-828.478) -- 0:00:51
      149500 -- [-827.217] (-828.207) (-829.734) (-829.265) * (-830.660) [-830.543] (-827.185) (-829.881) -- 0:00:51
      150000 -- (-827.229) (-828.844) [-829.589] (-827.793) * (-830.248) (-828.486) [-831.501] (-833.236) -- 0:00:51

      Average standard deviation of split frequencies: 0.021119

      150500 -- (-833.121) (-828.323) (-828.380) [-828.123] * (-830.888) [-829.308] (-828.061) (-832.649) -- 0:00:50
      151000 -- (-826.723) [-829.809] (-828.768) (-829.779) * (-827.514) (-828.833) (-829.709) [-830.796] -- 0:00:50
      151500 -- (-827.438) (-829.334) (-832.136) [-829.779] * (-828.917) (-833.173) (-829.960) [-828.061] -- 0:00:50
      152000 -- [-826.838] (-830.112) (-829.860) (-829.385) * [-827.892] (-830.304) (-828.174) (-827.793) -- 0:00:50
      152500 -- (-827.828) (-828.997) (-827.996) [-829.960] * (-829.654) (-830.762) [-826.809] (-829.294) -- 0:00:50
      153000 -- (-827.665) (-827.277) [-828.071] (-827.816) * [-828.889] (-829.731) (-827.307) (-830.084) -- 0:00:49
      153500 -- (-828.303) [-829.294] (-827.408) (-827.958) * (-827.722) (-829.328) [-831.667] (-830.223) -- 0:00:49
      154000 -- (-826.863) (-829.408) (-828.550) [-827.501] * (-829.986) (-827.637) (-829.614) [-829.333] -- 0:00:49
      154500 -- (-827.179) (-828.090) [-831.918] (-829.698) * [-831.216] (-827.405) (-830.564) (-827.814) -- 0:00:49
      155000 -- (-827.587) (-827.751) (-829.117) [-830.478] * [-828.677] (-831.376) (-828.738) (-831.905) -- 0:00:49

      Average standard deviation of split frequencies: 0.023503

      155500 -- (-830.074) [-827.839] (-831.640) (-828.083) * [-829.612] (-831.282) (-830.717) (-829.666) -- 0:00:48
      156000 -- (-828.197) (-828.554) (-829.838) [-828.598] * [-831.706] (-827.716) (-828.266) (-829.058) -- 0:00:48
      156500 -- (-828.222) (-828.360) (-829.598) [-828.143] * [-827.394] (-829.978) (-832.975) (-829.018) -- 0:00:48
      157000 -- (-832.266) (-830.979) (-827.975) [-827.377] * (-832.849) (-832.546) [-829.513] (-827.874) -- 0:00:48
      157500 -- (-829.552) (-827.200) [-828.774] (-829.589) * (-834.441) (-829.444) [-827.012] (-827.568) -- 0:00:48
      158000 -- [-829.470] (-830.212) (-828.687) (-827.883) * (-831.658) (-829.226) [-827.284] (-830.675) -- 0:00:47
      158500 -- (-829.389) (-830.077) (-829.385) [-829.441] * (-834.480) [-829.217] (-829.551) (-831.269) -- 0:00:47
      159000 -- [-829.295] (-828.624) (-827.604) (-829.179) * (-837.604) (-828.967) (-830.248) [-829.232] -- 0:00:47
      159500 -- [-830.049] (-832.190) (-830.609) (-828.665) * [-829.684] (-829.132) (-829.648) (-829.197) -- 0:00:47
      160000 -- (-833.747) [-832.606] (-833.590) (-829.520) * (-828.959) (-829.789) (-828.087) [-827.478] -- 0:00:47

      Average standard deviation of split frequencies: 0.022005

      160500 -- (-835.277) (-831.089) (-830.010) [-829.949] * [-827.866] (-828.397) (-830.929) (-829.410) -- 0:00:47
      161000 -- (-830.014) (-827.596) [-829.937] (-830.440) * (-829.725) (-832.500) (-830.211) [-831.222] -- 0:00:46
      161500 -- (-828.943) (-828.424) (-831.438) [-828.648] * (-827.601) [-832.356] (-828.665) (-831.097) -- 0:00:51
      162000 -- [-830.710] (-830.409) (-828.018) (-827.770) * [-831.606] (-833.234) (-833.614) (-830.320) -- 0:00:51
      162500 -- (-831.117) (-830.203) (-828.244) [-826.924] * (-829.026) (-831.009) [-830.206] (-828.739) -- 0:00:51
      163000 -- [-829.999] (-827.967) (-830.083) (-828.279) * (-830.782) (-828.157) [-828.581] (-828.235) -- 0:00:51
      163500 -- [-830.748] (-828.162) (-832.345) (-834.613) * [-828.097] (-830.311) (-828.443) (-830.520) -- 0:00:51
      164000 -- [-827.503] (-828.025) (-828.493) (-827.865) * [-827.939] (-828.361) (-829.651) (-828.092) -- 0:00:50
      164500 -- [-830.214] (-827.643) (-828.222) (-829.657) * (-828.153) [-828.908] (-828.485) (-828.822) -- 0:00:50
      165000 -- (-829.987) [-831.172] (-831.172) (-828.309) * [-827.818] (-827.984) (-830.991) (-832.752) -- 0:00:50

      Average standard deviation of split frequencies: 0.018533

      165500 -- [-829.225] (-830.900) (-834.715) (-828.644) * (-826.888) [-827.413] (-832.710) (-828.478) -- 0:00:50
      166000 -- (-828.491) (-829.913) [-828.441] (-830.751) * (-827.380) (-833.560) [-831.362] (-827.708) -- 0:00:50
      166500 -- (-831.775) (-832.242) (-827.035) [-830.870] * (-827.747) (-830.698) [-831.288] (-828.602) -- 0:00:50
      167000 -- (-831.595) (-827.472) (-828.405) [-828.249] * [-827.746] (-829.572) (-830.472) (-830.887) -- 0:00:49
      167500 -- (-831.352) (-829.221) [-827.567] (-828.382) * (-829.464) (-834.415) (-827.370) [-829.338] -- 0:00:49
      168000 -- [-830.630] (-830.423) (-830.515) (-829.059) * [-830.446] (-828.845) (-827.636) (-831.170) -- 0:00:49
      168500 -- (-833.314) [-831.125] (-831.534) (-829.011) * [-827.064] (-828.940) (-827.155) (-827.254) -- 0:00:49
      169000 -- [-828.209] (-833.036) (-829.080) (-828.224) * (-830.831) (-828.265) [-827.159] (-827.962) -- 0:00:49
      169500 -- (-827.130) (-828.931) [-828.091] (-831.478) * (-828.451) (-829.952) [-829.130] (-829.051) -- 0:00:48
      170000 -- [-832.230] (-828.486) (-827.658) (-827.128) * [-827.132] (-828.099) (-829.859) (-829.573) -- 0:00:48

      Average standard deviation of split frequencies: 0.019949

      170500 -- (-831.439) (-827.489) [-829.364] (-827.735) * [-828.078] (-832.298) (-829.461) (-828.462) -- 0:00:48
      171000 -- (-830.978) [-827.632] (-828.688) (-830.919) * (-828.120) (-827.966) (-829.318) [-828.642] -- 0:00:48
      171500 -- (-830.923) (-826.921) [-830.575] (-829.392) * (-830.394) (-830.608) (-832.372) [-828.522] -- 0:00:48
      172000 -- [-832.008] (-828.849) (-828.674) (-829.485) * (-828.767) [-828.969] (-827.806) (-827.922) -- 0:00:48
      172500 -- (-828.797) [-827.438] (-827.969) (-831.078) * (-833.921) [-827.372] (-830.321) (-828.319) -- 0:00:47
      173000 -- [-830.380] (-827.475) (-830.882) (-827.415) * (-834.762) [-828.639] (-831.798) (-829.913) -- 0:00:47
      173500 -- [-827.474] (-827.475) (-828.948) (-832.165) * [-827.841] (-827.983) (-828.565) (-832.404) -- 0:00:47
      174000 -- [-828.713] (-829.267) (-829.128) (-828.888) * [-828.709] (-827.705) (-828.780) (-828.023) -- 0:00:47
      174500 -- [-829.176] (-831.378) (-828.235) (-829.067) * [-829.071] (-829.752) (-829.174) (-827.072) -- 0:00:47
      175000 -- (-829.634) (-832.032) (-830.932) [-827.349] * (-831.065) [-828.478] (-828.634) (-827.642) -- 0:00:47

      Average standard deviation of split frequencies: 0.017480

      175500 -- [-829.769] (-830.978) (-828.146) (-829.317) * (-833.982) (-829.937) [-829.100] (-829.501) -- 0:00:46
      176000 -- (-828.107) [-829.567] (-830.344) (-828.613) * (-831.083) [-828.077] (-828.795) (-827.258) -- 0:00:46
      176500 -- [-828.414] (-831.095) (-827.666) (-834.246) * (-832.626) (-828.081) [-826.810] (-828.682) -- 0:00:46
      177000 -- (-827.168) (-829.481) (-829.822) [-828.553] * (-832.111) (-827.322) (-828.258) [-828.016] -- 0:00:46
      177500 -- (-830.715) (-829.688) (-831.977) [-831.755] * (-831.772) (-827.379) (-828.392) [-827.694] -- 0:00:46
      178000 -- (-833.799) [-829.780] (-831.966) (-831.523) * [-831.525] (-828.144) (-827.932) (-832.209) -- 0:00:50
      178500 -- [-832.604] (-827.451) (-830.724) (-832.976) * (-832.157) [-828.602] (-830.046) (-830.829) -- 0:00:50
      179000 -- [-828.181] (-827.892) (-827.202) (-829.852) * (-827.943) (-829.574) (-830.009) [-829.833] -- 0:00:50
      179500 -- [-829.948] (-831.220) (-827.316) (-827.638) * (-829.232) [-830.995] (-827.809) (-829.390) -- 0:00:50
      180000 -- (-829.010) (-829.238) [-827.471] (-829.785) * (-828.802) (-831.677) (-828.319) [-834.035] -- 0:00:50

      Average standard deviation of split frequencies: 0.016815

      180500 -- (-829.095) (-828.154) [-831.019] (-831.360) * [-827.641] (-830.359) (-827.809) (-827.614) -- 0:00:49
      181000 -- [-828.652] (-832.608) (-830.149) (-832.019) * (-827.272) (-831.662) [-828.048] (-828.443) -- 0:00:49
      181500 -- (-828.794) (-829.073) [-829.325] (-827.788) * (-829.085) (-827.475) (-828.047) [-827.412] -- 0:00:49
      182000 -- [-831.158] (-828.263) (-830.322) (-828.467) * [-829.775] (-829.952) (-829.118) (-830.688) -- 0:00:49
      182500 -- [-827.864] (-827.280) (-827.407) (-830.566) * (-828.648) (-829.109) [-828.957] (-829.224) -- 0:00:49
      183000 -- [-828.551] (-827.436) (-829.923) (-828.776) * [-827.089] (-827.338) (-828.332) (-829.628) -- 0:00:49
      183500 -- [-828.723] (-829.298) (-827.319) (-829.142) * [-826.934] (-827.177) (-830.169) (-835.091) -- 0:00:48
      184000 -- [-828.304] (-831.436) (-828.190) (-832.704) * [-827.879] (-828.919) (-833.230) (-830.213) -- 0:00:48
      184500 -- (-827.922) [-829.509] (-831.854) (-828.855) * (-828.695) (-827.871) (-834.689) [-829.831] -- 0:00:48
      185000 -- (-828.114) (-830.084) [-828.580] (-828.338) * (-831.352) (-830.883) (-827.148) [-829.454] -- 0:00:48

      Average standard deviation of split frequencies: 0.018408

      185500 -- (-829.431) (-827.968) [-827.740] (-828.762) * [-828.196] (-828.140) (-830.442) (-829.577) -- 0:00:48
      186000 -- (-829.217) (-831.852) (-829.528) [-827.634] * (-830.632) (-830.085) (-827.502) [-828.252] -- 0:00:48
      186500 -- (-830.871) (-830.198) (-828.089) [-828.010] * (-829.934) (-828.344) [-828.822] (-827.592) -- 0:00:47
      187000 -- (-830.968) (-831.360) [-827.073] (-828.631) * [-829.399] (-830.111) (-832.235) (-830.998) -- 0:00:47
      187500 -- (-829.246) (-829.156) (-830.373) [-829.872] * (-830.225) (-828.516) [-827.549] (-828.487) -- 0:00:47
      188000 -- (-827.879) (-829.888) [-829.183] (-830.209) * [-827.545] (-832.880) (-826.914) (-833.046) -- 0:00:47
      188500 -- (-831.456) (-830.196) (-827.205) [-828.316] * [-828.134] (-829.735) (-827.665) (-829.193) -- 0:00:47
      189000 -- (-831.448) [-828.750] (-828.994) (-830.711) * (-827.658) (-829.037) [-831.761] (-827.709) -- 0:00:47
      189500 -- (-830.445) (-831.530) (-833.848) [-832.744] * [-832.103] (-827.543) (-827.336) (-828.129) -- 0:00:47
      190000 -- (-829.844) (-832.313) (-833.136) [-833.534] * (-828.605) [-827.526] (-827.019) (-831.261) -- 0:00:46

      Average standard deviation of split frequencies: 0.016071

      190500 -- (-828.727) [-827.591] (-827.770) (-832.863) * (-827.585) (-830.560) (-827.167) [-831.379] -- 0:00:46
      191000 -- (-828.742) (-827.191) (-828.580) [-829.274] * (-827.803) (-828.276) [-828.472] (-828.201) -- 0:00:46
      191500 -- [-829.034] (-830.956) (-828.341) (-833.062) * (-828.257) (-830.877) [-826.896] (-828.573) -- 0:00:46
      192000 -- (-829.249) [-827.396] (-830.104) (-830.812) * (-828.223) (-828.286) [-827.179] (-829.138) -- 0:00:46
      192500 -- (-832.545) (-827.404) [-828.932] (-829.652) * (-830.158) [-828.237] (-829.135) (-830.181) -- 0:00:46
      193000 -- (-827.682) (-828.035) (-828.066) [-827.534] * (-827.059) (-829.039) [-827.308] (-829.467) -- 0:00:45
      193500 -- [-827.403] (-828.118) (-828.175) (-827.598) * [-828.035] (-829.103) (-828.478) (-830.639) -- 0:00:45
      194000 -- (-827.451) (-827.634) (-831.635) [-828.674] * (-828.319) [-829.430] (-827.665) (-829.424) -- 0:00:49
      194500 -- (-830.737) (-827.389) [-830.978] (-830.874) * (-831.230) (-829.140) [-829.943] (-827.369) -- 0:00:49
      195000 -- (-829.890) (-830.313) (-827.482) [-832.473] * [-828.841] (-829.034) (-831.698) (-828.646) -- 0:00:49

      Average standard deviation of split frequencies: 0.016076

      195500 -- [-828.458] (-828.104) (-827.481) (-832.201) * (-828.240) [-830.247] (-834.368) (-827.702) -- 0:00:49
      196000 -- (-829.964) (-836.137) [-830.586] (-828.611) * (-830.169) (-829.418) [-827.666] (-830.050) -- 0:00:49
      196500 -- (-826.856) (-828.085) (-831.093) [-827.659] * (-834.295) (-829.651) [-827.563] (-826.993) -- 0:00:49
      197000 -- (-829.772) (-828.937) [-829.319] (-827.689) * (-830.646) [-829.967] (-827.568) (-827.584) -- 0:00:48
      197500 -- (-831.933) (-828.389) [-828.405] (-827.950) * [-829.882] (-829.424) (-830.176) (-828.162) -- 0:00:48
      198000 -- (-828.185) (-828.902) (-827.527) [-831.027] * (-830.109) [-827.748] (-830.323) (-828.321) -- 0:00:48
      198500 -- (-828.584) [-828.168] (-831.256) (-829.398) * [-830.189] (-827.328) (-827.429) (-830.757) -- 0:00:48
      199000 -- (-831.733) (-831.077) (-829.677) [-830.023] * [-832.357] (-829.177) (-829.389) (-829.042) -- 0:00:48
      199500 -- (-831.817) (-829.206) (-827.372) [-827.752] * (-829.851) (-829.472) [-830.253] (-828.223) -- 0:00:48
      200000 -- (-831.228) (-830.796) [-827.519] (-828.315) * [-831.128] (-828.112) (-828.075) (-830.458) -- 0:00:48

      Average standard deviation of split frequencies: 0.017358

      200500 -- (-828.562) [-827.103] (-827.800) (-827.784) * (-827.331) (-830.019) (-832.851) [-828.023] -- 0:00:47
      201000 -- [-827.257] (-828.088) (-828.691) (-829.694) * (-826.686) (-829.311) [-828.393] (-828.247) -- 0:00:47
      201500 -- (-827.258) (-828.238) (-829.034) [-828.191] * [-830.364] (-829.276) (-831.895) (-828.063) -- 0:00:47
      202000 -- (-830.458) (-828.675) (-829.313) [-827.420] * [-827.187] (-830.425) (-833.223) (-827.314) -- 0:00:47
      202500 -- (-831.488) (-828.899) [-829.211] (-828.135) * [-827.546] (-827.167) (-827.703) (-830.578) -- 0:00:47
      203000 -- (-827.663) [-828.465] (-829.380) (-828.425) * (-828.042) [-827.043] (-831.720) (-828.217) -- 0:00:47
      203500 -- (-828.516) (-828.661) [-827.283] (-827.989) * (-827.727) [-830.308] (-834.036) (-827.364) -- 0:00:46
      204000 -- (-827.843) [-828.748] (-828.895) (-827.155) * (-830.412) (-827.259) [-829.103] (-827.271) -- 0:00:46
      204500 -- (-828.913) (-828.670) [-827.120] (-828.056) * [-827.451] (-829.130) (-829.887) (-827.975) -- 0:00:46
      205000 -- [-828.693] (-828.691) (-826.954) (-829.572) * (-828.215) [-827.101] (-830.072) (-829.604) -- 0:00:46

      Average standard deviation of split frequencies: 0.016909

      205500 -- (-831.208) (-829.996) [-831.016] (-828.632) * (-827.754) (-827.939) [-827.907] (-830.515) -- 0:00:46
      206000 -- [-829.324] (-827.682) (-829.049) (-828.150) * (-830.707) (-829.066) [-827.719] (-830.450) -- 0:00:46
      206500 -- (-828.814) (-829.033) (-828.261) [-828.367] * (-828.372) (-828.187) [-828.052] (-827.888) -- 0:00:46
      207000 -- (-829.337) (-827.558) (-827.595) [-827.897] * [-827.758] (-835.173) (-827.373) (-828.339) -- 0:00:45
      207500 -- (-828.578) (-828.580) [-828.524] (-827.969) * (-829.354) (-830.860) [-828.310] (-827.859) -- 0:00:45
      208000 -- [-834.358] (-829.873) (-831.197) (-827.977) * (-829.964) (-829.496) [-827.665] (-832.223) -- 0:00:45
      208500 -- (-828.923) (-827.888) [-831.872] (-827.376) * [-827.385] (-828.588) (-830.770) (-827.707) -- 0:00:45
      209000 -- [-829.273] (-827.943) (-832.347) (-827.057) * (-828.934) [-831.593] (-828.862) (-827.522) -- 0:00:45
      209500 -- (-826.897) (-828.160) [-827.822] (-828.290) * (-830.884) (-829.868) [-829.296] (-829.655) -- 0:00:45
      210000 -- (-827.014) (-829.846) (-831.283) [-831.778] * (-830.565) [-829.211] (-829.518) (-831.532) -- 0:00:45

      Average standard deviation of split frequencies: 0.016534

      210500 -- (-841.144) [-831.991] (-828.275) (-831.384) * (-829.663) (-829.606) (-827.905) [-831.458] -- 0:00:48
      211000 -- (-829.890) (-833.863) [-827.523] (-827.131) * [-829.014] (-828.776) (-827.815) (-834.220) -- 0:00:48
      211500 -- (-831.895) (-830.170) [-827.767] (-828.317) * [-828.851] (-827.836) (-828.536) (-832.845) -- 0:00:48
      212000 -- [-828.252] (-829.956) (-829.020) (-827.607) * (-830.403) (-828.104) (-827.160) [-829.414] -- 0:00:48
      212500 -- (-830.342) (-829.559) [-827.263] (-827.491) * [-830.383] (-828.098) (-828.322) (-827.627) -- 0:00:48
      213000 -- [-833.111] (-828.104) (-827.886) (-827.465) * (-829.889) [-827.711] (-829.541) (-830.304) -- 0:00:48
      213500 -- (-832.127) (-826.876) (-827.890) [-827.963] * (-829.354) (-828.701) (-829.192) [-828.843] -- 0:00:47
      214000 -- (-828.745) [-826.830] (-829.187) (-828.823) * (-827.733) [-829.234] (-834.224) (-829.783) -- 0:00:47
      214500 -- (-830.809) [-829.309] (-837.107) (-832.575) * (-829.873) (-827.564) (-832.986) [-827.109] -- 0:00:47
      215000 -- [-834.570] (-833.071) (-829.606) (-831.935) * (-829.196) [-827.532] (-827.042) (-827.523) -- 0:00:47

      Average standard deviation of split frequencies: 0.016770

      215500 -- (-833.241) (-830.860) (-828.149) [-829.932] * (-828.451) [-827.067] (-827.624) (-827.589) -- 0:00:47
      216000 -- (-829.941) [-830.771] (-829.518) (-833.146) * (-827.194) (-836.175) [-827.783] (-826.805) -- 0:00:47
      216500 -- (-828.986) [-830.089] (-829.196) (-829.761) * (-827.652) (-828.380) [-828.954] (-827.311) -- 0:00:47
      217000 -- (-832.048) (-833.138) [-828.714] (-829.619) * [-830.963] (-828.421) (-827.706) (-827.658) -- 0:00:46
      217500 -- (-833.918) (-829.383) [-828.301] (-828.877) * (-828.801) (-828.562) [-829.125] (-827.416) -- 0:00:46
      218000 -- (-830.411) (-828.882) (-829.680) [-827.848] * (-829.911) (-828.834) (-827.688) [-828.361] -- 0:00:46
      218500 -- (-829.246) (-827.716) [-834.808] (-827.974) * (-827.483) [-828.829] (-830.663) (-831.927) -- 0:00:46
      219000 -- (-827.060) (-829.088) [-829.787] (-828.710) * (-827.814) (-830.221) (-830.832) [-827.151] -- 0:00:46
      219500 -- (-829.068) [-833.389] (-829.736) (-829.168) * (-829.016) [-828.506] (-831.276) (-827.524) -- 0:00:46
      220000 -- [-827.049] (-828.885) (-829.667) (-831.194) * (-831.027) [-830.120] (-827.944) (-827.440) -- 0:00:46

      Average standard deviation of split frequencies: 0.013942

      220500 -- (-827.958) [-829.439] (-830.429) (-828.309) * [-829.749] (-831.340) (-828.076) (-827.083) -- 0:00:45
      221000 -- (-835.452) (-829.963) (-828.194) [-827.917] * (-826.750) (-827.672) (-828.259) [-828.925] -- 0:00:45
      221500 -- (-830.527) (-830.286) [-828.353] (-828.235) * (-828.298) (-829.569) [-828.329] (-827.991) -- 0:00:45
      222000 -- (-829.874) (-829.531) (-827.148) [-830.754] * [-827.011] (-830.003) (-828.224) (-827.894) -- 0:00:45
      222500 -- (-831.418) (-827.529) [-826.984] (-830.958) * (-829.189) [-829.308] (-830.803) (-827.999) -- 0:00:45
      223000 -- [-828.660] (-827.816) (-827.369) (-828.081) * (-830.772) (-829.308) (-832.502) [-829.148] -- 0:00:45
      223500 -- (-828.540) [-828.388] (-828.861) (-831.354) * (-831.331) (-827.745) (-829.344) [-827.518] -- 0:00:45
      224000 -- (-831.377) (-830.912) (-828.340) [-827.159] * (-827.830) (-828.013) (-828.297) [-827.523] -- 0:00:45
      224500 -- [-827.585] (-827.962) (-829.855) (-830.222) * [-827.319] (-833.641) (-828.857) (-829.279) -- 0:00:44
      225000 -- (-828.035) [-828.010] (-826.741) (-828.792) * (-827.582) (-828.445) (-827.442) [-830.318] -- 0:00:44

      Average standard deviation of split frequencies: 0.016290

      225500 -- (-829.727) (-827.123) [-829.584] (-829.793) * (-830.431) (-828.774) [-827.075] (-827.305) -- 0:00:44
      226000 -- (-832.139) (-827.771) (-832.986) [-829.654] * (-829.092) (-828.615) (-829.281) [-827.819] -- 0:00:44
      226500 -- (-829.818) (-830.157) (-831.090) [-827.855] * [-828.421] (-828.093) (-830.867) (-828.533) -- 0:00:44
      227000 -- [-828.868] (-827.140) (-829.625) (-828.356) * (-827.432) (-828.998) (-831.083) [-831.821] -- 0:00:47
      227500 -- [-830.947] (-828.945) (-829.703) (-827.020) * (-828.770) [-827.444] (-831.613) (-827.739) -- 0:00:47
      228000 -- (-830.177) (-831.344) (-827.369) [-828.615] * [-829.173] (-827.117) (-827.558) (-832.589) -- 0:00:47
      228500 -- (-831.362) [-829.471] (-829.715) (-830.021) * (-829.436) [-832.365] (-828.366) (-834.717) -- 0:00:47
      229000 -- (-831.042) [-829.341] (-830.318) (-829.750) * (-829.349) (-829.532) (-833.852) [-831.051] -- 0:00:47
      229500 -- (-828.862) (-828.375) [-829.284] (-829.559) * [-828.283] (-830.914) (-828.061) (-833.138) -- 0:00:47
      230000 -- (-829.476) [-829.467] (-831.104) (-827.083) * (-829.328) (-828.428) (-827.557) [-829.450] -- 0:00:46

      Average standard deviation of split frequencies: 0.014521

      230500 -- (-830.604) (-827.294) (-828.981) [-827.597] * (-828.712) (-830.698) (-826.860) [-830.551] -- 0:00:46
      231000 -- (-829.868) (-831.660) (-829.078) [-827.619] * [-827.933] (-829.619) (-830.379) (-827.129) -- 0:00:46
      231500 -- (-829.256) (-828.717) (-829.265) [-828.149] * [-829.095] (-831.979) (-830.017) (-826.943) -- 0:00:46
      232000 -- [-827.158] (-827.622) (-829.342) (-827.491) * (-829.818) (-834.489) (-828.741) [-827.857] -- 0:00:46
      232500 -- (-831.306) (-826.902) [-830.573] (-827.710) * [-830.583] (-830.355) (-829.482) (-828.312) -- 0:00:46
      233000 -- (-829.325) [-827.522] (-830.796) (-829.713) * [-828.862] (-830.519) (-831.075) (-827.057) -- 0:00:46
      233500 -- (-829.429) [-829.263] (-831.935) (-831.361) * (-827.929) (-829.123) (-830.763) [-829.109] -- 0:00:45
      234000 -- [-829.437] (-828.119) (-829.592) (-829.058) * (-827.778) [-831.677] (-827.772) (-829.555) -- 0:00:45
      234500 -- (-829.636) [-828.499] (-830.036) (-828.175) * (-827.428) [-828.524] (-829.165) (-828.448) -- 0:00:45
      235000 -- (-829.721) [-831.382] (-830.370) (-828.061) * (-827.326) (-828.268) [-829.871] (-829.536) -- 0:00:45

      Average standard deviation of split frequencies: 0.012931

      235500 -- (-832.083) (-828.403) (-830.347) [-828.380] * [-828.520] (-827.885) (-827.860) (-828.680) -- 0:00:45
      236000 -- (-828.680) [-827.175] (-830.863) (-827.952) * (-832.365) [-834.907] (-827.703) (-830.553) -- 0:00:45
      236500 -- (-829.290) [-828.437] (-827.118) (-828.381) * (-833.206) (-827.714) (-828.844) [-828.015] -- 0:00:45
      237000 -- [-831.288] (-828.579) (-827.039) (-830.530) * (-827.214) (-828.388) (-830.750) [-831.687] -- 0:00:45
      237500 -- (-828.086) (-828.607) (-827.969) [-827.805] * (-827.564) (-828.384) (-829.603) [-828.862] -- 0:00:44
      238000 -- (-827.749) (-832.434) (-831.817) [-828.662] * (-827.553) (-828.699) (-828.868) [-828.163] -- 0:00:44
      238500 -- (-828.056) [-826.707] (-827.309) (-828.568) * (-828.218) (-830.157) (-828.423) [-827.160] -- 0:00:44
      239000 -- [-829.953] (-831.435) (-827.937) (-829.282) * [-828.737] (-830.572) (-828.348) (-833.083) -- 0:00:44
      239500 -- (-828.341) [-830.110] (-829.746) (-829.216) * (-828.343) (-828.018) [-828.831] (-829.741) -- 0:00:44
      240000 -- (-828.827) (-827.587) [-830.435] (-827.195) * (-828.281) [-827.322] (-827.394) (-830.297) -- 0:00:44

      Average standard deviation of split frequencies: 0.012949

      240500 -- [-830.119] (-829.120) (-827.620) (-829.434) * (-828.021) [-828.676] (-826.926) (-828.394) -- 0:00:44
      241000 -- (-830.221) [-827.833] (-829.671) (-827.263) * (-831.433) [-830.878] (-827.910) (-828.235) -- 0:00:44
      241500 -- (-829.732) [-828.462] (-829.151) (-827.846) * (-828.741) (-831.933) (-828.838) [-831.129] -- 0:00:43
      242000 -- (-828.939) (-827.680) (-830.437) [-834.203] * (-829.079) (-833.059) [-832.496] (-828.863) -- 0:00:43
      242500 -- [-830.536] (-828.715) (-830.197) (-829.293) * (-828.449) (-827.680) (-835.331) [-830.503] -- 0:00:43
      243000 -- (-831.951) [-830.199] (-835.700) (-831.327) * (-831.101) [-829.692] (-830.808) (-832.049) -- 0:00:43
      243500 -- (-830.095) (-831.410) (-830.537) [-830.404] * [-827.907] (-828.611) (-829.674) (-833.571) -- 0:00:46
      244000 -- (-830.856) (-831.765) [-828.024] (-829.768) * (-833.845) (-828.798) (-827.193) [-828.192] -- 0:00:46
      244500 -- (-828.557) (-830.431) (-827.506) [-827.631] * (-828.035) (-830.815) [-829.222] (-828.655) -- 0:00:46
      245000 -- [-832.365] (-829.816) (-827.265) (-830.000) * (-828.029) (-833.092) [-828.298] (-829.423) -- 0:00:46

      Average standard deviation of split frequencies: 0.012839

      245500 -- (-830.400) [-828.739] (-828.410) (-828.687) * [-830.347] (-828.771) (-830.083) (-831.813) -- 0:00:46
      246000 -- (-835.148) [-828.499] (-827.721) (-829.713) * (-828.468) (-834.887) [-828.697] (-829.258) -- 0:00:45
      246500 -- [-829.707] (-829.871) (-828.357) (-831.836) * (-830.288) (-831.565) [-829.076] (-827.111) -- 0:00:45
      247000 -- (-828.837) (-830.141) [-830.989] (-828.696) * [-831.038] (-828.766) (-827.583) (-827.496) -- 0:00:45
      247500 -- [-831.109] (-829.818) (-828.811) (-827.706) * [-830.967] (-826.801) (-829.390) (-828.265) -- 0:00:45
      248000 -- (-830.138) (-830.128) (-832.925) [-828.215] * (-829.615) (-827.818) [-830.119] (-835.949) -- 0:00:45
      248500 -- (-828.108) (-828.780) (-828.002) [-828.114] * (-830.806) [-827.065] (-830.573) (-829.858) -- 0:00:45
      249000 -- (-827.886) [-830.677] (-828.722) (-827.929) * (-826.858) (-826.912) [-830.097] (-830.951) -- 0:00:45
      249500 -- [-827.714] (-830.251) (-828.053) (-827.112) * [-827.840] (-826.972) (-827.520) (-831.644) -- 0:00:45
      250000 -- (-828.708) (-829.383) (-827.984) [-827.466] * (-832.433) (-831.799) [-828.959] (-831.215) -- 0:00:45

      Average standard deviation of split frequencies: 0.014946

      250500 -- (-828.891) [-829.058] (-828.676) (-827.317) * (-829.258) [-827.454] (-830.378) (-833.128) -- 0:00:44
      251000 -- (-832.330) (-828.298) [-829.570] (-827.724) * [-827.542] (-832.410) (-834.727) (-831.364) -- 0:00:44
      251500 -- (-829.167) (-829.028) (-830.167) [-829.481] * [-829.134] (-829.639) (-827.461) (-829.325) -- 0:00:44
      252000 -- [-827.511] (-830.141) (-831.277) (-828.073) * [-827.797] (-835.296) (-830.471) (-827.104) -- 0:00:44
      252500 -- [-831.435] (-832.133) (-828.191) (-827.776) * [-831.558] (-828.725) (-830.153) (-827.918) -- 0:00:44
      253000 -- (-827.859) (-830.084) [-830.046] (-828.209) * [-828.065] (-831.692) (-827.452) (-827.183) -- 0:00:44
      253500 -- (-830.439) [-831.475] (-830.523) (-829.327) * (-830.750) (-830.152) [-830.133] (-829.127) -- 0:00:44
      254000 -- [-832.563] (-832.845) (-828.384) (-829.310) * (-831.334) (-829.235) [-831.579] (-833.404) -- 0:00:44
      254500 -- [-828.334] (-829.854) (-830.425) (-830.142) * [-828.184] (-831.631) (-833.987) (-832.754) -- 0:00:43
      255000 -- [-827.771] (-829.582) (-830.392) (-828.393) * (-828.476) [-828.070] (-832.854) (-828.278) -- 0:00:43

      Average standard deviation of split frequencies: 0.014834

      255500 -- (-831.616) (-828.774) [-826.952] (-827.110) * (-830.226) (-827.063) (-829.662) [-828.509] -- 0:00:43
      256000 -- (-830.036) (-829.453) [-829.026] (-830.981) * (-827.338) [-827.713] (-828.360) (-828.908) -- 0:00:43
      256500 -- (-831.102) (-829.602) (-828.131) [-828.571] * (-827.963) [-827.437] (-827.812) (-827.902) -- 0:00:43
      257000 -- (-832.654) [-832.364] (-826.675) (-828.579) * (-828.641) (-827.220) [-828.196] (-828.147) -- 0:00:43
      257500 -- (-829.334) [-831.552] (-827.604) (-828.632) * (-829.900) [-828.958] (-829.906) (-831.623) -- 0:00:43
      258000 -- (-833.158) (-832.741) (-827.223) [-828.946] * (-832.821) (-827.656) (-829.236) [-828.857] -- 0:00:43
      258500 -- (-828.677) (-826.763) [-831.184] (-829.622) * [-827.464] (-830.087) (-827.499) (-829.627) -- 0:00:43
      259000 -- [-828.383] (-828.126) (-828.840) (-829.823) * [-827.481] (-828.158) (-828.830) (-829.993) -- 0:00:42
      259500 -- (-828.777) [-832.779] (-830.609) (-828.840) * [-830.531] (-831.371) (-831.351) (-828.513) -- 0:00:42
      260000 -- [-829.236] (-828.461) (-827.645) (-828.419) * (-827.667) (-829.708) [-831.925] (-827.711) -- 0:00:42

      Average standard deviation of split frequencies: 0.015638

      260500 -- [-826.657] (-828.774) (-828.046) (-829.629) * (-831.042) [-828.494] (-829.955) (-828.319) -- 0:00:45
      261000 -- [-828.948] (-833.012) (-827.610) (-827.966) * (-832.506) [-828.128] (-829.522) (-829.986) -- 0:00:45
      261500 -- (-832.419) (-831.368) [-828.603] (-827.481) * [-828.508] (-827.642) (-827.438) (-838.620) -- 0:00:45
      262000 -- (-831.422) (-827.282) [-827.015] (-832.925) * (-828.891) (-830.491) [-829.166] (-836.651) -- 0:00:45
      262500 -- [-828.023] (-828.590) (-831.075) (-828.991) * [-828.685] (-828.851) (-830.204) (-830.449) -- 0:00:44
      263000 -- (-828.712) [-827.080] (-830.913) (-829.718) * [-828.435] (-829.462) (-831.045) (-828.723) -- 0:00:44
      263500 -- (-827.299) [-826.723] (-830.646) (-831.426) * (-829.712) (-827.158) [-829.694] (-828.558) -- 0:00:44
      264000 -- (-827.581) [-832.807] (-829.446) (-829.695) * (-828.604) (-828.376) [-831.997] (-830.195) -- 0:00:44
      264500 -- (-828.712) (-830.397) [-827.727] (-830.447) * (-832.258) (-827.491) (-827.150) [-828.394] -- 0:00:44
      265000 -- [-828.667] (-832.495) (-829.570) (-828.976) * (-829.522) (-829.669) [-827.778] (-828.437) -- 0:00:44

      Average standard deviation of split frequencies: 0.015359

      265500 -- [-829.390] (-829.575) (-829.535) (-827.654) * (-829.044) (-830.013) (-829.711) [-827.293] -- 0:00:44
      266000 -- (-830.614) (-828.246) [-827.152] (-827.990) * (-830.099) (-832.138) [-828.419] (-827.657) -- 0:00:44
      266500 -- (-829.968) [-831.211] (-829.062) (-831.105) * [-830.043] (-828.705) (-832.092) (-827.664) -- 0:00:44
      267000 -- (-827.856) [-829.076] (-826.917) (-832.374) * (-829.117) [-828.268] (-827.987) (-826.801) -- 0:00:43
      267500 -- (-829.163) (-831.245) [-827.201] (-830.769) * [-827.421] (-833.348) (-828.064) (-827.708) -- 0:00:43
      268000 -- [-829.959] (-830.895) (-830.826) (-828.374) * (-828.512) [-833.248] (-827.562) (-828.035) -- 0:00:43
      268500 -- (-828.100) (-831.666) (-830.336) [-828.798] * [-828.647] (-831.835) (-827.896) (-828.156) -- 0:00:43
      269000 -- (-827.044) (-833.745) (-829.574) [-827.431] * (-828.729) [-830.883] (-828.869) (-827.685) -- 0:00:43
      269500 -- (-829.534) [-829.539] (-831.054) (-829.531) * [-829.908] (-828.189) (-829.669) (-828.181) -- 0:00:43
      270000 -- (-832.761) (-827.807) [-830.736] (-829.703) * [-827.940] (-827.730) (-833.071) (-828.609) -- 0:00:43

      Average standard deviation of split frequencies: 0.015216

      270500 -- (-833.083) (-827.150) [-829.142] (-829.430) * (-827.750) (-828.527) (-838.213) [-827.235] -- 0:00:43
      271000 -- (-831.344) [-826.834] (-829.282) (-829.024) * (-827.292) (-828.026) [-841.169] (-826.653) -- 0:00:43
      271500 -- (-831.866) (-828.108) [-831.483] (-827.334) * (-827.866) [-827.763] (-833.792) (-834.482) -- 0:00:42
      272000 -- [-828.616] (-827.786) (-829.064) (-829.099) * (-829.122) (-828.575) (-830.673) [-828.916] -- 0:00:42
      272500 -- (-828.680) [-827.061] (-827.992) (-827.672) * (-827.564) (-828.274) [-830.892] (-828.113) -- 0:00:42
      273000 -- (-831.385) (-828.038) (-830.783) [-827.103] * (-832.871) (-827.425) [-831.530] (-827.427) -- 0:00:42
      273500 -- (-829.737) (-828.060) (-829.605) [-828.393] * [-830.916] (-827.843) (-832.030) (-827.329) -- 0:00:42
      274000 -- [-827.857] (-828.082) (-830.191) (-828.358) * (-827.734) (-829.317) [-829.927] (-830.394) -- 0:00:42
      274500 -- (-829.140) (-827.960) (-827.716) [-829.298] * [-827.907] (-829.614) (-834.365) (-828.478) -- 0:00:42
      275000 -- (-828.785) [-828.210] (-828.986) (-827.792) * [-829.144] (-829.513) (-828.394) (-832.005) -- 0:00:42

      Average standard deviation of split frequencies: 0.014743

      275500 -- (-827.950) (-828.733) [-826.973] (-828.978) * (-827.637) (-828.017) [-829.443] (-828.463) -- 0:00:42
      276000 -- (-829.333) [-828.799] (-828.831) (-828.690) * (-832.285) (-827.655) [-830.248] (-828.506) -- 0:00:41
      276500 -- [-830.349] (-831.326) (-833.014) (-829.376) * (-828.720) (-828.482) (-831.005) [-828.811] -- 0:00:41
      277000 -- [-827.825] (-827.837) (-832.764) (-828.453) * (-830.324) (-829.132) (-828.087) [-828.865] -- 0:00:44
      277500 -- (-830.748) [-827.885] (-826.967) (-832.979) * (-828.674) [-828.178] (-828.604) (-831.218) -- 0:00:44
      278000 -- [-827.356] (-828.345) (-826.781) (-828.224) * (-827.765) [-830.063] (-830.119) (-830.754) -- 0:00:44
      278500 -- (-827.472) (-832.287) (-829.747) [-831.357] * (-830.485) (-830.622) [-828.838] (-832.723) -- 0:00:44
      279000 -- [-828.215] (-830.616) (-827.327) (-828.764) * (-827.078) (-829.165) (-828.475) [-831.372] -- 0:00:43
      279500 -- [-828.220] (-832.119) (-828.286) (-828.698) * [-829.751] (-828.291) (-828.032) (-831.293) -- 0:00:43
      280000 -- (-827.338) (-832.915) (-829.057) [-828.090] * (-828.319) [-827.451] (-829.896) (-832.066) -- 0:00:43

      Average standard deviation of split frequencies: 0.014025

      280500 -- (-828.739) (-832.906) [-827.780] (-827.115) * (-827.712) [-827.918] (-827.224) (-830.249) -- 0:00:43
      281000 -- (-830.038) (-829.086) [-827.082] (-828.047) * (-829.286) [-831.265] (-827.695) (-831.141) -- 0:00:43
      281500 -- (-829.569) (-828.070) (-828.891) [-828.531] * (-833.950) (-831.278) [-827.991] (-829.198) -- 0:00:43
      282000 -- (-828.230) (-828.759) [-830.159] (-831.209) * [-827.435] (-831.225) (-830.823) (-831.167) -- 0:00:43
      282500 -- (-828.591) [-829.115] (-831.516) (-832.109) * (-829.312) [-827.789] (-829.561) (-828.481) -- 0:00:43
      283000 -- (-828.383) (-830.014) [-828.098] (-828.395) * (-827.991) (-832.818) [-827.252] (-829.520) -- 0:00:43
      283500 -- (-828.024) (-831.520) [-830.516] (-827.710) * [-828.516] (-827.805) (-829.667) (-831.983) -- 0:00:42
      284000 -- (-827.387) [-827.516] (-827.811) (-827.230) * (-830.017) [-827.186] (-828.215) (-828.924) -- 0:00:42
      284500 -- [-826.689] (-827.461) (-830.944) (-827.649) * (-828.282) [-830.377] (-835.927) (-828.083) -- 0:00:42
      285000 -- [-827.686] (-831.267) (-828.801) (-828.631) * (-829.054) (-836.616) (-828.314) [-830.900] -- 0:00:42

      Average standard deviation of split frequencies: 0.014258

      285500 -- (-827.442) (-834.714) (-828.293) [-827.439] * (-828.190) (-838.116) [-828.973] (-830.201) -- 0:00:42
      286000 -- (-828.760) [-828.626] (-827.613) (-829.840) * [-828.522] (-831.337) (-832.589) (-831.377) -- 0:00:42
      286500 -- [-827.270] (-829.583) (-832.214) (-828.997) * (-828.353) (-827.186) [-830.081] (-829.724) -- 0:00:42
      287000 -- [-828.648] (-829.241) (-833.869) (-828.055) * (-828.244) (-828.312) (-828.540) [-827.754] -- 0:00:42
      287500 -- [-831.316] (-832.784) (-832.250) (-828.392) * (-829.612) (-828.775) (-828.698) [-827.918] -- 0:00:42
      288000 -- [-828.224] (-829.614) (-828.312) (-827.561) * (-828.590) (-830.286) [-827.808] (-828.742) -- 0:00:42
      288500 -- (-829.214) (-827.077) [-829.801] (-828.596) * (-829.766) (-829.351) [-832.095] (-828.128) -- 0:00:41
      289000 -- (-829.253) [-828.299] (-832.595) (-828.025) * (-830.304) [-829.210] (-829.896) (-827.875) -- 0:00:41
      289500 -- (-829.997) [-827.100] (-828.711) (-826.890) * (-831.941) [-830.158] (-828.820) (-830.408) -- 0:00:41
      290000 -- (-828.046) (-828.469) [-828.981] (-827.758) * (-831.198) (-831.795) (-826.899) [-828.974] -- 0:00:41

      Average standard deviation of split frequencies: 0.013137

      290500 -- (-827.550) (-830.360) (-828.654) [-827.667] * (-831.129) (-836.923) [-827.613] (-829.762) -- 0:00:41
      291000 -- (-828.473) [-828.829] (-831.256) (-828.858) * (-830.510) (-831.419) [-827.639] (-826.968) -- 0:00:41
      291500 -- (-830.756) [-828.744] (-830.065) (-827.324) * [-827.385] (-831.389) (-830.718) (-830.133) -- 0:00:41
      292000 -- (-827.972) (-830.341) (-829.716) [-828.090] * [-828.461] (-831.074) (-828.987) (-828.976) -- 0:00:41
      292500 -- (-828.764) (-827.181) (-826.964) [-829.348] * (-830.344) (-834.918) (-829.596) [-826.983] -- 0:00:41
      293000 -- (-827.301) [-827.223] (-827.437) (-828.383) * (-830.693) (-831.923) (-828.201) [-827.942] -- 0:00:41
      293500 -- [-832.054] (-828.307) (-831.835) (-828.333) * (-830.153) [-827.978] (-829.903) (-831.613) -- 0:00:43
      294000 -- (-827.716) [-830.250] (-828.821) (-829.570) * [-828.392] (-830.226) (-830.199) (-832.408) -- 0:00:43
      294500 -- [-829.254] (-827.877) (-830.031) (-835.932) * (-828.662) [-831.413] (-828.663) (-829.315) -- 0:00:43
      295000 -- (-828.714) [-829.044] (-827.231) (-829.767) * (-828.897) [-828.791] (-827.272) (-827.504) -- 0:00:43

      Average standard deviation of split frequencies: 0.013095

      295500 -- [-828.358] (-829.272) (-828.297) (-829.826) * (-828.719) (-827.617) [-830.217] (-830.532) -- 0:00:42
      296000 -- (-827.610) (-828.799) (-830.137) [-827.857] * (-827.943) [-835.277] (-830.329) (-834.271) -- 0:00:42
      296500 -- (-826.957) (-829.872) (-833.291) [-826.878] * (-827.647) (-829.282) [-828.189] (-827.923) -- 0:00:42
      297000 -- (-831.821) [-828.330] (-830.741) (-834.204) * (-829.085) (-831.211) (-828.606) [-830.034] -- 0:00:42
      297500 -- (-833.788) (-831.898) [-827.982] (-829.972) * [-828.443] (-829.313) (-830.392) (-833.468) -- 0:00:42
      298000 -- (-833.120) (-831.509) [-827.160] (-830.513) * [-831.535] (-829.610) (-831.256) (-830.350) -- 0:00:42
      298500 -- (-828.852) [-828.862] (-836.124) (-829.282) * [-827.653] (-828.162) (-829.243) (-830.093) -- 0:00:42
      299000 -- [-829.868] (-827.985) (-831.789) (-827.752) * [-831.066] (-827.204) (-828.786) (-831.686) -- 0:00:42
      299500 -- (-829.500) [-827.466] (-828.891) (-828.625) * (-827.688) (-827.357) (-829.269) [-833.066] -- 0:00:42
      300000 -- (-830.260) (-826.948) [-829.458] (-829.163) * (-830.385) (-827.335) (-829.908) [-829.623] -- 0:00:42

      Average standard deviation of split frequencies: 0.013588

      300500 -- (-829.800) (-827.641) (-829.729) [-828.825] * (-832.917) (-828.820) [-832.028] (-827.538) -- 0:00:41
      301000 -- (-828.492) (-829.130) [-828.835] (-829.379) * (-831.172) [-830.949] (-828.925) (-828.328) -- 0:00:41
      301500 -- [-833.337] (-829.632) (-828.500) (-833.676) * [-828.556] (-830.892) (-829.133) (-830.982) -- 0:00:41
      302000 -- (-832.050) (-828.365) [-828.609] (-828.578) * [-828.445] (-828.571) (-828.757) (-827.985) -- 0:00:41
      302500 -- (-831.091) (-829.335) (-829.554) [-829.967] * [-828.316] (-833.357) (-827.376) (-827.644) -- 0:00:41
      303000 -- (-831.458) [-830.391] (-828.942) (-830.305) * (-829.513) (-832.352) (-829.041) [-827.602] -- 0:00:41
      303500 -- (-828.538) (-831.344) [-827.560] (-829.388) * (-829.469) (-828.748) [-828.870] (-831.155) -- 0:00:41
      304000 -- (-829.039) [-832.591] (-828.151) (-829.968) * [-830.551] (-828.441) (-829.225) (-828.664) -- 0:00:41
      304500 -- (-830.179) [-831.552] (-831.677) (-831.040) * (-828.353) (-827.836) [-827.838] (-829.068) -- 0:00:41
      305000 -- (-829.800) (-827.799) [-830.601] (-828.614) * (-830.084) [-828.051] (-832.073) (-828.184) -- 0:00:41

      Average standard deviation of split frequencies: 0.013403

      305500 -- (-829.807) (-829.324) [-830.530] (-827.513) * (-831.719) (-829.547) [-830.861] (-831.592) -- 0:00:40
      306000 -- (-827.651) [-829.466] (-828.909) (-830.917) * [-830.877] (-830.731) (-831.945) (-829.079) -- 0:00:40
      306500 -- [-828.281] (-832.074) (-829.540) (-829.708) * [-829.631] (-827.692) (-829.551) (-829.879) -- 0:00:40
      307000 -- (-826.887) (-831.228) (-828.243) [-830.870] * [-831.855] (-827.250) (-828.400) (-831.092) -- 0:00:40
      307500 -- (-828.877) [-827.801] (-831.262) (-832.389) * [-828.409] (-829.000) (-827.808) (-827.700) -- 0:00:40
      308000 -- (-830.233) (-830.023) (-828.145) [-828.695] * (-828.972) [-827.636] (-828.823) (-828.420) -- 0:00:40
      308500 -- (-830.521) (-828.691) (-831.084) [-827.597] * [-827.647] (-827.606) (-830.807) (-831.395) -- 0:00:40
      309000 -- (-830.108) [-831.078] (-831.043) (-827.151) * (-828.402) [-827.432] (-832.714) (-829.688) -- 0:00:40
      309500 -- [-828.174] (-830.335) (-832.168) (-828.737) * [-828.900] (-836.006) (-830.578) (-827.788) -- 0:00:40
      310000 -- (-829.690) (-830.192) (-833.835) [-828.723] * [-828.933] (-828.208) (-827.763) (-828.596) -- 0:00:42

      Average standard deviation of split frequencies: 0.013337

      310500 -- (-829.570) (-828.488) [-829.303] (-828.822) * (-829.698) (-832.434) [-829.453] (-830.367) -- 0:00:42
      311000 -- (-828.301) [-827.507] (-829.927) (-829.492) * (-826.965) (-829.388) [-830.117] (-835.019) -- 0:00:42
      311500 -- (-827.640) [-828.478] (-832.755) (-827.640) * (-828.246) [-827.112] (-830.751) (-831.322) -- 0:00:41
      312000 -- (-827.199) [-830.581] (-828.259) (-831.612) * [-827.458] (-827.823) (-830.363) (-830.704) -- 0:00:41
      312500 -- [-827.571] (-828.172) (-830.015) (-827.972) * (-829.078) (-828.047) (-831.592) [-828.718] -- 0:00:41
      313000 -- [-829.155] (-828.485) (-830.676) (-829.153) * (-829.909) (-827.839) [-828.059] (-828.880) -- 0:00:41
      313500 -- [-832.408] (-827.676) (-827.818) (-830.095) * (-833.211) (-831.142) (-830.445) [-829.905] -- 0:00:41
      314000 -- [-828.920] (-827.403) (-827.710) (-827.580) * [-832.429] (-829.183) (-829.319) (-828.673) -- 0:00:41
      314500 -- (-827.018) [-827.600] (-828.150) (-828.255) * (-838.866) [-828.154] (-827.913) (-828.434) -- 0:00:41
      315000 -- (-827.188) (-828.194) (-829.939) [-827.729] * (-834.938) (-827.288) (-827.561) [-828.830] -- 0:00:41

      Average standard deviation of split frequencies: 0.013505

      315500 -- (-828.426) (-831.277) [-829.056] (-828.537) * (-831.053) (-829.338) (-827.893) [-830.886] -- 0:00:41
      316000 -- (-829.364) [-829.627] (-829.282) (-828.213) * (-827.582) [-828.457] (-829.102) (-828.041) -- 0:00:41
      316500 -- [-831.921] (-829.875) (-827.393) (-828.416) * (-827.760) (-830.915) [-830.971] (-831.199) -- 0:00:41
      317000 -- (-830.383) (-828.087) [-828.576] (-828.299) * (-828.088) [-829.633] (-829.281) (-835.394) -- 0:00:40
      317500 -- (-829.797) (-828.623) (-827.491) [-827.995] * (-830.236) [-828.124] (-829.323) (-829.901) -- 0:00:40
      318000 -- (-830.955) [-827.987] (-830.663) (-827.562) * (-829.259) (-826.822) (-829.538) [-830.065] -- 0:00:40
      318500 -- (-828.164) [-829.860] (-829.252) (-830.087) * (-839.287) [-827.966] (-828.344) (-828.293) -- 0:00:40
      319000 -- [-827.531] (-829.941) (-830.657) (-830.578) * (-831.429) (-826.738) (-828.480) [-829.080] -- 0:00:40
      319500 -- (-829.641) [-830.357] (-831.487) (-827.238) * (-829.691) (-831.603) (-829.781) [-827.926] -- 0:00:40
      320000 -- [-828.159] (-827.674) (-831.902) (-828.491) * (-827.472) (-829.650) [-830.292] (-829.568) -- 0:00:40

      Average standard deviation of split frequencies: 0.012414

      320500 -- (-826.983) (-829.312) (-829.174) [-831.868] * [-826.797] (-829.390) (-830.010) (-828.808) -- 0:00:40
      321000 -- (-831.255) (-830.063) [-828.028] (-831.882) * (-827.280) (-827.058) [-827.386] (-828.585) -- 0:00:40
      321500 -- (-836.236) [-828.617] (-828.088) (-829.781) * (-830.753) [-827.866] (-827.743) (-830.772) -- 0:00:40
      322000 -- (-830.108) [-830.586] (-830.312) (-831.118) * (-826.632) [-830.096] (-827.767) (-830.845) -- 0:00:40
      322500 -- (-834.028) (-828.746) [-831.418] (-832.089) * (-826.688) (-831.223) [-827.931] (-832.880) -- 0:00:39
      323000 -- [-830.873] (-827.905) (-828.431) (-830.491) * [-828.870] (-827.189) (-829.864) (-831.780) -- 0:00:39
      323500 -- [-828.657] (-827.608) (-828.520) (-831.511) * (-832.954) (-832.067) (-831.218) [-834.053] -- 0:00:39
      324000 -- (-833.851) (-828.489) [-831.362] (-828.971) * (-830.816) (-827.348) (-829.513) [-831.897] -- 0:00:39
      324500 -- [-827.480] (-830.441) (-829.714) (-829.700) * (-827.893) (-828.814) [-832.544] (-827.746) -- 0:00:39
      325000 -- (-828.000) (-828.764) [-831.312] (-827.703) * [-832.093] (-830.519) (-831.770) (-828.733) -- 0:00:39

      Average standard deviation of split frequencies: 0.012025

      325500 -- (-829.696) (-831.802) (-831.049) [-828.212] * (-830.501) (-830.106) [-827.443] (-830.106) -- 0:00:39
      326000 -- [-829.600] (-830.645) (-831.923) (-828.819) * (-828.296) (-829.789) (-827.500) [-828.569] -- 0:00:39
      326500 -- [-827.685] (-827.081) (-830.793) (-827.621) * [-828.287] (-827.748) (-827.719) (-836.741) -- 0:00:41
      327000 -- (-829.019) (-826.807) (-828.919) [-826.900] * (-830.655) [-827.504] (-827.826) (-828.909) -- 0:00:41
      327500 -- (-833.047) (-828.323) (-826.901) [-826.888] * [-827.172] (-831.453) (-827.743) (-828.976) -- 0:00:41
      328000 -- (-829.228) (-827.063) [-827.132] (-828.650) * [-828.976] (-828.509) (-829.664) (-828.875) -- 0:00:40
      328500 -- [-829.596] (-828.387) (-832.378) (-829.348) * (-829.410) (-827.777) (-829.501) [-829.641] -- 0:00:40
      329000 -- (-834.738) (-829.425) [-828.549] (-827.417) * (-831.448) [-833.232] (-828.551) (-829.286) -- 0:00:40
      329500 -- (-829.020) (-830.079) (-827.996) [-830.432] * [-827.692] (-829.715) (-829.901) (-832.307) -- 0:00:40
      330000 -- (-827.995) (-828.880) (-826.850) [-828.840] * (-829.013) [-830.869] (-829.085) (-828.655) -- 0:00:40

      Average standard deviation of split frequencies: 0.012672

      330500 -- (-828.777) (-828.862) (-827.257) [-829.856] * (-828.561) [-828.162] (-829.419) (-828.950) -- 0:00:40
      331000 -- (-828.483) [-828.457] (-827.643) (-831.472) * (-829.751) [-831.016] (-835.669) (-831.869) -- 0:00:40
      331500 -- [-827.956] (-829.077) (-828.728) (-829.754) * (-829.480) (-833.465) (-829.267) [-829.645] -- 0:00:40
      332000 -- [-828.118] (-830.369) (-831.080) (-827.578) * (-830.319) (-828.049) (-832.288) [-830.990] -- 0:00:40
      332500 -- [-828.186] (-828.974) (-830.419) (-828.667) * (-828.990) (-832.077) (-828.482) [-832.101] -- 0:00:40
      333000 -- (-829.057) (-828.360) (-830.392) [-832.333] * (-828.062) (-830.361) (-829.893) [-831.078] -- 0:00:40
      333500 -- (-828.734) [-829.717] (-827.914) (-829.347) * (-831.279) [-828.297] (-828.824) (-830.684) -- 0:00:39
      334000 -- (-828.365) (-834.392) [-828.457] (-829.202) * (-828.694) (-829.959) (-827.079) [-830.092] -- 0:00:39
      334500 -- (-828.199) [-829.317] (-829.396) (-830.727) * (-828.986) (-831.699) [-827.924] (-830.592) -- 0:00:39
      335000 -- (-831.817) (-829.760) (-828.243) [-827.493] * (-828.370) (-831.950) (-827.490) [-834.585] -- 0:00:39

      Average standard deviation of split frequencies: 0.012393

      335500 -- [-827.842] (-829.258) (-827.613) (-830.927) * (-831.869) (-831.277) [-827.909] (-829.995) -- 0:00:39
      336000 -- (-827.047) (-828.221) [-827.353] (-828.531) * (-831.129) (-834.488) [-827.591] (-828.991) -- 0:00:39
      336500 -- (-828.034) (-831.762) (-827.282) [-830.126] * (-828.342) [-827.501] (-829.586) (-830.683) -- 0:00:39
      337000 -- (-828.953) (-827.477) (-827.094) [-831.446] * (-827.328) [-827.341] (-826.880) (-833.162) -- 0:00:39
      337500 -- [-827.545] (-830.063) (-827.634) (-829.335) * (-827.594) [-829.839] (-828.896) (-830.324) -- 0:00:39
      338000 -- (-832.719) [-827.931] (-828.830) (-832.229) * [-829.142] (-832.048) (-830.181) (-831.041) -- 0:00:39
      338500 -- (-828.212) [-830.097] (-831.154) (-828.016) * (-828.809) (-829.596) (-827.916) [-829.849] -- 0:00:39
      339000 -- (-830.611) [-830.443] (-829.555) (-831.864) * [-827.150] (-828.818) (-827.207) (-830.175) -- 0:00:38
      339500 -- [-827.277] (-830.201) (-829.287) (-828.050) * (-830.098) [-828.277] (-828.200) (-828.047) -- 0:00:38
      340000 -- (-829.124) (-829.274) (-827.862) [-828.315] * (-832.142) (-828.540) [-828.782] (-827.636) -- 0:00:38

      Average standard deviation of split frequencies: 0.012070

      340500 -- [-830.016] (-827.196) (-827.761) (-828.652) * (-831.450) (-827.981) [-826.993] (-827.641) -- 0:00:38
      341000 -- (-834.190) (-828.012) [-828.058] (-827.702) * (-830.221) (-830.941) (-828.439) [-829.059] -- 0:00:38
      341500 -- (-833.344) [-829.453] (-827.837) (-827.851) * (-828.657) [-828.578] (-828.909) (-828.234) -- 0:00:38
      342000 -- (-828.080) (-827.293) [-830.093] (-828.065) * (-828.358) (-829.804) (-828.397) [-828.706] -- 0:00:38
      342500 -- [-828.739] (-829.962) (-828.755) (-829.107) * (-829.284) (-829.085) (-829.320) [-828.323] -- 0:00:38
      343000 -- (-828.995) (-830.100) [-828.339] (-827.913) * (-829.126) [-827.100] (-832.193) (-831.667) -- 0:00:40
      343500 -- (-828.214) (-830.256) (-827.700) [-829.332] * [-827.415] (-829.169) (-828.097) (-832.658) -- 0:00:40
      344000 -- (-832.240) (-832.160) [-828.384] (-830.417) * [-827.410] (-832.755) (-831.786) (-828.902) -- 0:00:40
      344500 -- (-827.370) [-831.015] (-831.026) (-828.499) * [-828.682] (-832.373) (-829.149) (-829.437) -- 0:00:39
      345000 -- [-828.352] (-828.764) (-827.400) (-828.518) * [-828.907] (-828.270) (-831.262) (-828.293) -- 0:00:39

      Average standard deviation of split frequencies: 0.012489

      345500 -- [-828.114] (-832.900) (-829.093) (-829.721) * (-831.706) [-827.740] (-831.056) (-828.677) -- 0:00:39
      346000 -- (-829.650) (-828.692) (-827.948) [-827.970] * (-830.332) [-827.777] (-827.264) (-828.738) -- 0:00:39
      346500 -- (-837.118) [-830.990] (-828.591) (-833.018) * (-828.334) (-831.952) [-827.234] (-828.595) -- 0:00:39
      347000 -- (-831.154) (-828.789) [-831.253] (-829.608) * (-827.749) [-830.921] (-827.508) (-830.100) -- 0:00:39
      347500 -- (-830.721) (-832.043) (-832.646) [-831.213] * [-827.076] (-828.234) (-827.525) (-833.299) -- 0:00:39
      348000 -- (-830.384) (-829.735) (-828.515) [-829.525] * (-828.853) [-828.247] (-831.213) (-832.475) -- 0:00:39
      348500 -- (-829.895) [-828.263] (-828.789) (-829.626) * [-828.240] (-828.529) (-830.475) (-830.701) -- 0:00:39
      349000 -- (-828.536) (-827.034) [-829.227] (-831.029) * [-829.599] (-829.305) (-829.122) (-831.525) -- 0:00:39
      349500 -- (-828.379) (-830.836) [-831.154] (-831.432) * [-828.415] (-828.304) (-829.570) (-829.950) -- 0:00:39
      350000 -- [-829.191] (-829.156) (-829.467) (-827.816) * (-828.042) (-830.122) [-832.749] (-827.661) -- 0:00:39

      Average standard deviation of split frequencies: 0.012652

      350500 -- [-828.152] (-829.517) (-828.317) (-828.608) * (-828.001) (-832.532) [-832.230] (-830.502) -- 0:00:38
      351000 -- (-828.509) (-828.210) [-827.004] (-830.314) * [-829.720] (-827.895) (-826.976) (-829.588) -- 0:00:38
      351500 -- (-830.516) (-827.799) [-829.828] (-829.011) * (-827.637) (-827.730) [-827.260] (-829.964) -- 0:00:38
      352000 -- (-831.331) (-828.498) (-828.770) [-831.205] * (-826.913) (-827.560) (-831.467) [-831.154] -- 0:00:38
      352500 -- [-828.465] (-827.990) (-832.422) (-831.322) * (-827.048) (-829.352) (-827.583) [-827.460] -- 0:00:38
      353000 -- (-834.614) (-827.514) [-828.972] (-829.010) * (-827.613) (-829.342) [-827.854] (-829.040) -- 0:00:38
      353500 -- (-829.788) [-828.479] (-828.344) (-828.435) * (-829.154) (-827.343) (-827.822) [-829.126] -- 0:00:38
      354000 -- (-827.544) (-827.773) (-827.809) [-828.943] * (-829.032) (-827.626) (-828.724) [-828.758] -- 0:00:38
      354500 -- (-828.051) [-828.496] (-828.347) (-831.910) * (-828.498) (-827.889) (-828.446) [-827.368] -- 0:00:38
      355000 -- (-828.088) [-830.324] (-827.445) (-827.965) * (-828.857) (-831.770) [-830.587] (-835.631) -- 0:00:38

      Average standard deviation of split frequencies: 0.011918

      355500 -- (-827.873) (-832.058) [-827.141] (-828.745) * (-829.330) [-829.387] (-834.635) (-833.579) -- 0:00:38
      356000 -- (-827.528) (-832.224) [-832.277] (-833.742) * (-827.836) [-828.872] (-831.296) (-827.927) -- 0:00:37
      356500 -- (-829.620) [-828.855] (-832.925) (-829.097) * (-829.661) [-827.339] (-830.268) (-827.931) -- 0:00:37
      357000 -- [-828.418] (-832.121) (-829.933) (-833.558) * (-827.638) (-827.686) (-829.336) [-828.584] -- 0:00:37
      357500 -- [-828.707] (-829.307) (-828.965) (-831.147) * (-828.387) [-827.685] (-827.267) (-831.508) -- 0:00:37
      358000 -- [-831.660] (-827.149) (-830.128) (-829.353) * (-834.105) (-828.681) (-827.031) [-828.390] -- 0:00:37
      358500 -- (-828.898) (-827.903) (-830.010) [-829.040] * [-826.786] (-830.166) (-829.024) (-827.185) -- 0:00:37
      359000 -- [-826.951] (-827.948) (-832.088) (-828.760) * [-826.647] (-828.744) (-828.361) (-827.883) -- 0:00:37
      359500 -- [-829.295] (-826.973) (-828.339) (-827.036) * (-830.500) (-827.209) (-829.901) [-827.193] -- 0:00:37
      360000 -- (-828.581) (-828.928) [-831.808] (-827.442) * (-831.742) (-828.057) (-829.590) [-829.793] -- 0:00:39

      Average standard deviation of split frequencies: 0.012562

      360500 -- [-830.053] (-827.727) (-830.336) (-827.423) * (-828.222) [-831.651] (-828.258) (-827.725) -- 0:00:39
      361000 -- [-827.580] (-835.345) (-830.937) (-827.551) * (-827.359) (-829.532) [-829.076] (-829.420) -- 0:00:38
      361500 -- (-828.713) (-829.097) (-833.228) [-827.744] * [-828.619] (-828.487) (-834.561) (-832.121) -- 0:00:38
      362000 -- (-830.716) (-828.358) (-831.124) [-828.514] * [-830.101] (-828.285) (-829.571) (-828.867) -- 0:00:38
      362500 -- (-828.903) [-828.741] (-831.797) (-832.748) * [-832.579] (-829.646) (-829.960) (-829.777) -- 0:00:38
      363000 -- (-828.154) (-833.671) [-827.551] (-826.909) * (-834.002) (-829.557) [-828.404] (-829.592) -- 0:00:38
      363500 -- [-828.816] (-828.621) (-829.164) (-833.538) * (-832.269) (-830.963) (-830.068) [-828.290] -- 0:00:38
      364000 -- (-830.754) [-828.840] (-828.985) (-834.816) * (-828.372) [-830.312] (-831.510) (-831.364) -- 0:00:38
      364500 -- [-829.867] (-828.737) (-831.353) (-832.352) * [-827.939] (-830.207) (-831.884) (-829.197) -- 0:00:38
      365000 -- [-827.732] (-829.738) (-832.211) (-832.207) * (-827.495) (-829.343) [-829.891] (-832.638) -- 0:00:38

      Average standard deviation of split frequencies: 0.013953

      365500 -- (-834.911) (-831.004) (-830.305) [-830.312] * (-828.458) (-828.913) [-827.820] (-829.890) -- 0:00:38
      366000 -- (-829.087) (-827.088) [-831.605] (-827.332) * (-829.042) (-832.140) (-833.416) [-829.144] -- 0:00:38
      366500 -- (-828.141) (-832.275) [-833.021] (-829.220) * (-828.026) [-831.472] (-832.585) (-829.377) -- 0:00:38
      367000 -- (-828.537) (-832.297) [-831.413] (-828.370) * (-832.051) (-832.343) (-832.658) [-826.834] -- 0:00:37
      367500 -- (-828.199) [-830.735] (-829.188) (-828.553) * [-829.145] (-835.303) (-831.883) (-831.071) -- 0:00:37
      368000 -- [-828.316] (-832.776) (-831.072) (-827.791) * (-829.495) (-836.912) (-831.493) [-832.707] -- 0:00:37
      368500 -- [-828.625] (-832.272) (-828.713) (-827.775) * (-827.072) (-827.312) [-829.125] (-829.153) -- 0:00:37
      369000 -- (-828.129) (-830.159) [-828.622] (-828.251) * [-827.504] (-830.597) (-829.604) (-828.544) -- 0:00:37
      369500 -- (-827.088) (-827.363) (-827.522) [-827.625] * [-828.455] (-829.119) (-830.217) (-832.128) -- 0:00:37
      370000 -- [-826.684] (-827.364) (-827.293) (-828.495) * (-827.911) (-829.352) [-829.473] (-829.679) -- 0:00:37

      Average standard deviation of split frequencies: 0.014908

      370500 -- [-829.773] (-826.981) (-829.561) (-828.836) * (-831.042) (-827.254) [-828.852] (-830.023) -- 0:00:37
      371000 -- (-827.459) [-826.998] (-828.670) (-833.315) * (-836.240) [-830.125] (-828.495) (-833.703) -- 0:00:37
      371500 -- (-834.553) [-828.714] (-831.831) (-829.470) * (-831.394) [-828.616] (-827.428) (-831.627) -- 0:00:37
      372000 -- (-831.489) [-827.450] (-828.626) (-829.187) * (-826.839) (-828.150) (-832.496) [-826.906] -- 0:00:37
      372500 -- (-827.454) (-827.458) (-830.844) [-829.448] * [-828.280] (-827.179) (-829.950) (-828.408) -- 0:00:37
      373000 -- (-827.318) (-828.435) [-828.309] (-828.417) * (-828.937) (-831.943) [-830.055] (-827.169) -- 0:00:36
      373500 -- [-827.385] (-831.354) (-829.500) (-830.948) * (-830.209) [-827.730] (-830.122) (-828.099) -- 0:00:36
      374000 -- (-828.097) (-831.785) [-828.507] (-828.278) * [-828.968] (-827.353) (-832.485) (-830.279) -- 0:00:36
      374500 -- [-826.817] (-829.140) (-834.960) (-830.458) * (-832.749) [-831.268] (-828.459) (-829.270) -- 0:00:36
      375000 -- (-830.932) (-830.437) (-828.638) [-828.317] * (-828.621) [-828.104] (-826.690) (-828.305) -- 0:00:36

      Average standard deviation of split frequencies: 0.014455

      375500 -- (-828.156) (-827.880) (-828.137) [-827.481] * (-827.423) (-828.340) (-828.612) [-830.806] -- 0:00:36
      376000 -- (-829.529) [-827.249] (-830.106) (-827.612) * [-829.204] (-828.612) (-829.840) (-830.457) -- 0:00:36
      376500 -- (-827.553) (-829.081) [-829.390] (-830.587) * [-827.988] (-828.908) (-833.533) (-832.867) -- 0:00:38
      377000 -- (-828.460) [-826.985] (-833.366) (-831.464) * [-827.952] (-829.385) (-828.072) (-831.751) -- 0:00:38
      377500 -- (-828.341) (-828.378) (-830.204) [-826.686] * (-827.443) (-829.549) (-829.530) [-827.769] -- 0:00:37
      378000 -- (-827.529) (-831.138) (-829.996) [-829.137] * (-829.070) [-828.630] (-828.110) (-827.567) -- 0:00:37
      378500 -- (-829.217) [-829.799] (-829.928) (-830.269) * [-827.470] (-828.077) (-832.393) (-831.686) -- 0:00:37
      379000 -- (-830.108) [-826.886] (-832.623) (-830.382) * [-831.492] (-829.515) (-829.951) (-830.746) -- 0:00:37
      379500 -- [-828.344] (-827.206) (-831.023) (-829.897) * (-831.892) (-827.615) [-827.467] (-830.874) -- 0:00:37
      380000 -- [-828.109] (-827.742) (-832.844) (-827.442) * [-829.496] (-829.448) (-827.880) (-832.846) -- 0:00:37

      Average standard deviation of split frequencies: 0.014933

      380500 -- (-828.017) (-830.974) (-828.894) [-831.745] * [-829.736] (-830.298) (-829.905) (-829.084) -- 0:00:37
      381000 -- [-828.442] (-833.527) (-828.926) (-828.055) * (-827.362) (-830.203) [-830.657] (-828.229) -- 0:00:37
      381500 -- (-831.150) (-828.488) [-831.452] (-827.798) * (-829.992) (-830.330) [-828.687] (-830.936) -- 0:00:37
      382000 -- (-831.299) (-829.396) [-833.306] (-827.617) * (-829.749) (-828.348) (-832.190) [-829.082] -- 0:00:37
      382500 -- [-827.926] (-828.305) (-830.330) (-828.900) * (-832.333) (-828.026) (-828.258) [-828.640] -- 0:00:37
      383000 -- [-828.386] (-830.445) (-832.512) (-828.220) * (-831.315) [-827.778] (-832.298) (-831.368) -- 0:00:37
      383500 -- (-831.973) [-830.411] (-831.991) (-832.076) * [-830.455] (-829.281) (-827.462) (-827.236) -- 0:00:36
      384000 -- (-829.304) (-829.270) (-833.855) [-829.028] * (-828.453) (-830.217) [-829.476] (-830.092) -- 0:00:36
      384500 -- (-829.968) (-827.292) (-827.435) [-829.367] * (-829.142) (-828.858) [-827.504] (-828.868) -- 0:00:36
      385000 -- (-828.690) [-828.535] (-827.524) (-829.539) * (-828.404) (-827.818) [-827.576] (-828.296) -- 0:00:36

      Average standard deviation of split frequencies: 0.015808

      385500 -- (-827.864) (-833.018) [-829.036] (-830.518) * [-828.263] (-830.725) (-829.306) (-830.573) -- 0:00:36
      386000 -- [-828.211] (-829.475) (-828.538) (-829.401) * (-828.001) (-829.837) (-842.260) [-828.566] -- 0:00:36
      386500 -- (-828.848) [-828.804] (-827.241) (-829.305) * (-826.888) (-828.739) (-827.320) [-827.254] -- 0:00:36
      387000 -- [-828.605] (-830.763) (-828.490) (-831.798) * (-827.791) [-829.087] (-829.685) (-827.791) -- 0:00:36
      387500 -- (-827.894) (-830.349) [-827.689] (-835.449) * [-827.997] (-828.337) (-833.025) (-833.184) -- 0:00:36
      388000 -- [-828.581] (-828.265) (-830.157) (-830.221) * (-830.638) [-829.404] (-827.475) (-830.427) -- 0:00:36
      388500 -- (-827.860) [-826.724] (-829.376) (-829.424) * (-829.563) (-828.341) [-828.885] (-834.686) -- 0:00:36
      389000 -- (-827.141) [-827.742] (-827.181) (-828.546) * (-827.961) (-828.149) (-827.503) [-831.466] -- 0:00:36
      389500 -- (-828.875) [-827.890] (-829.636) (-828.230) * (-830.970) (-828.119) (-830.707) [-831.749] -- 0:00:36
      390000 -- (-831.070) [-828.017] (-827.374) (-830.713) * (-828.187) (-834.084) (-828.508) [-828.946] -- 0:00:35

      Average standard deviation of split frequencies: 0.015616

      390500 -- (-829.396) [-827.312] (-828.687) (-831.971) * (-829.451) (-829.725) [-828.672] (-832.559) -- 0:00:35
      391000 -- [-831.644] (-829.467) (-828.855) (-829.240) * (-828.418) (-829.651) [-830.066] (-827.207) -- 0:00:35
      391500 -- (-830.760) (-828.104) [-829.203] (-827.654) * (-828.309) (-834.100) [-829.291] (-827.681) -- 0:00:35
      392000 -- (-829.760) (-829.776) (-828.242) [-827.142] * [-828.778] (-828.679) (-828.302) (-827.432) -- 0:00:35
      392500 -- [-827.464] (-829.568) (-831.104) (-829.378) * [-828.015] (-829.927) (-830.432) (-829.375) -- 0:00:35
      393000 -- (-827.594) [-829.495] (-831.510) (-830.051) * [-829.129] (-827.950) (-830.436) (-828.722) -- 0:00:37
      393500 -- (-827.553) (-829.686) (-829.698) [-829.595] * (-827.613) (-829.876) (-831.633) [-829.954] -- 0:00:36
      394000 -- (-827.648) (-828.658) [-830.899] (-828.865) * [-827.965] (-828.462) (-828.865) (-831.741) -- 0:00:36
      394500 -- (-828.101) (-827.916) [-830.069] (-829.800) * (-828.960) [-829.941] (-827.702) (-828.928) -- 0:00:36
      395000 -- (-828.174) (-828.188) (-829.248) [-828.761] * (-827.630) (-829.274) (-833.264) [-827.621] -- 0:00:36

      Average standard deviation of split frequencies: 0.015966

      395500 -- (-828.121) [-828.639] (-829.939) (-827.466) * [-827.923] (-829.203) (-827.945) (-833.516) -- 0:00:36
      396000 -- [-831.214] (-828.883) (-829.655) (-830.112) * (-828.443) (-831.885) (-828.862) [-828.579] -- 0:00:36
      396500 -- [-827.912] (-828.344) (-828.858) (-829.921) * (-829.724) (-829.104) (-830.665) [-833.940] -- 0:00:36
      397000 -- (-832.305) (-827.513) [-827.562] (-833.030) * (-827.225) [-827.299] (-829.535) (-830.004) -- 0:00:36
      397500 -- (-831.054) [-827.693] (-827.160) (-828.924) * (-827.100) (-827.200) (-828.420) [-828.981] -- 0:00:36
      398000 -- (-827.863) (-829.665) (-829.189) [-830.308] * (-830.481) (-827.530) [-827.807] (-830.938) -- 0:00:36
      398500 -- (-830.288) (-831.732) [-827.468] (-827.968) * (-835.737) [-831.835] (-828.262) (-827.993) -- 0:00:36
      399000 -- (-838.765) (-829.020) [-827.510] (-829.588) * (-831.559) [-828.020] (-827.787) (-832.111) -- 0:00:36
      399500 -- [-829.022] (-827.631) (-828.451) (-833.030) * (-827.483) [-828.051] (-829.279) (-830.948) -- 0:00:36
      400000 -- (-834.862) (-831.355) (-829.297) [-827.630] * (-827.741) [-828.132] (-832.135) (-833.752) -- 0:00:36

      Average standard deviation of split frequencies: 0.015710

      400500 -- (-827.709) (-827.769) (-831.555) [-827.417] * (-828.995) (-828.978) [-833.030] (-831.808) -- 0:00:35
      401000 -- (-831.093) [-829.522] (-829.762) (-827.397) * [-833.413] (-827.833) (-828.863) (-829.372) -- 0:00:35
      401500 -- (-830.549) (-830.545) (-833.637) [-828.773] * (-837.050) [-828.891] (-830.460) (-829.362) -- 0:00:35
      402000 -- (-829.265) (-830.905) [-829.663] (-828.705) * (-834.393) [-827.580] (-829.135) (-828.026) -- 0:00:35
      402500 -- (-830.121) (-829.492) [-827.446] (-828.886) * (-828.415) (-827.693) (-829.773) [-831.418] -- 0:00:35
      403000 -- [-828.034] (-828.389) (-827.879) (-830.287) * [-828.556] (-829.296) (-827.724) (-828.646) -- 0:00:35
      403500 -- (-832.094) [-827.298] (-830.600) (-827.688) * (-837.771) [-833.428] (-827.977) (-829.021) -- 0:00:35
      404000 -- (-831.899) (-829.893) (-827.122) [-827.714] * (-830.544) (-828.540) [-830.016] (-827.413) -- 0:00:35
      404500 -- (-830.810) [-831.359] (-828.632) (-830.356) * (-827.765) [-827.324] (-829.092) (-829.488) -- 0:00:35
      405000 -- (-830.017) (-829.958) (-828.960) [-827.469] * (-829.397) (-829.432) [-828.080] (-830.230) -- 0:00:35

      Average standard deviation of split frequencies: 0.015231

      405500 -- [-827.873] (-831.288) (-829.419) (-826.888) * (-829.556) [-834.262] (-827.904) (-827.915) -- 0:00:35
      406000 -- (-828.020) (-829.646) [-831.646] (-828.199) * (-828.420) (-830.811) [-829.169] (-831.493) -- 0:00:35
      406500 -- (-828.454) [-827.485] (-833.614) (-828.023) * (-828.950) (-830.443) (-830.490) [-828.687] -- 0:00:35
      407000 -- (-829.540) (-830.329) [-828.651] (-828.789) * (-828.208) [-828.470] (-827.924) (-828.587) -- 0:00:34
      407500 -- [-828.219] (-830.369) (-829.325) (-830.475) * (-829.370) [-827.274] (-827.439) (-828.072) -- 0:00:34
      408000 -- (-828.789) (-829.758) [-829.872] (-830.894) * (-831.775) (-826.844) (-828.814) [-829.874] -- 0:00:34
      408500 -- (-827.935) (-828.984) (-829.856) [-832.110] * (-833.418) [-826.891] (-830.532) (-831.222) -- 0:00:34
      409000 -- (-827.573) [-830.393] (-828.918) (-827.517) * (-833.587) (-833.857) (-828.170) [-826.984] -- 0:00:34
      409500 -- (-828.438) (-827.627) (-830.650) [-827.263] * (-828.791) (-829.580) [-830.484] (-827.127) -- 0:00:36
      410000 -- (-829.042) (-827.420) [-828.031] (-827.286) * (-829.296) (-827.810) (-828.069) [-827.497] -- 0:00:35

      Average standard deviation of split frequencies: 0.015058

      410500 -- (-831.735) (-830.482) (-834.938) [-827.579] * (-830.907) (-828.262) [-829.712] (-829.439) -- 0:00:35
      411000 -- (-834.314) (-834.044) (-829.350) [-831.555] * (-828.528) [-826.771] (-829.325) (-830.347) -- 0:00:35
      411500 -- (-829.305) (-829.413) (-826.705) [-828.566] * (-828.721) (-827.232) [-827.077] (-830.467) -- 0:00:35
      412000 -- (-829.931) [-828.711] (-827.544) (-827.306) * (-828.904) [-827.186] (-827.977) (-829.260) -- 0:00:35
      412500 -- [-829.834] (-830.800) (-828.647) (-828.331) * (-828.840) [-828.819] (-827.952) (-828.160) -- 0:00:35
      413000 -- (-829.451) [-827.293] (-827.726) (-829.058) * (-830.544) (-832.913) (-830.405) [-828.885] -- 0:00:35
      413500 -- (-831.567) (-830.188) [-828.632] (-829.937) * (-828.795) [-828.098] (-831.607) (-829.426) -- 0:00:35
      414000 -- (-830.463) [-827.191] (-828.886) (-827.315) * (-829.565) [-826.731] (-829.449) (-827.621) -- 0:00:35
      414500 -- [-832.324] (-827.216) (-829.743) (-829.314) * [-827.806] (-828.792) (-830.117) (-829.229) -- 0:00:35
      415000 -- [-827.557] (-829.584) (-828.338) (-830.069) * (-827.650) [-829.545] (-829.689) (-834.419) -- 0:00:35

      Average standard deviation of split frequencies: 0.014465

      415500 -- (-827.126) (-828.942) [-830.863] (-827.738) * [-828.564] (-830.328) (-829.665) (-827.446) -- 0:00:35
      416000 -- (-826.763) (-827.351) (-830.462) [-829.195] * (-828.514) [-830.436] (-827.377) (-828.548) -- 0:00:35
      416500 -- (-828.103) [-827.956] (-831.469) (-829.117) * [-829.394] (-832.089) (-827.370) (-830.507) -- 0:00:35
      417000 -- (-827.613) (-827.921) [-827.942] (-833.320) * [-829.453] (-828.427) (-829.194) (-829.825) -- 0:00:34
      417500 -- (-827.975) (-827.727) (-827.342) [-831.107] * [-829.728] (-828.314) (-833.693) (-829.921) -- 0:00:34
      418000 -- (-828.963) (-831.485) [-827.918] (-829.020) * [-830.912] (-827.531) (-834.163) (-829.181) -- 0:00:34
      418500 -- (-828.955) (-829.901) [-826.827] (-828.658) * (-829.854) (-830.490) [-833.376] (-828.031) -- 0:00:34
      419000 -- (-830.935) (-830.266) (-828.762) [-828.665] * (-829.219) [-828.466] (-829.643) (-827.848) -- 0:00:34
      419500 -- (-837.430) (-827.192) [-828.724] (-829.373) * (-828.608) (-828.192) [-829.828] (-830.629) -- 0:00:34
      420000 -- [-832.911] (-828.194) (-827.603) (-828.844) * (-828.182) (-828.473) [-833.781] (-828.887) -- 0:00:34

      Average standard deviation of split frequencies: 0.013909

      420500 -- (-835.246) (-827.607) [-828.971] (-829.340) * (-830.604) (-832.358) (-832.816) [-827.574] -- 0:00:34
      421000 -- (-831.600) (-829.113) (-827.843) [-828.997] * (-828.212) (-827.172) [-828.431] (-828.705) -- 0:00:34
      421500 -- [-827.906] (-828.927) (-829.874) (-828.371) * (-830.165) (-828.169) (-827.658) [-827.953] -- 0:00:34
      422000 -- (-829.541) (-829.240) (-829.475) [-829.022] * (-829.970) [-827.426] (-829.075) (-827.208) -- 0:00:34
      422500 -- (-830.800) [-827.529] (-830.792) (-827.484) * (-828.616) [-827.677] (-828.025) (-828.033) -- 0:00:34
      423000 -- (-829.694) [-827.046] (-831.107) (-827.615) * (-831.201) (-828.080) [-827.677] (-828.614) -- 0:00:34
      423500 -- (-829.804) [-826.772] (-832.093) (-829.152) * [-830.659] (-828.948) (-828.393) (-830.838) -- 0:00:34
      424000 -- (-828.962) (-828.525) (-833.429) [-828.116] * [-827.931] (-828.304) (-827.172) (-829.081) -- 0:00:33
      424500 -- [-829.291] (-829.599) (-828.926) (-828.096) * [-828.060] (-828.601) (-832.544) (-830.926) -- 0:00:33
      425000 -- (-828.810) [-829.719] (-829.364) (-831.692) * (-827.979) (-828.042) (-828.966) [-830.072] -- 0:00:33

      Average standard deviation of split frequencies: 0.013735

      425500 -- [-828.846] (-828.815) (-830.193) (-829.824) * (-829.824) [-829.698] (-830.556) (-828.028) -- 0:00:33
      426000 -- (-829.854) (-829.147) (-827.326) [-831.586] * (-830.852) (-834.785) [-829.833] (-827.970) -- 0:00:35
      426500 -- (-832.434) [-828.675] (-827.321) (-828.425) * (-829.223) (-828.622) (-828.989) [-827.329] -- 0:00:34
      427000 -- (-831.038) (-829.596) (-829.459) [-828.045] * [-828.225] (-829.225) (-828.815) (-833.370) -- 0:00:34
      427500 -- (-835.030) (-829.345) (-833.287) [-836.170] * (-828.603) (-830.015) (-830.823) [-827.351] -- 0:00:34
      428000 -- (-831.237) (-831.366) (-829.834) [-830.156] * (-828.946) (-831.569) (-828.067) [-830.093] -- 0:00:34
      428500 -- (-828.878) (-830.718) [-828.752] (-829.223) * (-827.141) (-827.482) (-829.454) [-827.994] -- 0:00:34
      429000 -- (-830.461) (-827.856) [-827.315] (-829.533) * (-828.041) [-829.228] (-828.189) (-827.687) -- 0:00:34
      429500 -- (-831.272) (-829.792) (-833.704) [-830.000] * (-828.295) [-827.174] (-827.867) (-827.204) -- 0:00:34
      430000 -- (-830.946) [-827.407] (-833.045) (-832.166) * (-830.921) (-829.053) (-831.573) [-827.136] -- 0:00:34

      Average standard deviation of split frequencies: 0.013071

      430500 -- (-828.231) (-828.446) (-833.350) [-826.969] * (-827.953) [-830.955] (-830.559) (-828.722) -- 0:00:34
      431000 -- [-827.157] (-832.244) (-832.101) (-827.657) * (-827.287) (-830.248) [-829.103] (-830.036) -- 0:00:34
      431500 -- (-827.535) (-829.656) (-831.282) [-827.272] * (-828.376) [-830.918] (-827.833) (-830.880) -- 0:00:34
      432000 -- (-827.950) (-829.774) (-830.206) [-827.191] * (-829.984) (-832.929) [-827.477] (-829.485) -- 0:00:34
      432500 -- (-829.311) [-829.699] (-831.100) (-828.843) * (-831.191) [-829.749] (-827.032) (-829.860) -- 0:00:34
      433000 -- [-828.210] (-827.819) (-831.853) (-829.334) * (-830.136) (-828.483) [-829.089] (-827.374) -- 0:00:34
      433500 -- (-830.530) [-827.213] (-828.370) (-829.039) * (-829.414) (-829.417) [-833.059] (-827.279) -- 0:00:33
      434000 -- [-827.636] (-828.046) (-828.323) (-828.219) * [-829.803] (-828.328) (-829.548) (-831.905) -- 0:00:33
      434500 -- [-827.765] (-831.559) (-828.739) (-828.178) * (-834.067) [-831.313] (-827.999) (-827.986) -- 0:00:33
      435000 -- (-829.261) (-828.118) [-828.795] (-828.366) * [-830.371] (-830.231) (-827.852) (-827.976) -- 0:00:33

      Average standard deviation of split frequencies: 0.012593

      435500 -- (-830.560) [-830.586] (-829.806) (-829.624) * (-829.604) (-827.847) (-828.279) [-829.742] -- 0:00:33
      436000 -- [-828.744] (-827.662) (-830.426) (-829.898) * (-827.965) (-828.025) (-831.803) [-828.527] -- 0:00:33
      436500 -- (-828.137) (-828.126) [-831.544] (-828.365) * (-827.811) [-827.542] (-829.644) (-828.887) -- 0:00:33
      437000 -- [-828.216] (-832.006) (-829.207) (-829.099) * (-826.750) (-828.660) (-827.788) [-829.177] -- 0:00:33
      437500 -- (-829.183) [-829.673] (-829.744) (-828.999) * [-827.738] (-828.201) (-828.091) (-829.735) -- 0:00:33
      438000 -- [-828.261] (-828.600) (-828.231) (-830.197) * (-827.705) (-829.351) [-828.427] (-828.748) -- 0:00:33
      438500 -- (-827.633) (-827.659) (-827.658) [-829.107] * [-827.245] (-829.674) (-827.055) (-829.498) -- 0:00:33
      439000 -- (-828.160) [-827.092] (-830.817) (-831.153) * (-828.292) (-827.336) [-828.363] (-828.240) -- 0:00:33
      439500 -- (-827.960) (-828.683) [-829.140] (-827.516) * (-829.990) (-830.294) [-831.200] (-828.786) -- 0:00:33
      440000 -- (-828.954) (-830.318) [-828.850] (-827.964) * (-832.058) (-831.960) [-829.085] (-827.453) -- 0:00:33

      Average standard deviation of split frequencies: 0.012648

      440500 -- (-827.666) (-831.225) (-831.898) [-831.011] * (-833.994) (-828.858) (-827.962) [-827.899] -- 0:00:33
      441000 -- (-830.173) (-829.467) (-834.197) [-829.753] * (-827.908) (-831.215) [-827.898] (-827.621) -- 0:00:32
      441500 -- (-827.548) (-830.971) [-829.960] (-827.412) * (-829.083) (-828.790) [-828.511] (-828.371) -- 0:00:32
      442000 -- [-827.341] (-831.948) (-831.360) (-828.054) * (-828.593) (-832.887) [-827.973] (-827.910) -- 0:00:32
      442500 -- (-827.703) (-829.580) [-830.744] (-829.345) * (-829.171) (-829.584) [-828.778] (-827.610) -- 0:00:34
      443000 -- (-826.973) [-826.702] (-832.080) (-829.299) * (-828.148) (-829.969) (-828.180) [-830.264] -- 0:00:33
      443500 -- (-827.196) [-827.646] (-832.712) (-831.980) * (-829.224) (-830.148) (-827.637) [-827.728] -- 0:00:33
      444000 -- [-827.022] (-828.026) (-831.074) (-829.189) * [-828.515] (-827.114) (-829.656) (-828.658) -- 0:00:33
      444500 -- [-827.383] (-829.628) (-827.402) (-828.904) * (-831.022) (-832.946) (-828.456) [-832.366] -- 0:00:33
      445000 -- (-830.721) [-828.799] (-826.850) (-829.770) * (-828.031) (-827.969) [-828.436] (-830.466) -- 0:00:33

      Average standard deviation of split frequencies: 0.012621

      445500 -- (-831.559) [-828.750] (-827.051) (-829.131) * [-830.903] (-827.918) (-832.433) (-829.314) -- 0:00:33
      446000 -- (-831.842) [-827.154] (-827.748) (-829.250) * (-830.946) [-827.293] (-830.261) (-830.089) -- 0:00:33
      446500 -- (-830.245) (-831.836) (-827.808) [-829.114] * [-831.791] (-828.764) (-829.164) (-827.870) -- 0:00:33
      447000 -- [-827.840] (-830.508) (-828.425) (-831.106) * (-830.618) (-827.202) [-829.078] (-828.390) -- 0:00:33
      447500 -- [-829.098] (-827.699) (-829.155) (-828.736) * (-828.073) (-829.582) (-830.554) [-828.711] -- 0:00:33
      448000 -- (-827.606) (-826.852) [-827.295] (-829.951) * (-828.507) (-828.031) [-830.828] (-827.676) -- 0:00:33
      448500 -- [-829.819] (-829.966) (-827.513) (-830.150) * (-830.154) (-830.894) (-827.596) [-828.323] -- 0:00:33
      449000 -- (-827.115) (-832.446) [-828.334] (-828.780) * (-829.758) [-829.594] (-828.257) (-834.709) -- 0:00:33
      449500 -- (-827.420) (-833.110) (-828.045) [-829.207] * (-829.635) (-828.411) [-830.013] (-828.253) -- 0:00:33
      450000 -- (-828.695) [-827.334] (-827.857) (-829.388) * (-829.548) (-831.662) (-829.599) [-830.307] -- 0:00:33

      Average standard deviation of split frequencies: 0.012245

      450500 -- (-829.666) (-827.699) (-827.020) [-828.562] * (-829.389) (-828.087) [-831.461] (-827.278) -- 0:00:32
      451000 -- (-828.603) [-828.264] (-827.198) (-828.430) * (-827.446) (-831.089) (-828.527) [-829.337] -- 0:00:32
      451500 -- (-828.718) (-828.604) (-830.510) [-828.869] * [-827.468] (-829.617) (-829.012) (-829.764) -- 0:00:32
      452000 -- [-828.957] (-828.854) (-828.861) (-829.747) * (-829.987) [-827.056] (-829.228) (-830.354) -- 0:00:32
      452500 -- (-829.010) (-830.072) (-830.436) [-829.936] * (-829.565) [-828.833] (-830.131) (-828.609) -- 0:00:32
      453000 -- [-829.741] (-834.437) (-827.971) (-826.950) * (-834.422) [-828.308] (-831.838) (-828.506) -- 0:00:32
      453500 -- (-826.834) (-829.563) (-828.336) [-826.931] * (-828.310) (-831.865) (-827.675) [-830.930] -- 0:00:32
      454000 -- (-827.475) (-833.060) [-828.779] (-829.835) * (-828.311) (-828.516) (-834.443) [-829.760] -- 0:00:32
      454500 -- (-830.459) [-830.050] (-830.380) (-832.318) * (-829.453) [-828.516] (-836.666) (-828.367) -- 0:00:32
      455000 -- (-827.852) [-829.153] (-829.250) (-829.886) * [-827.920] (-828.711) (-830.458) (-830.093) -- 0:00:32

      Average standard deviation of split frequencies: 0.012709

      455500 -- (-827.197) (-829.566) [-830.256] (-829.274) * [-827.572] (-827.456) (-829.724) (-831.024) -- 0:00:32
      456000 -- (-829.057) (-829.869) [-830.926] (-830.247) * (-827.267) [-827.494] (-827.576) (-828.103) -- 0:00:32
      456500 -- (-836.432) (-830.237) (-827.740) [-828.544] * (-827.178) (-830.130) (-831.098) [-827.978] -- 0:00:32
      457000 -- [-832.229] (-827.444) (-836.537) (-827.886) * (-826.736) (-829.110) [-830.034] (-827.409) -- 0:00:32
      457500 -- [-829.628] (-832.200) (-828.938) (-829.666) * (-829.624) (-829.151) [-829.552] (-827.711) -- 0:00:32
      458000 -- (-828.699) (-828.946) [-827.905] (-832.730) * (-827.115) (-828.901) (-827.906) [-828.773] -- 0:00:31
      458500 -- (-829.421) (-828.309) [-829.438] (-828.405) * (-827.092) (-834.348) (-832.461) [-828.198] -- 0:00:31
      459000 -- [-827.821] (-833.906) (-828.213) (-832.559) * (-830.787) (-827.500) (-829.224) [-828.226] -- 0:00:31
      459500 -- (-828.180) [-829.202] (-828.273) (-829.499) * [-830.562] (-828.271) (-827.717) (-828.223) -- 0:00:32
      460000 -- (-827.974) (-828.462) [-828.075] (-828.990) * (-829.910) (-829.240) (-831.352) [-831.127] -- 0:00:32

      Average standard deviation of split frequencies: 0.012520

      460500 -- (-827.792) [-827.962] (-830.316) (-830.908) * (-830.549) [-826.724] (-830.848) (-832.331) -- 0:00:32
      461000 -- [-827.420] (-828.008) (-828.173) (-834.088) * (-828.797) (-826.725) (-830.561) [-832.873] -- 0:00:32
      461500 -- (-830.526) [-829.858] (-828.337) (-828.701) * (-829.216) [-827.375] (-830.407) (-832.806) -- 0:00:32
      462000 -- (-830.098) [-830.101] (-830.268) (-828.290) * (-828.829) (-831.589) (-833.909) [-828.819] -- 0:00:32
      462500 -- (-835.062) (-828.614) [-829.876] (-827.481) * (-828.611) (-828.916) [-829.127] (-829.988) -- 0:00:32
      463000 -- (-828.041) (-828.113) (-827.570) [-827.635] * (-828.723) (-829.166) [-829.406] (-831.032) -- 0:00:32
      463500 -- (-827.559) [-827.894] (-830.048) (-827.320) * (-828.730) (-827.711) [-827.790] (-831.487) -- 0:00:32
      464000 -- (-828.054) [-827.627] (-828.222) (-829.944) * (-827.496) [-830.143] (-827.053) (-831.317) -- 0:00:32
      464500 -- [-828.420] (-826.917) (-828.757) (-831.765) * (-828.950) (-831.113) (-829.192) [-827.881] -- 0:00:32
      465000 -- (-828.350) [-828.474] (-829.574) (-829.928) * [-828.822] (-827.850) (-829.127) (-829.085) -- 0:00:32

      Average standard deviation of split frequencies: 0.012318

      465500 -- [-828.579] (-828.330) (-828.993) (-830.568) * (-829.451) (-832.338) [-830.530] (-830.478) -- 0:00:32
      466000 -- (-828.766) (-827.978) [-828.470] (-830.956) * (-829.459) [-828.882] (-830.110) (-829.473) -- 0:00:32
      466500 -- (-829.717) [-830.400] (-831.897) (-830.412) * (-828.806) [-828.675] (-830.815) (-829.488) -- 0:00:32
      467000 -- (-830.628) (-829.115) [-827.251] (-833.465) * (-829.083) (-828.046) (-828.567) [-830.118] -- 0:00:31
      467500 -- (-831.421) [-827.752] (-830.101) (-828.106) * [-829.552] (-828.370) (-828.730) (-827.398) -- 0:00:31
      468000 -- (-831.671) (-828.568) [-832.906] (-834.269) * (-829.784) [-829.630] (-830.059) (-828.059) -- 0:00:31
      468500 -- (-830.057) (-831.900) [-829.455] (-833.826) * [-829.623] (-829.119) (-827.881) (-832.303) -- 0:00:31
      469000 -- (-830.802) (-831.261) [-831.196] (-835.575) * [-829.884] (-833.135) (-833.085) (-826.793) -- 0:00:31
      469500 -- (-829.354) [-829.799] (-828.890) (-829.197) * (-831.811) (-827.770) (-832.044) [-828.881] -- 0:00:31
      470000 -- [-830.584] (-830.799) (-831.736) (-829.816) * [-831.631] (-828.933) (-829.950) (-827.698) -- 0:00:31

      Average standard deviation of split frequencies: 0.012520

      470500 -- (-827.664) (-830.985) [-831.290] (-829.795) * (-832.126) (-827.443) (-828.952) [-831.986] -- 0:00:31
      471000 -- [-827.805] (-828.696) (-827.673) (-833.409) * (-827.539) (-829.158) [-831.592] (-830.133) -- 0:00:31
      471500 -- (-832.294) (-828.708) (-828.588) [-827.971] * (-827.488) [-827.231] (-829.650) (-827.885) -- 0:00:31
      472000 -- (-831.526) (-828.978) (-829.730) [-830.636] * (-828.649) (-831.327) [-828.895] (-830.153) -- 0:00:31
      472500 -- [-828.084] (-834.490) (-830.391) (-830.596) * (-829.885) (-831.017) (-826.970) [-827.828] -- 0:00:31
      473000 -- (-827.140) (-830.270) (-830.237) [-828.885] * (-828.059) (-830.089) [-829.231] (-830.401) -- 0:00:31
      473500 -- (-829.564) (-834.147) [-830.205] (-828.456) * [-827.250] (-831.202) (-828.564) (-830.473) -- 0:00:31
      474000 -- [-827.264] (-827.404) (-828.580) (-828.706) * (-830.658) (-833.379) (-828.221) [-829.511] -- 0:00:31
      474500 -- (-829.988) (-829.181) [-829.646] (-829.754) * (-828.238) (-829.955) (-827.564) [-830.650] -- 0:00:31
      475000 -- (-827.618) [-827.855] (-829.330) (-829.497) * (-829.418) (-827.303) [-827.118] (-829.658) -- 0:00:30

      Average standard deviation of split frequencies: 0.012874

      475500 -- (-827.636) [-828.325] (-830.241) (-827.843) * (-828.591) (-828.764) [-829.111] (-830.174) -- 0:00:31
      476000 -- (-828.580) (-829.562) (-829.402) [-829.571] * (-828.132) (-833.541) [-829.608] (-829.686) -- 0:00:31
      476500 -- (-834.120) (-828.577) [-828.528] (-831.954) * (-829.239) (-829.902) [-829.434] (-830.699) -- 0:00:31
      477000 -- (-828.930) [-827.804] (-828.784) (-830.026) * (-833.642) (-829.838) [-828.548] (-829.209) -- 0:00:31
      477500 -- [-831.048] (-828.389) (-833.993) (-827.447) * (-831.483) (-828.711) [-829.116] (-828.662) -- 0:00:31
      478000 -- (-828.495) (-827.230) [-830.455] (-827.019) * (-829.467) (-827.497) [-827.000] (-830.506) -- 0:00:31
      478500 -- (-829.418) (-830.458) (-831.011) [-827.016] * (-828.843) (-829.410) [-827.874] (-829.787) -- 0:00:31
      479000 -- (-827.822) (-835.169) (-827.226) [-828.409] * (-828.329) (-829.673) (-827.161) [-827.305] -- 0:00:31
      479500 -- (-827.437) (-828.380) [-830.153] (-827.523) * [-828.345] (-828.927) (-827.548) (-829.546) -- 0:00:31
      480000 -- [-829.460] (-828.064) (-828.330) (-829.690) * [-828.607] (-832.416) (-827.263) (-830.981) -- 0:00:31

      Average standard deviation of split frequencies: 0.012749

      480500 -- (-829.857) [-830.141] (-828.484) (-830.864) * [-827.462] (-834.105) (-827.342) (-829.874) -- 0:00:31
      481000 -- (-827.800) (-829.187) [-828.792] (-830.723) * (-832.778) (-829.002) (-828.109) [-830.235] -- 0:00:31
      481500 -- (-827.225) [-828.133] (-832.084) (-827.835) * (-830.349) [-828.788] (-826.697) (-830.696) -- 0:00:31
      482000 -- (-827.728) [-829.112] (-834.432) (-829.702) * (-829.819) (-833.229) [-827.588] (-828.325) -- 0:00:31
      482500 -- (-827.709) (-828.641) [-827.834] (-831.680) * (-829.823) (-829.083) [-829.763] (-827.879) -- 0:00:31
      483000 -- [-827.307] (-829.458) (-830.481) (-831.435) * (-830.055) (-831.702) (-827.386) [-827.311] -- 0:00:31
      483500 -- (-828.233) (-829.461) (-828.405) [-829.711] * (-830.940) (-828.498) (-829.418) [-829.115] -- 0:00:30
      484000 -- [-827.289] (-826.794) (-828.878) (-830.614) * (-830.366) (-827.685) [-829.942] (-829.075) -- 0:00:30
      484500 -- (-827.540) [-827.778] (-827.829) (-833.353) * (-828.148) (-838.711) (-828.482) [-830.950] -- 0:00:30
      485000 -- (-829.038) (-836.547) [-831.175] (-831.299) * (-828.463) (-833.911) [-828.637] (-828.770) -- 0:00:30

      Average standard deviation of split frequencies: 0.012610

      485500 -- (-829.378) [-828.044] (-831.817) (-829.094) * (-829.856) (-829.598) (-828.723) [-828.008] -- 0:00:30
      486000 -- (-827.858) (-833.107) [-828.945] (-828.978) * [-829.060] (-829.296) (-827.104) (-827.650) -- 0:00:30
      486500 -- (-831.039) [-827.603] (-829.630) (-832.465) * (-828.301) (-829.562) (-827.816) [-831.041] -- 0:00:30
      487000 -- [-830.343] (-828.509) (-828.366) (-830.251) * (-828.118) [-827.584] (-829.761) (-830.602) -- 0:00:30
      487500 -- (-832.455) [-830.863] (-829.151) (-830.331) * (-829.189) (-827.942) [-828.734] (-830.714) -- 0:00:30
      488000 -- (-827.328) (-828.020) [-828.839] (-829.850) * (-828.377) (-832.688) [-828.485] (-828.966) -- 0:00:30
      488500 -- (-827.339) (-827.922) [-828.260] (-829.464) * (-828.285) (-827.915) (-828.853) [-827.094] -- 0:00:30
      489000 -- (-828.532) (-828.872) [-827.982] (-827.253) * (-828.251) [-828.146] (-830.667) (-826.992) -- 0:00:30
      489500 -- (-827.877) (-829.910) (-830.244) [-827.107] * (-831.440) (-828.789) (-830.812) [-829.137] -- 0:00:30
      490000 -- (-830.281) (-830.433) (-829.508) [-829.748] * (-828.892) [-830.896] (-827.922) (-829.437) -- 0:00:30

      Average standard deviation of split frequencies: 0.012490

      490500 -- (-829.529) (-828.222) (-829.064) [-830.062] * (-827.151) (-827.693) (-828.297) [-831.266] -- 0:00:30
      491000 -- (-831.233) (-828.595) (-830.651) [-829.555] * [-829.313] (-827.692) (-830.234) (-830.480) -- 0:00:30
      491500 -- (-828.959) [-830.432] (-832.535) (-830.639) * (-830.047) (-829.184) (-827.925) [-827.628] -- 0:00:30
      492000 -- (-831.321) (-829.918) (-833.047) [-828.950] * (-828.126) [-828.038] (-829.392) (-831.730) -- 0:00:29
      492500 -- (-830.582) (-832.080) (-829.770) [-827.911] * (-827.416) [-828.044] (-829.564) (-830.185) -- 0:00:30
      493000 -- (-827.941) (-830.940) (-829.889) [-827.997] * [-827.708] (-828.034) (-829.094) (-829.906) -- 0:00:30
      493500 -- (-828.192) (-830.988) [-827.851] (-828.498) * [-828.342] (-829.206) (-827.985) (-834.795) -- 0:00:30
      494000 -- (-826.870) (-828.085) (-829.447) [-833.955] * [-827.947] (-830.585) (-827.248) (-827.810) -- 0:00:30
      494500 -- [-828.163] (-829.218) (-826.907) (-829.644) * (-829.213) [-829.354] (-827.233) (-833.876) -- 0:00:30
      495000 -- (-827.254) (-828.201) [-827.672] (-829.651) * (-827.112) (-828.878) [-827.143] (-832.401) -- 0:00:30

      Average standard deviation of split frequencies: 0.012415

      495500 -- (-828.539) [-830.942] (-831.030) (-830.496) * (-831.163) (-827.984) [-828.911] (-829.478) -- 0:00:30
      496000 -- [-827.909] (-830.189) (-830.864) (-827.778) * [-834.117] (-827.647) (-831.352) (-827.203) -- 0:00:30
      496500 -- (-827.697) [-827.084] (-828.008) (-831.244) * (-829.937) (-829.892) (-827.592) [-831.132] -- 0:00:30
      497000 -- (-827.465) [-831.505] (-828.946) (-829.749) * (-829.926) (-827.618) [-827.475] (-828.347) -- 0:00:30
      497500 -- (-828.187) [-829.547] (-829.315) (-828.290) * (-830.139) [-828.301] (-830.531) (-827.534) -- 0:00:30
      498000 -- (-827.456) (-826.889) (-830.243) [-829.724] * (-830.421) (-829.768) (-828.592) [-829.738] -- 0:00:30
      498500 -- (-830.266) (-829.011) (-831.982) [-828.644] * (-828.804) (-829.512) (-829.135) [-833.961] -- 0:00:30
      499000 -- [-827.502] (-828.500) (-832.461) (-829.356) * [-827.865] (-829.033) (-829.308) (-834.527) -- 0:00:30
      499500 -- (-828.134) [-828.748] (-828.298) (-830.185) * (-830.921) (-830.142) [-829.535] (-829.976) -- 0:00:30
      500000 -- (-830.925) (-828.481) [-829.204] (-831.442) * (-830.911) [-829.250] (-828.357) (-827.767) -- 0:00:30

      Average standard deviation of split frequencies: 0.012181

      500500 -- (-826.931) [-827.828] (-828.758) (-830.002) * (-829.256) [-829.414] (-829.993) (-832.540) -- 0:00:29
      501000 -- (-828.150) [-827.490] (-830.403) (-830.767) * (-828.322) (-827.436) (-832.080) [-827.957] -- 0:00:29
      501500 -- [-828.939] (-827.049) (-831.663) (-828.909) * (-828.135) (-828.221) (-830.712) [-830.679] -- 0:00:29
      502000 -- (-827.631) [-828.174] (-827.925) (-828.715) * (-832.206) [-829.853] (-830.135) (-830.109) -- 0:00:29
      502500 -- (-831.751) (-829.112) (-829.208) [-829.842] * [-829.406] (-828.547) (-833.629) (-827.893) -- 0:00:29
      503000 -- (-827.801) (-827.341) (-829.513) [-827.768] * (-828.119) (-829.900) (-831.352) [-829.334] -- 0:00:29
      503500 -- [-827.127] (-828.959) (-827.291) (-827.966) * (-832.504) [-829.147] (-830.506) (-829.389) -- 0:00:29
      504000 -- (-830.649) (-829.352) (-827.944) [-827.054] * (-831.326) (-828.112) (-830.481) [-830.072] -- 0:00:29
      504500 -- (-830.072) (-830.657) [-829.104] (-834.491) * (-835.194) (-829.746) (-831.140) [-828.766] -- 0:00:29
      505000 -- (-827.588) [-831.182] (-831.620) (-829.701) * (-829.376) (-834.683) (-829.576) [-833.407] -- 0:00:29

      Average standard deviation of split frequencies: 0.011937

      505500 -- (-829.299) (-834.741) (-830.110) [-828.096] * [-828.224] (-828.840) (-832.573) (-829.260) -- 0:00:29
      506000 -- (-827.707) (-829.799) (-827.675) [-831.422] * (-828.039) (-829.126) (-829.516) [-827.698] -- 0:00:29
      506500 -- (-828.555) [-830.838] (-828.783) (-827.801) * (-832.392) (-828.924) [-827.044] (-828.896) -- 0:00:29
      507000 -- [-829.486] (-828.078) (-831.753) (-831.625) * (-827.631) (-829.260) [-827.963] (-830.267) -- 0:00:29
      507500 -- [-828.621] (-832.365) (-827.922) (-830.333) * (-828.016) [-828.158] (-828.477) (-829.076) -- 0:00:29
      508000 -- [-829.479] (-827.851) (-829.723) (-829.736) * (-828.048) (-829.263) (-828.587) [-829.074] -- 0:00:29
      508500 -- (-828.563) (-828.058) [-830.050] (-829.286) * [-828.722] (-832.551) (-828.595) (-836.194) -- 0:00:28
      509000 -- (-827.416) (-829.299) (-829.728) [-827.978] * (-834.444) (-830.558) [-830.901] (-828.165) -- 0:00:29
      509500 -- (-833.357) (-827.544) [-828.106] (-827.145) * (-832.925) (-830.776) (-828.021) [-829.659] -- 0:00:29
      510000 -- (-829.691) (-828.425) [-827.209] (-826.851) * (-834.092) [-827.584] (-828.567) (-830.382) -- 0:00:29

      Average standard deviation of split frequencies: 0.012174

      510500 -- (-830.342) (-829.429) (-826.890) [-829.212] * [-827.621] (-829.163) (-828.884) (-829.800) -- 0:00:29
      511000 -- (-829.250) [-827.881] (-827.818) (-830.011) * [-828.977] (-830.195) (-829.729) (-830.495) -- 0:00:29
      511500 -- (-832.544) [-827.999] (-827.483) (-832.493) * (-827.522) (-829.247) [-828.962] (-829.415) -- 0:00:29
      512000 -- (-830.345) (-830.784) (-833.572) [-827.553] * (-828.200) (-828.488) (-829.552) [-829.497] -- 0:00:29
      512500 -- (-829.084) [-828.784] (-829.719) (-834.696) * (-827.995) (-828.907) (-828.735) [-827.789] -- 0:00:29
      513000 -- (-827.782) (-829.883) [-831.921] (-827.204) * (-829.716) (-828.677) (-827.648) [-827.600] -- 0:00:29
      513500 -- (-829.715) (-829.261) (-828.036) [-827.449] * (-826.946) (-828.665) [-828.176] (-828.313) -- 0:00:29
      514000 -- (-830.862) (-835.681) (-832.300) [-831.103] * (-830.172) (-829.163) [-828.627] (-827.430) -- 0:00:29
      514500 -- (-831.683) (-828.832) [-827.833] (-828.573) * (-830.949) [-829.429] (-827.798) (-828.785) -- 0:00:29
      515000 -- (-833.329) (-827.552) (-831.148) [-829.927] * (-834.035) (-829.515) (-829.920) [-829.762] -- 0:00:29

      Average standard deviation of split frequencies: 0.012219

      515500 -- [-833.330] (-829.514) (-830.088) (-830.319) * [-830.263] (-827.856) (-834.253) (-827.217) -- 0:00:29
      516000 -- [-830.210] (-830.492) (-830.197) (-832.023) * [-830.290] (-827.315) (-832.676) (-831.719) -- 0:00:29
      516500 -- (-829.418) (-830.137) (-831.709) [-827.406] * [-829.485] (-829.979) (-829.460) (-829.011) -- 0:00:29
      517000 -- (-828.363) (-829.843) (-831.731) [-828.595] * (-830.528) (-827.685) (-830.223) [-827.250] -- 0:00:28
      517500 -- (-833.073) (-828.297) (-828.285) [-828.042] * (-827.236) (-830.005) (-828.722) [-829.058] -- 0:00:28
      518000 -- (-828.020) [-827.941] (-828.586) (-828.759) * (-830.308) (-829.104) (-829.617) [-827.461] -- 0:00:28
      518500 -- (-832.910) (-828.477) (-829.632) [-827.767] * (-831.539) (-828.629) [-830.219] (-827.098) -- 0:00:28
      519000 -- (-828.329) (-828.887) (-830.648) [-829.106] * (-828.602) (-828.534) (-827.629) [-827.441] -- 0:00:28
      519500 -- (-827.737) (-829.826) [-827.050] (-828.027) * [-832.215] (-829.257) (-831.610) (-827.404) -- 0:00:28
      520000 -- (-828.512) [-831.814] (-828.178) (-828.010) * [-829.415] (-829.223) (-835.606) (-827.924) -- 0:00:28

      Average standard deviation of split frequencies: 0.012166

      520500 -- (-828.723) [-828.363] (-828.916) (-827.860) * (-828.665) [-829.223] (-832.200) (-827.310) -- 0:00:28
      521000 -- [-827.737] (-829.024) (-827.504) (-831.337) * (-831.150) (-830.558) [-829.573] (-827.749) -- 0:00:28
      521500 -- [-830.310] (-829.154) (-829.816) (-827.842) * [-827.682] (-835.915) (-829.851) (-827.604) -- 0:00:28
      522000 -- (-829.464) [-829.565] (-827.623) (-829.319) * [-830.647] (-827.603) (-828.109) (-829.952) -- 0:00:28
      522500 -- (-827.718) (-830.982) (-829.927) [-827.156] * (-829.693) [-827.767] (-828.544) (-829.300) -- 0:00:28
      523000 -- (-829.571) (-833.493) (-828.369) [-827.638] * [-830.329] (-830.504) (-827.336) (-827.349) -- 0:00:28
      523500 -- [-829.168] (-831.245) (-829.823) (-827.371) * (-831.068) (-828.008) (-830.477) [-827.277] -- 0:00:28
      524000 -- (-830.455) (-837.700) [-827.626] (-827.394) * (-832.252) [-827.732] (-828.324) (-832.352) -- 0:00:28
      524500 -- [-830.144] (-833.028) (-827.500) (-828.557) * (-832.099) (-827.411) [-827.814] (-830.187) -- 0:00:28
      525000 -- [-830.063] (-827.896) (-829.014) (-832.595) * (-828.875) (-834.243) [-829.071] (-830.157) -- 0:00:28

      Average standard deviation of split frequencies: 0.011819

      525500 -- (-834.567) (-830.194) (-829.002) [-828.300] * (-830.816) [-828.926] (-828.484) (-831.082) -- 0:00:28
      526000 -- (-834.611) [-832.154] (-827.640) (-830.792) * (-829.851) [-829.392] (-828.028) (-831.457) -- 0:00:28
      526500 -- (-828.042) (-833.854) [-827.476] (-828.016) * (-831.163) [-829.856] (-830.001) (-833.921) -- 0:00:28
      527000 -- [-828.727] (-830.070) (-828.274) (-828.566) * (-828.468) [-832.191] (-828.516) (-831.995) -- 0:00:28
      527500 -- (-829.921) (-829.016) [-828.628] (-830.080) * (-827.489) [-830.016] (-827.567) (-827.693) -- 0:00:28
      528000 -- (-828.769) (-828.808) (-830.407) [-828.748] * (-827.601) (-828.107) [-828.426] (-828.333) -- 0:00:28
      528500 -- (-829.025) [-827.852] (-827.636) (-832.291) * (-828.320) [-828.883] (-827.982) (-829.904) -- 0:00:28
      529000 -- [-827.858] (-828.488) (-829.536) (-827.343) * [-831.355] (-830.406) (-827.413) (-827.959) -- 0:00:28
      529500 -- (-828.783) [-830.536] (-830.390) (-828.605) * (-830.017) (-830.271) (-830.423) [-830.000] -- 0:00:28
      530000 -- [-829.262] (-830.781) (-832.028) (-830.866) * [-830.832] (-830.267) (-833.660) (-829.241) -- 0:00:28

      Average standard deviation of split frequencies: 0.011548

      530500 -- (-831.422) [-827.933] (-832.919) (-830.071) * (-827.330) [-829.060] (-832.014) (-830.558) -- 0:00:28
      531000 -- [-828.476] (-831.407) (-828.255) (-827.833) * [-828.506] (-832.765) (-835.445) (-831.277) -- 0:00:28
      531500 -- (-828.273) [-829.094] (-828.109) (-832.079) * (-828.224) [-829.162] (-828.132) (-827.584) -- 0:00:28
      532000 -- (-830.970) (-827.349) (-830.459) [-829.483] * (-827.800) (-828.305) [-829.495] (-827.746) -- 0:00:28
      532500 -- (-829.509) (-829.011) [-829.025] (-831.973) * (-828.457) (-829.121) (-831.482) [-829.447] -- 0:00:28
      533000 -- (-827.532) (-827.168) (-827.577) [-828.243] * (-830.598) (-827.362) (-829.018) [-828.309] -- 0:00:28
      533500 -- (-826.766) (-827.953) [-828.025] (-827.559) * (-827.050) [-827.539] (-829.192) (-830.869) -- 0:00:27
      534000 -- (-828.420) (-828.466) (-827.092) [-828.907] * [-828.007] (-830.484) (-831.601) (-830.085) -- 0:00:27
      534500 -- [-828.153] (-830.479) (-837.011) (-828.612) * [-829.742] (-830.098) (-827.268) (-828.538) -- 0:00:27
      535000 -- (-828.301) (-827.807) [-833.611] (-829.175) * (-831.046) [-828.370] (-828.109) (-827.060) -- 0:00:27

      Average standard deviation of split frequencies: 0.010994

      535500 -- (-827.732) [-826.835] (-830.542) (-829.932) * (-830.110) [-829.404] (-828.179) (-827.618) -- 0:00:27
      536000 -- (-829.475) (-829.151) [-829.821] (-827.492) * (-829.459) (-831.530) [-829.665] (-828.611) -- 0:00:27
      536500 -- [-826.899] (-829.763) (-829.212) (-829.543) * (-829.459) (-831.586) (-827.927) [-827.117] -- 0:00:27
      537000 -- (-827.298) (-829.868) [-830.195] (-828.000) * [-827.804] (-832.366) (-830.026) (-827.974) -- 0:00:27
      537500 -- (-827.786) (-828.911) [-831.226] (-828.911) * [-832.246] (-831.846) (-830.494) (-827.515) -- 0:00:27
      538000 -- (-828.286) (-828.737) [-829.914] (-830.205) * (-834.061) [-829.646] (-830.005) (-827.589) -- 0:00:27
      538500 -- (-831.018) (-830.268) (-830.347) [-830.262] * (-835.505) (-829.166) [-830.393] (-828.419) -- 0:00:27
      539000 -- [-829.061] (-831.638) (-828.082) (-831.621) * (-830.046) (-832.169) (-828.624) [-827.146] -- 0:00:27
      539500 -- [-827.665] (-829.148) (-828.028) (-828.711) * (-827.793) (-838.403) [-828.151] (-828.673) -- 0:00:27
      540000 -- (-828.846) [-831.166] (-828.214) (-827.737) * (-827.404) (-828.712) [-827.477] (-829.112) -- 0:00:27

      Average standard deviation of split frequencies: 0.011280

      540500 -- [-828.685] (-828.787) (-828.382) (-829.725) * [-827.951] (-829.351) (-827.231) (-830.737) -- 0:00:27
      541000 -- (-830.306) (-833.206) (-830.456) [-829.291] * (-833.065) (-828.479) (-832.225) [-827.128] -- 0:00:27
      541500 -- [-827.872] (-828.145) (-833.092) (-828.986) * (-829.226) (-828.138) [-829.315] (-827.164) -- 0:00:27
      542000 -- [-830.591] (-829.402) (-832.096) (-827.763) * (-827.474) [-829.152] (-828.033) (-828.039) -- 0:00:27
      542500 -- (-829.976) (-830.306) (-828.288) [-827.984] * (-830.076) [-826.818] (-829.062) (-827.058) -- 0:00:27
      543000 -- (-829.604) [-829.922] (-828.215) (-833.946) * [-830.074] (-830.970) (-831.507) (-828.036) -- 0:00:27
      543500 -- (-830.722) (-828.411) [-828.215] (-828.340) * (-830.046) [-829.617] (-830.461) (-832.491) -- 0:00:27
      544000 -- (-829.797) (-828.831) (-828.805) [-829.073] * (-827.425) (-828.970) (-831.862) [-828.573] -- 0:00:27
      544500 -- (-829.783) (-828.174) [-828.075] (-828.391) * (-827.788) (-829.239) [-827.793] (-827.371) -- 0:00:27
      545000 -- [-827.955] (-827.884) (-830.224) (-829.312) * (-829.198) (-827.689) [-827.644] (-827.354) -- 0:00:27

      Average standard deviation of split frequencies: 0.011062

      545500 -- (-827.928) (-829.346) (-828.214) [-828.393] * (-828.481) (-830.684) [-827.934] (-829.532) -- 0:00:27
      546000 -- (-827.659) (-831.505) (-827.204) [-830.534] * [-828.296] (-830.391) (-830.411) (-833.378) -- 0:00:27
      546500 -- (-828.959) [-826.905] (-832.878) (-836.205) * (-827.606) [-827.858] (-830.307) (-832.480) -- 0:00:27
      547000 -- (-829.112) [-827.238] (-830.761) (-829.293) * (-827.701) [-829.371] (-830.541) (-829.087) -- 0:00:27
      547500 -- (-828.371) (-827.524) [-832.400] (-827.833) * (-829.743) [-828.886] (-828.430) (-828.181) -- 0:00:27
      548000 -- [-827.924] (-827.573) (-827.230) (-828.820) * (-830.856) [-830.001] (-830.324) (-828.032) -- 0:00:27
      548500 -- (-829.280) [-829.672] (-828.148) (-828.397) * [-830.866] (-828.143) (-827.522) (-827.228) -- 0:00:27
      549000 -- (-829.020) [-830.404] (-827.599) (-829.592) * (-828.944) (-831.123) [-827.228] (-829.071) -- 0:00:27
      549500 -- (-833.891) (-830.857) [-827.829] (-832.131) * [-829.294] (-832.304) (-830.202) (-827.468) -- 0:00:27
      550000 -- (-831.998) (-830.419) (-828.515) [-829.278] * (-826.830) (-830.720) (-830.289) [-829.453] -- 0:00:27

      Average standard deviation of split frequencies: 0.010915

      550500 -- (-833.848) (-828.487) (-829.392) [-828.369] * (-829.870) (-829.272) (-828.232) [-831.358] -- 0:00:26
      551000 -- (-827.985) (-831.156) [-828.264] (-828.856) * (-828.335) (-829.927) [-828.347] (-828.840) -- 0:00:26
      551500 -- [-827.888] (-828.951) (-828.037) (-829.147) * (-829.172) (-833.256) [-829.107] (-830.356) -- 0:00:26
      552000 -- (-830.763) (-827.776) (-828.237) [-831.334] * (-829.645) (-833.058) (-827.647) [-830.443] -- 0:00:26
      552500 -- (-828.021) (-831.816) [-830.155] (-831.456) * (-832.719) (-830.588) [-828.263] (-831.796) -- 0:00:26
      553000 -- [-828.083] (-828.405) (-829.849) (-828.383) * (-835.893) (-827.926) [-830.058] (-828.408) -- 0:00:26
      553500 -- (-831.318) (-827.548) [-830.995] (-829.258) * (-831.638) (-829.292) (-833.768) [-827.380] -- 0:00:26
      554000 -- (-827.240) (-828.290) (-831.215) [-828.149] * [-832.426] (-827.055) (-831.653) (-829.831) -- 0:00:26
      554500 -- (-829.035) [-828.991] (-832.168) (-830.932) * (-829.119) [-828.437] (-830.137) (-828.566) -- 0:00:26
      555000 -- (-829.394) [-829.753] (-827.786) (-829.885) * (-828.558) (-830.959) (-830.725) [-828.302] -- 0:00:26

      Average standard deviation of split frequencies: 0.010015

      555500 -- (-829.163) [-828.703] (-828.315) (-829.116) * (-827.741) (-829.931) (-830.899) [-829.456] -- 0:00:26
      556000 -- [-829.735] (-829.030) (-831.001) (-830.956) * (-828.976) [-827.705] (-827.446) (-829.910) -- 0:00:26
      556500 -- [-828.748] (-827.611) (-827.901) (-832.868) * [-828.878] (-832.277) (-831.768) (-831.038) -- 0:00:26
      557000 -- [-830.457] (-828.814) (-828.687) (-832.710) * (-827.251) (-832.235) (-831.645) [-827.687] -- 0:00:26
      557500 -- [-830.106] (-829.435) (-828.992) (-828.760) * [-827.761] (-834.500) (-838.138) (-827.704) -- 0:00:26
      558000 -- (-828.954) [-830.007] (-829.379) (-827.544) * (-831.937) (-833.645) [-829.015] (-829.743) -- 0:00:26
      558500 -- (-828.699) (-826.884) (-827.943) [-828.415] * (-827.655) (-830.792) [-829.557] (-831.493) -- 0:00:26
      559000 -- (-830.172) (-827.407) (-827.521) [-829.310] * (-828.162) [-827.607] (-830.564) (-831.972) -- 0:00:26
      559500 -- [-828.940] (-829.103) (-830.636) (-829.587) * (-828.590) (-830.088) (-829.701) [-830.490] -- 0:00:26
      560000 -- (-831.157) [-830.959] (-832.223) (-828.564) * [-829.850] (-829.279) (-829.799) (-828.312) -- 0:00:26

      Average standard deviation of split frequencies: 0.010247

      560500 -- (-830.170) (-829.601) (-828.878) [-829.792] * (-829.944) (-830.776) [-826.809] (-829.281) -- 0:00:26
      561000 -- (-830.455) (-830.060) [-829.025] (-827.809) * (-829.093) (-828.194) [-829.049] (-826.908) -- 0:00:26
      561500 -- (-834.286) (-827.960) [-829.978] (-833.360) * (-827.722) [-828.198] (-829.544) (-828.052) -- 0:00:26
      562000 -- (-827.902) [-828.219] (-828.624) (-827.725) * [-829.998] (-827.860) (-829.048) (-828.766) -- 0:00:26
      562500 -- (-828.942) [-829.104] (-830.447) (-828.646) * [-829.467] (-828.624) (-827.902) (-829.367) -- 0:00:26
      563000 -- (-829.535) (-828.480) [-829.217] (-828.701) * (-830.045) (-828.919) [-828.011] (-829.650) -- 0:00:26
      563500 -- (-828.637) (-828.834) (-831.167) [-828.261] * [-828.186] (-830.418) (-826.778) (-831.271) -- 0:00:26
      564000 -- (-828.032) (-829.699) (-826.658) [-829.238] * [-829.405] (-827.910) (-826.984) (-830.203) -- 0:00:26
      564500 -- (-829.585) (-830.065) [-827.135] (-832.412) * (-830.578) (-827.755) [-828.514] (-829.749) -- 0:00:26
      565000 -- (-832.162) (-829.385) [-829.114] (-827.276) * [-831.135] (-828.003) (-827.580) (-829.183) -- 0:00:26

      Average standard deviation of split frequencies: 0.009890

      565500 -- (-834.451) [-828.675] (-826.978) (-827.232) * (-828.938) [-829.249] (-829.901) (-832.946) -- 0:00:26
      566000 -- (-835.154) (-829.483) (-828.080) [-827.776] * [-830.413] (-833.636) (-833.642) (-829.320) -- 0:00:26
      566500 -- (-834.228) (-830.968) (-832.203) [-827.985] * (-831.453) [-832.449] (-828.392) (-828.742) -- 0:00:26
      567000 -- (-828.347) [-828.868] (-827.983) (-827.526) * (-831.445) (-830.351) [-828.670] (-827.562) -- 0:00:25
      567500 -- [-827.606] (-827.750) (-833.557) (-828.802) * (-829.373) [-828.691] (-827.471) (-827.359) -- 0:00:25
      568000 -- (-830.005) [-827.550] (-830.860) (-829.666) * (-828.128) (-830.240) [-827.222] (-829.402) -- 0:00:25
      568500 -- [-828.185] (-827.824) (-831.851) (-829.238) * [-828.674] (-829.654) (-828.528) (-828.633) -- 0:00:25
      569000 -- (-829.227) (-827.080) [-830.518] (-827.574) * [-827.692] (-832.695) (-829.211) (-829.008) -- 0:00:25
      569500 -- [-829.495] (-829.356) (-828.083) (-834.525) * (-830.823) (-833.645) (-831.376) [-830.821] -- 0:00:25
      570000 -- [-828.015] (-828.217) (-827.794) (-829.772) * [-829.862] (-830.644) (-827.547) (-828.492) -- 0:00:25

      Average standard deviation of split frequencies: 0.009913

      570500 -- (-828.488) (-829.714) [-837.659] (-829.320) * (-829.344) (-833.877) [-828.189] (-827.926) -- 0:00:25
      571000 -- (-831.302) (-831.427) (-831.171) [-829.553] * (-827.300) [-829.652] (-830.069) (-827.750) -- 0:00:25
      571500 -- (-828.683) (-829.027) (-828.819) [-827.643] * [-827.339] (-829.704) (-829.500) (-830.935) -- 0:00:25
      572000 -- (-827.955) (-833.046) [-828.721] (-827.551) * (-829.581) [-828.301] (-827.269) (-827.386) -- 0:00:25
      572500 -- [-828.847] (-830.709) (-828.918) (-827.941) * (-827.412) (-830.122) [-827.484] (-828.827) -- 0:00:25
      573000 -- (-827.134) (-829.120) (-831.249) [-828.020] * (-827.540) [-828.916] (-831.334) (-831.597) -- 0:00:25
      573500 -- [-829.100] (-834.870) (-831.493) (-828.427) * (-828.989) (-831.594) (-828.044) [-829.674] -- 0:00:25
      574000 -- (-827.536) (-830.864) [-827.171] (-827.267) * (-829.384) (-832.342) [-827.491] (-827.243) -- 0:00:25
      574500 -- (-826.987) (-828.829) (-829.584) [-828.635] * (-831.523) [-828.166] (-828.741) (-828.455) -- 0:00:25
      575000 -- (-828.364) (-829.040) [-829.184] (-828.782) * (-828.628) (-829.611) [-830.028] (-828.620) -- 0:00:25

      Average standard deviation of split frequencies: 0.009616

      575500 -- (-827.437) (-828.230) [-831.811] (-828.215) * (-828.474) [-827.634] (-827.862) (-829.815) -- 0:00:25
      576000 -- [-827.491] (-828.066) (-827.996) (-833.356) * (-828.629) (-830.226) [-827.879] (-829.402) -- 0:00:25
      576500 -- (-827.491) [-830.995] (-829.889) (-829.951) * (-828.405) (-829.375) [-831.083] (-828.015) -- 0:00:25
      577000 -- (-828.308) (-826.821) (-827.883) [-831.238] * (-828.708) (-829.536) (-831.813) [-828.775] -- 0:00:25
      577500 -- (-827.510) (-827.232) (-827.580) [-829.842] * (-829.819) (-827.161) (-828.350) [-827.375] -- 0:00:25
      578000 -- [-827.750] (-828.526) (-830.145) (-827.582) * (-828.739) (-828.517) [-830.283] (-827.086) -- 0:00:25
      578500 -- [-827.065] (-827.668) (-827.779) (-829.508) * (-829.648) (-829.746) (-827.482) [-828.746] -- 0:00:25
      579000 -- (-829.354) (-828.542) [-827.935] (-829.242) * [-830.087] (-830.478) (-828.867) (-832.346) -- 0:00:25
      579500 -- (-833.585) (-829.175) (-828.294) [-827.898] * (-831.376) (-828.102) (-827.630) [-829.871] -- 0:00:25
      580000 -- (-833.754) (-828.858) [-827.963] (-828.563) * (-831.117) [-827.187] (-832.273) (-829.646) -- 0:00:25

      Average standard deviation of split frequencies: 0.009133

      580500 -- (-829.592) [-828.156] (-827.706) (-826.976) * (-829.795) [-828.050] (-828.650) (-828.451) -- 0:00:25
      581000 -- (-827.566) (-827.279) (-827.546) [-830.961] * [-831.144] (-828.885) (-828.379) (-829.820) -- 0:00:25
      581500 -- (-828.943) [-826.678] (-831.472) (-828.256) * (-829.251) [-828.529] (-826.971) (-829.325) -- 0:00:25
      582000 -- (-831.672) (-826.782) [-829.045] (-828.997) * (-828.533) [-828.052] (-827.215) (-829.563) -- 0:00:25
      582500 -- (-829.548) [-829.798] (-830.081) (-828.540) * (-828.654) [-826.820] (-828.573) (-831.012) -- 0:00:25
      583000 -- (-834.501) (-829.279) [-830.600] (-829.123) * [-830.431] (-828.179) (-828.569) (-828.508) -- 0:00:25
      583500 -- [-828.596] (-829.119) (-827.813) (-828.983) * (-829.850) [-827.528] (-828.773) (-830.194) -- 0:00:24
      584000 -- (-829.774) (-830.491) (-832.817) [-829.363] * [-827.945] (-832.082) (-831.006) (-828.143) -- 0:00:24
      584500 -- (-829.762) (-829.436) (-828.146) [-828.410] * (-827.584) [-828.097] (-828.549) (-829.195) -- 0:00:24
      585000 -- [-828.039] (-828.118) (-827.224) (-827.577) * [-830.232] (-827.084) (-828.603) (-829.539) -- 0:00:24

      Average standard deviation of split frequencies: 0.008598

      585500 -- (-832.421) (-827.966) [-827.999] (-830.377) * [-829.238] (-831.024) (-828.424) (-830.174) -- 0:00:24
      586000 -- (-829.181) (-828.772) [-828.517] (-827.675) * (-827.880) (-835.553) (-834.835) [-828.631] -- 0:00:24
      586500 -- (-828.915) (-830.633) [-828.810] (-833.793) * (-831.483) [-828.544] (-829.228) (-827.585) -- 0:00:24
      587000 -- (-829.204) (-829.948) [-827.196] (-831.176) * [-836.093] (-830.749) (-829.966) (-830.977) -- 0:00:24
      587500 -- [-827.855] (-827.845) (-829.693) (-828.723) * (-831.263) (-828.315) (-834.233) [-827.576] -- 0:00:24
      588000 -- (-828.869) (-832.320) [-829.528] (-829.329) * (-829.606) (-829.312) (-831.750) [-827.666] -- 0:00:24
      588500 -- (-829.920) (-832.351) (-831.839) [-827.839] * [-827.670] (-829.387) (-835.724) (-828.678) -- 0:00:24
      589000 -- (-832.167) [-828.612] (-833.362) (-829.544) * (-829.539) (-829.716) (-827.584) [-831.270] -- 0:00:24
      589500 -- (-829.904) (-828.725) (-831.470) [-831.190] * (-827.468) (-831.201) [-828.833] (-829.025) -- 0:00:24
      590000 -- (-831.340) [-828.180] (-832.043) (-828.579) * [-828.305] (-829.695) (-828.299) (-830.232) -- 0:00:24

      Average standard deviation of split frequencies: 0.008081

      590500 -- (-831.556) (-829.491) (-833.391) [-827.707] * [-827.631] (-830.459) (-827.880) (-828.197) -- 0:00:24
      591000 -- (-832.228) (-827.794) [-828.119] (-829.317) * (-830.096) (-829.105) [-828.246] (-827.614) -- 0:00:24
      591500 -- (-829.633) (-828.404) [-828.715] (-828.252) * (-830.461) (-829.851) (-828.964) [-829.098] -- 0:00:24
      592000 -- (-829.333) [-828.360] (-830.364) (-827.953) * (-832.092) [-828.561] (-830.662) (-830.053) -- 0:00:24
      592500 -- (-831.075) (-829.982) [-829.483] (-828.340) * [-827.068] (-827.824) (-832.589) (-829.885) -- 0:00:24
      593000 -- (-833.324) (-827.976) (-828.729) [-829.912] * (-828.433) [-829.122] (-829.163) (-829.469) -- 0:00:24
      593500 -- (-826.885) (-830.540) (-829.570) [-830.623] * (-829.695) (-828.928) (-830.718) [-828.003] -- 0:00:24
      594000 -- (-830.448) (-828.692) (-827.948) [-827.705] * (-835.507) (-830.402) [-826.928] (-827.965) -- 0:00:24
      594500 -- (-826.788) (-829.790) (-827.708) [-828.014] * (-830.130) (-831.782) (-827.155) [-832.001] -- 0:00:24
      595000 -- (-830.159) (-831.579) (-829.460) [-828.593] * [-831.518] (-827.577) (-828.461) (-828.250) -- 0:00:24

      Average standard deviation of split frequencies: 0.007909

      595500 -- (-831.557) (-833.437) (-828.947) [-828.858] * (-829.239) (-828.955) (-830.346) [-830.299] -- 0:00:24
      596000 -- (-829.023) [-829.908] (-828.399) (-828.385) * [-828.509] (-834.693) (-829.657) (-830.455) -- 0:00:24
      596500 -- [-827.311] (-827.554) (-828.593) (-830.237) * [-829.474] (-828.153) (-829.010) (-832.105) -- 0:00:24
      597000 -- [-828.089] (-828.749) (-829.816) (-828.121) * (-828.028) (-828.634) (-834.833) [-829.380] -- 0:00:24
      597500 -- (-832.176) [-830.784] (-829.744) (-830.400) * [-829.235] (-828.058) (-832.812) (-834.998) -- 0:00:24
      598000 -- [-826.988] (-830.043) (-828.715) (-833.517) * [-831.496] (-831.761) (-830.388) (-829.580) -- 0:00:24
      598500 -- (-826.774) (-827.797) (-827.820) [-829.855] * (-829.271) [-827.409] (-830.051) (-830.177) -- 0:00:24
      599000 -- (-828.303) (-827.509) [-829.184] (-828.735) * (-827.209) [-827.286] (-831.842) (-829.006) -- 0:00:24
      599500 -- (-829.492) (-829.218) (-830.797) [-830.961] * (-827.304) [-828.220] (-828.473) (-830.625) -- 0:00:24
      600000 -- [-827.321] (-829.121) (-827.819) (-829.765) * (-832.434) [-827.395] (-830.420) (-830.324) -- 0:00:24

      Average standard deviation of split frequencies: 0.007946

      600500 -- (-827.927) (-828.087) [-828.042] (-828.583) * (-831.229) [-829.405] (-827.003) (-829.656) -- 0:00:23
      601000 -- (-829.583) (-827.818) [-827.911] (-828.187) * [-830.142] (-839.129) (-826.849) (-830.497) -- 0:00:23
      601500 -- (-829.754) [-828.097] (-828.073) (-828.193) * (-827.752) (-832.085) [-830.011] (-830.360) -- 0:00:23
      602000 -- [-829.301] (-830.338) (-829.841) (-827.462) * (-827.932) (-829.693) [-833.822] (-833.573) -- 0:00:23
      602500 -- (-828.616) (-831.804) (-828.346) [-828.696] * (-829.604) (-828.683) (-831.952) [-828.150] -- 0:00:23
      603000 -- (-827.079) (-827.881) [-829.224] (-828.225) * (-830.970) (-829.613) [-828.606] (-829.459) -- 0:00:23
      603500 -- [-830.563] (-828.680) (-829.249) (-829.952) * (-830.210) (-830.909) [-828.592] (-829.586) -- 0:00:23
      604000 -- (-829.562) [-829.988] (-828.782) (-828.909) * [-830.363] (-829.455) (-827.667) (-828.911) -- 0:00:23
      604500 -- [-830.197] (-828.100) (-827.719) (-833.708) * (-832.539) (-827.775) (-827.344) [-827.817] -- 0:00:23
      605000 -- (-827.668) (-827.541) [-827.395] (-831.322) * (-830.861) (-831.090) (-826.778) [-829.738] -- 0:00:23

      Average standard deviation of split frequencies: 0.007682

      605500 -- (-827.789) (-827.537) (-828.729) [-826.911] * (-828.544) (-828.579) (-826.814) [-830.504] -- 0:00:23
      606000 -- (-827.834) [-828.866] (-828.055) (-826.862) * [-831.500] (-829.016) (-827.203) (-827.441) -- 0:00:23
      606500 -- (-831.057) (-827.299) [-827.667] (-832.126) * (-827.564) (-827.207) [-827.149] (-830.814) -- 0:00:23
      607000 -- (-830.558) (-828.346) (-827.058) [-827.133] * (-826.959) [-829.052] (-827.764) (-826.886) -- 0:00:23
      607500 -- (-828.478) (-829.361) (-828.355) [-827.086] * [-828.978] (-828.959) (-829.014) (-827.375) -- 0:00:23
      608000 -- [-831.955] (-830.073) (-831.282) (-830.712) * (-828.147) [-830.966] (-828.098) (-827.374) -- 0:00:23
      608500 -- (-829.924) (-829.070) [-831.347] (-829.257) * (-829.322) [-830.162] (-829.314) (-829.907) -- 0:00:23
      609000 -- (-832.291) (-830.482) [-832.030] (-832.046) * [-828.050] (-829.999) (-827.942) (-829.164) -- 0:00:23
      609500 -- (-829.963) [-827.306] (-828.321) (-828.208) * (-826.810) (-827.813) (-827.170) [-830.540] -- 0:00:23
      610000 -- [-829.499] (-827.000) (-829.583) (-828.600) * [-828.815] (-828.995) (-828.996) (-829.914) -- 0:00:23

      Average standard deviation of split frequencies: 0.007478

      610500 -- [-830.915] (-829.810) (-827.377) (-828.701) * [-828.311] (-831.197) (-828.479) (-828.903) -- 0:00:23
      611000 -- [-826.791] (-827.538) (-828.651) (-828.545) * (-829.777) (-830.404) (-832.170) [-830.240] -- 0:00:23
      611500 -- (-826.907) [-827.723] (-829.760) (-830.443) * [-830.059] (-828.667) (-834.453) (-829.213) -- 0:00:23
      612000 -- (-827.553) (-831.255) [-830.054] (-828.941) * (-828.281) (-827.522) (-832.147) [-827.809] -- 0:00:23
      612500 -- (-828.183) [-834.347] (-830.189) (-832.188) * [-828.437] (-827.679) (-828.691) (-829.786) -- 0:00:23
      613000 -- (-827.904) (-830.331) (-830.169) [-829.057] * [-829.632] (-828.175) (-828.439) (-827.792) -- 0:00:23
      613500 -- [-827.621] (-830.419) (-827.440) (-829.296) * (-827.965) (-828.810) (-827.768) [-828.352] -- 0:00:23
      614000 -- (-827.735) [-832.428] (-830.022) (-827.449) * (-828.499) (-829.991) [-829.323] (-831.389) -- 0:00:23
      614500 -- (-829.006) (-827.929) [-828.058] (-828.609) * (-829.786) [-828.608] (-827.922) (-829.794) -- 0:00:23
      615000 -- (-827.732) (-828.373) (-827.869) [-830.080] * [-828.586] (-828.763) (-832.196) (-828.453) -- 0:00:23

      Average standard deviation of split frequencies: 0.007318

      615500 -- [-827.824] (-827.471) (-835.086) (-832.805) * (-828.248) [-828.637] (-830.269) (-829.585) -- 0:00:23
      616000 -- (-828.301) (-830.187) (-833.563) [-829.303] * (-826.701) (-826.872) [-827.690] (-829.137) -- 0:00:23
      616500 -- (-830.591) (-831.233) (-830.010) [-828.044] * (-831.137) (-826.904) [-828.642] (-827.896) -- 0:00:23
      617000 -- (-827.760) (-830.085) [-831.795] (-829.152) * [-828.239] (-830.057) (-828.095) (-828.050) -- 0:00:22
      617500 -- (-827.654) (-829.735) (-829.614) [-828.329] * (-829.221) (-829.909) (-828.492) [-826.745] -- 0:00:22
      618000 -- (-830.437) [-829.370] (-828.180) (-830.300) * (-828.504) (-829.010) [-829.649] (-827.907) -- 0:00:22
      618500 -- [-832.852] (-827.972) (-828.523) (-828.627) * (-832.406) [-829.437] (-833.585) (-831.940) -- 0:00:22
      619000 -- (-828.828) (-828.020) [-830.683] (-830.292) * [-833.340] (-828.500) (-832.250) (-830.267) -- 0:00:22
      619500 -- (-829.200) (-827.102) [-827.868] (-832.452) * [-830.408] (-830.185) (-828.889) (-828.466) -- 0:00:22
      620000 -- (-829.025) (-827.080) (-829.150) [-832.184] * [-829.386] (-833.004) (-828.509) (-829.567) -- 0:00:22

      Average standard deviation of split frequencies: 0.007595

      620500 -- (-833.210) (-827.716) (-827.915) [-829.365] * (-832.257) (-829.673) (-830.033) [-828.524] -- 0:00:22
      621000 -- [-831.402] (-829.693) (-830.691) (-827.598) * (-832.598) [-827.695] (-829.980) (-826.972) -- 0:00:22
      621500 -- (-829.993) [-828.536] (-828.422) (-828.021) * (-834.380) [-831.212] (-827.637) (-827.857) -- 0:00:22
      622000 -- (-832.362) (-829.330) [-827.182] (-827.619) * (-827.928) [-827.892] (-827.281) (-830.974) -- 0:00:22
      622500 -- [-829.180] (-829.838) (-829.264) (-826.957) * (-829.078) (-828.455) [-828.929] (-831.215) -- 0:00:22
      623000 -- (-829.155) (-830.035) (-830.831) [-827.403] * (-828.702) [-827.742] (-829.425) (-827.615) -- 0:00:22
      623500 -- [-829.390] (-827.212) (-830.207) (-827.145) * (-829.699) (-832.043) (-828.362) [-831.591] -- 0:00:22
      624000 -- (-830.567) [-828.788] (-834.172) (-827.492) * (-829.541) (-827.842) [-833.846] (-829.538) -- 0:00:22
      624500 -- (-830.727) (-831.755) [-829.814] (-830.710) * (-833.445) [-828.928] (-840.217) (-833.994) -- 0:00:22
      625000 -- (-829.895) (-830.302) [-829.374] (-828.291) * [-829.292] (-827.920) (-830.076) (-829.395) -- 0:00:22

      Average standard deviation of split frequencies: 0.007625

      625500 -- [-829.987] (-829.171) (-833.752) (-830.080) * (-829.439) [-828.218] (-829.007) (-829.149) -- 0:00:22
      626000 -- (-827.629) [-826.762] (-830.647) (-829.992) * (-827.726) [-828.334] (-828.822) (-829.547) -- 0:00:22
      626500 -- (-828.291) (-827.275) [-830.770] (-827.963) * (-833.286) (-828.698) [-829.711] (-828.537) -- 0:00:22
      627000 -- (-828.928) [-828.459] (-830.575) (-828.209) * (-829.761) (-827.393) (-829.907) [-830.103] -- 0:00:22
      627500 -- (-827.811) (-828.669) (-827.055) [-827.743] * (-828.748) (-828.875) (-828.778) [-828.272] -- 0:00:22
      628000 -- (-832.041) (-827.344) [-830.314] (-831.575) * [-828.725] (-828.172) (-828.953) (-829.798) -- 0:00:22
      628500 -- (-830.498) (-829.352) [-828.775] (-831.060) * (-829.173) (-828.222) [-827.760] (-828.075) -- 0:00:22
      629000 -- (-828.815) (-835.015) (-829.979) [-828.659] * [-831.182] (-829.900) (-835.837) (-828.933) -- 0:00:22
      629500 -- (-829.902) (-829.137) [-827.830] (-829.062) * (-831.919) (-828.617) [-829.710] (-830.545) -- 0:00:22
      630000 -- (-828.213) (-830.147) [-831.441] (-828.043) * (-831.987) (-829.186) (-826.920) [-829.986] -- 0:00:22

      Average standard deviation of split frequencies: 0.007615

      630500 -- (-828.601) [-832.040] (-828.994) (-829.772) * (-832.958) (-827.304) [-827.724] (-829.854) -- 0:00:22
      631000 -- (-829.278) [-829.395] (-831.885) (-827.996) * (-826.681) (-827.163) (-832.546) [-828.407] -- 0:00:22
      631500 -- [-827.615] (-828.238) (-831.255) (-828.176) * (-830.069) [-828.651] (-831.274) (-829.068) -- 0:00:22
      632000 -- (-828.169) (-828.723) [-830.032] (-827.249) * (-826.926) [-833.285] (-827.322) (-829.873) -- 0:00:22
      632500 -- (-827.957) (-830.231) [-828.523] (-828.295) * (-833.360) [-828.163] (-829.808) (-829.329) -- 0:00:22
      633000 -- (-830.164) (-827.731) (-828.886) [-828.497] * (-834.685) [-829.015] (-827.052) (-829.885) -- 0:00:22
      633500 -- (-829.162) (-827.020) (-828.155) [-828.458] * [-831.515] (-834.058) (-828.527) (-830.562) -- 0:00:21
      634000 -- [-828.649] (-829.761) (-828.422) (-829.789) * (-834.513) [-831.065] (-827.466) (-828.463) -- 0:00:21
      634500 -- (-830.327) (-831.199) (-828.599) [-829.443] * (-830.732) [-828.854] (-829.127) (-827.619) -- 0:00:21
      635000 -- (-832.042) (-828.032) (-828.183) [-828.791] * (-833.427) [-828.269] (-827.572) (-831.745) -- 0:00:21

      Average standard deviation of split frequencies: 0.007968

      635500 -- [-828.278] (-839.131) (-827.684) (-830.762) * (-833.184) (-832.302) [-831.204] (-830.314) -- 0:00:21
      636000 -- [-828.748] (-828.976) (-828.788) (-828.567) * (-828.016) (-828.035) (-828.670) [-830.284] -- 0:00:21
      636500 -- (-827.487) (-828.702) (-831.003) [-827.396] * (-828.059) (-830.733) [-829.200] (-828.072) -- 0:00:21
      637000 -- (-829.761) (-827.505) (-831.512) [-827.058] * (-827.533) (-829.110) [-829.870] (-829.062) -- 0:00:21
      637500 -- [-828.130] (-827.902) (-830.805) (-829.494) * [-828.534] (-829.451) (-827.753) (-827.757) -- 0:00:21
      638000 -- [-827.870] (-831.456) (-830.528) (-830.019) * (-828.991) (-829.351) (-827.436) [-827.723] -- 0:00:21
      638500 -- (-828.923) (-833.718) (-829.594) [-829.928] * (-829.617) (-828.994) [-831.248] (-830.448) -- 0:00:21
      639000 -- (-827.828) [-829.771] (-832.223) (-828.358) * (-829.846) (-827.260) [-828.926] (-830.400) -- 0:00:21
      639500 -- (-828.412) (-827.926) [-826.991] (-829.071) * (-828.660) (-830.529) (-827.789) [-829.413] -- 0:00:21
      640000 -- (-827.436) [-827.210] (-828.348) (-831.666) * (-828.423) [-831.378] (-833.192) (-828.784) -- 0:00:21

      Average standard deviation of split frequencies: 0.007864

      640500 -- (-829.561) (-828.490) (-831.306) [-831.549] * (-831.634) (-827.513) (-831.099) [-828.456] -- 0:00:21
      641000 -- [-828.900] (-827.665) (-830.834) (-832.308) * (-829.715) [-828.911] (-828.733) (-826.803) -- 0:00:21
      641500 -- (-827.798) (-827.909) (-837.265) [-828.613] * (-829.782) (-829.531) [-828.439] (-828.193) -- 0:00:21
      642000 -- (-831.060) (-828.142) (-830.866) [-828.817] * (-831.192) (-831.486) (-829.247) [-829.319] -- 0:00:21
      642500 -- [-827.443] (-832.041) (-827.544) (-829.907) * [-830.059] (-829.337) (-831.771) (-828.611) -- 0:00:21
      643000 -- [-827.192] (-827.154) (-828.058) (-827.492) * (-827.904) (-829.456) [-827.703] (-828.935) -- 0:00:21
      643500 -- (-827.729) (-828.519) [-828.888] (-827.629) * (-831.287) (-827.692) (-829.663) [-827.836] -- 0:00:21
      644000 -- [-827.688] (-828.418) (-827.604) (-827.120) * (-828.937) [-827.467] (-832.433) (-835.290) -- 0:00:21
      644500 -- (-827.959) [-829.632] (-829.051) (-827.355) * (-828.819) (-826.910) (-829.277) [-828.534] -- 0:00:21
      645000 -- (-829.361) [-831.044] (-829.702) (-830.137) * (-830.274) [-827.495] (-829.902) (-830.848) -- 0:00:21

      Average standard deviation of split frequencies: 0.008209

      645500 -- (-829.772) (-828.189) [-828.170] (-830.840) * (-829.979) (-830.000) (-828.436) [-827.902] -- 0:00:21
      646000 -- (-831.418) (-828.218) [-827.465] (-828.414) * (-830.758) [-828.741] (-828.970) (-829.418) -- 0:00:21
      646500 -- (-829.228) (-829.408) (-827.114) [-828.568] * (-834.197) [-828.805] (-829.485) (-829.582) -- 0:00:21
      647000 -- [-827.362] (-828.706) (-828.597) (-829.751) * [-832.779] (-829.846) (-831.566) (-827.728) -- 0:00:21
      647500 -- (-828.199) (-829.320) [-831.387] (-828.544) * (-828.751) (-828.425) [-829.278] (-828.525) -- 0:00:21
      648000 -- (-830.882) (-828.775) [-827.991] (-827.977) * (-828.378) [-827.740] (-830.855) (-832.292) -- 0:00:21
      648500 -- (-831.325) (-829.039) [-827.602] (-830.690) * (-830.651) (-827.686) (-831.942) [-830.801] -- 0:00:21
      649000 -- (-828.892) [-827.284] (-830.676) (-829.768) * (-828.758) [-828.417] (-830.578) (-832.677) -- 0:00:21
      649500 -- [-830.208] (-827.188) (-827.940) (-829.206) * [-827.262] (-836.910) (-827.655) (-828.111) -- 0:00:21
      650000 -- (-831.973) (-827.087) [-829.201] (-828.753) * (-831.951) (-830.813) [-828.120] (-830.185) -- 0:00:21

      Average standard deviation of split frequencies: 0.008332

      650500 -- [-830.091] (-832.454) (-828.088) (-828.792) * (-830.628) (-831.432) (-829.083) [-827.380] -- 0:00:20
      651000 -- (-829.102) (-831.447) (-830.581) [-831.082] * [-827.624] (-828.781) (-828.797) (-828.455) -- 0:00:20
      651500 -- [-829.362] (-829.513) (-833.836) (-828.255) * [-828.754] (-827.521) (-832.118) (-830.369) -- 0:00:20
      652000 -- (-827.326) (-829.091) (-828.300) [-827.334] * (-829.784) [-827.806] (-827.115) (-827.011) -- 0:00:20
      652500 -- (-829.944) (-829.279) [-827.289] (-831.731) * (-827.784) (-828.615) [-828.687] (-829.620) -- 0:00:20
      653000 -- (-830.084) (-832.222) (-829.921) [-831.232] * (-827.920) (-829.637) [-828.717] (-831.584) -- 0:00:20
      653500 -- (-827.943) (-828.815) [-829.148] (-831.519) * (-827.223) (-831.184) [-828.391] (-831.290) -- 0:00:20
      654000 -- (-828.702) [-830.909] (-827.034) (-828.181) * (-827.605) (-827.425) (-827.256) [-830.096] -- 0:00:20
      654500 -- (-827.705) (-827.293) (-831.315) [-827.913] * (-829.598) (-829.910) (-833.505) [-830.853] -- 0:00:20
      655000 -- (-828.300) (-828.619) [-827.519] (-829.101) * [-832.170] (-833.427) (-828.273) (-831.884) -- 0:00:20

      Average standard deviation of split frequencies: 0.008309

      655500 -- [-827.856] (-827.110) (-826.904) (-828.829) * (-828.161) (-827.025) (-829.758) [-829.495] -- 0:00:20
      656000 -- (-830.642) [-828.075] (-827.277) (-830.034) * [-828.685] (-829.873) (-830.199) (-833.088) -- 0:00:20
      656500 -- (-831.608) [-828.286] (-828.066) (-830.442) * [-828.801] (-829.904) (-828.374) (-828.657) -- 0:00:20
      657000 -- [-828.896] (-828.713) (-828.415) (-828.463) * (-831.481) (-827.852) [-831.947] (-829.152) -- 0:00:20
      657500 -- (-828.588) (-836.724) [-828.876] (-827.488) * (-831.170) [-826.967] (-828.656) (-828.465) -- 0:00:20
      658000 -- (-828.439) (-828.732) (-827.832) [-830.301] * (-829.887) (-827.012) [-828.572] (-829.564) -- 0:00:20
      658500 -- [-828.891] (-827.198) (-831.548) (-830.457) * (-829.252) [-829.843] (-833.614) (-828.852) -- 0:00:20
      659000 -- (-831.216) (-827.568) [-833.408] (-828.136) * (-828.467) [-830.750] (-830.171) (-829.902) -- 0:00:20
      659500 -- (-827.617) (-828.809) [-828.755] (-828.323) * [-829.132] (-828.290) (-833.025) (-829.960) -- 0:00:20
      660000 -- [-828.675] (-829.186) (-827.659) (-829.069) * (-829.033) (-829.181) [-829.773] (-831.448) -- 0:00:20

      Average standard deviation of split frequencies: 0.008206

      660500 -- (-827.602) (-833.996) [-828.306] (-830.964) * (-831.006) (-827.837) [-830.916] (-827.758) -- 0:00:20
      661000 -- (-829.891) [-830.429] (-828.539) (-828.235) * (-827.830) (-832.391) (-828.856) [-829.519] -- 0:00:20
      661500 -- [-828.484] (-834.721) (-831.421) (-829.304) * [-827.676] (-830.018) (-830.457) (-830.093) -- 0:00:20
      662000 -- (-830.091) [-830.756] (-829.451) (-833.884) * (-826.775) (-830.015) [-829.829] (-831.867) -- 0:00:20
      662500 -- (-828.104) [-827.882] (-830.370) (-830.235) * (-828.660) (-827.239) [-830.677] (-828.544) -- 0:00:20
      663000 -- (-830.227) (-827.916) [-828.843] (-827.471) * [-829.367] (-827.246) (-829.432) (-827.863) -- 0:00:20
      663500 -- [-827.421] (-827.147) (-827.197) (-828.555) * (-828.101) (-827.409) (-829.202) [-826.940] -- 0:00:20
      664000 -- (-828.064) [-828.365] (-829.254) (-830.378) * [-827.952] (-832.512) (-827.374) (-827.660) -- 0:00:20
      664500 -- (-827.932) [-827.280] (-834.498) (-830.151) * (-830.288) [-827.361] (-827.615) (-829.508) -- 0:00:20
      665000 -- (-829.008) (-831.689) (-827.851) [-831.109] * (-827.929) (-827.800) [-828.819] (-830.100) -- 0:00:20

      Average standard deviation of split frequencies: 0.008007

      665500 -- (-827.573) (-828.270) [-827.846] (-827.327) * [-827.077] (-827.936) (-830.255) (-833.387) -- 0:00:20
      666000 -- [-827.693] (-829.387) (-828.123) (-830.579) * (-826.984) [-828.498] (-827.509) (-833.690) -- 0:00:20
      666500 -- (-833.084) (-829.022) [-828.661] (-827.607) * (-827.052) (-831.672) (-831.150) [-828.576] -- 0:00:20
      667000 -- (-832.508) (-828.452) [-830.028] (-827.605) * (-829.924) [-830.461] (-829.352) (-830.463) -- 0:00:19
      667500 -- (-832.943) (-828.554) (-830.792) [-827.929] * [-828.712] (-828.589) (-832.036) (-827.917) -- 0:00:19
      668000 -- [-832.961] (-826.824) (-829.255) (-827.097) * (-828.942) (-833.234) [-828.623] (-827.758) -- 0:00:19
      668500 -- (-829.198) [-828.794] (-830.993) (-827.640) * (-827.188) (-833.873) (-829.035) [-826.777] -- 0:00:19
      669000 -- (-827.953) (-829.668) (-830.442) [-836.083] * (-830.510) (-829.348) [-828.988] (-828.481) -- 0:00:19
      669500 -- (-827.388) (-831.259) [-830.336] (-828.344) * (-830.055) (-828.658) (-829.236) [-830.758] -- 0:00:19
      670000 -- (-828.300) (-827.970) (-829.497) [-831.328] * (-830.292) (-828.579) (-828.523) [-828.595] -- 0:00:19

      Average standard deviation of split frequencies: 0.008039

      670500 -- (-831.836) [-827.119] (-829.407) (-834.153) * (-829.366) [-829.057] (-832.303) (-828.572) -- 0:00:19
      671000 -- [-827.483] (-833.087) (-828.813) (-828.428) * (-829.189) [-829.020] (-828.362) (-829.710) -- 0:00:19
      671500 -- (-832.759) (-831.426) [-827.759] (-828.032) * (-829.789) [-829.775] (-828.654) (-827.464) -- 0:00:19
      672000 -- (-836.138) [-829.337] (-833.567) (-827.630) * (-827.418) (-826.770) (-831.394) [-829.363] -- 0:00:19
      672500 -- (-836.108) [-831.183] (-827.875) (-827.254) * [-827.979] (-828.129) (-831.290) (-830.226) -- 0:00:19
      673000 -- (-829.886) [-829.331] (-827.467) (-827.629) * (-827.654) (-827.967) [-828.230] (-827.919) -- 0:00:19
      673500 -- [-831.256] (-833.627) (-829.965) (-827.951) * (-828.563) (-830.881) (-831.079) [-827.767] -- 0:00:19
      674000 -- (-830.657) (-828.774) [-832.103] (-831.042) * (-827.799) (-829.810) (-831.806) [-827.915] -- 0:00:19
      674500 -- (-829.109) [-829.727] (-832.722) (-828.704) * (-827.525) (-828.951) (-827.863) [-827.338] -- 0:00:19
      675000 -- [-826.895] (-832.396) (-831.006) (-827.057) * [-827.925] (-832.197) (-831.005) (-828.142) -- 0:00:19

      Average standard deviation of split frequencies: 0.008237

      675500 -- [-827.773] (-828.309) (-830.191) (-827.412) * [-829.832] (-833.017) (-827.188) (-828.292) -- 0:00:19
      676000 -- (-828.164) [-828.424] (-829.548) (-827.418) * [-829.909] (-832.756) (-827.186) (-830.235) -- 0:00:19
      676500 -- (-828.184) (-831.256) [-828.442] (-831.247) * (-832.799) (-829.492) [-827.297] (-832.965) -- 0:00:19
      677000 -- (-828.289) (-830.556) (-829.822) [-828.500] * (-831.654) (-831.661) [-829.638] (-829.274) -- 0:00:19
      677500 -- (-831.594) (-832.719) [-827.310] (-830.705) * (-827.544) [-828.363] (-827.637) (-829.086) -- 0:00:19
      678000 -- [-829.364] (-828.370) (-827.120) (-828.885) * (-828.623) [-829.182] (-830.788) (-830.726) -- 0:00:19
      678500 -- (-827.732) (-828.226) (-828.718) [-829.987] * (-828.410) [-827.822] (-827.492) (-830.970) -- 0:00:19
      679000 -- (-829.372) (-829.643) (-829.820) [-829.901] * (-830.661) [-829.048] (-827.367) (-833.495) -- 0:00:19
      679500 -- (-829.696) (-827.166) [-833.636] (-828.240) * (-831.065) (-831.640) [-830.695] (-828.001) -- 0:00:19
      680000 -- (-828.862) (-827.662) (-830.805) [-827.496] * (-833.003) (-829.606) [-832.045] (-833.637) -- 0:00:19

      Average standard deviation of split frequencies: 0.008354

      680500 -- (-830.055) [-827.423] (-829.791) (-828.185) * [-826.878] (-829.478) (-828.744) (-827.236) -- 0:00:19
      681000 -- (-828.952) [-827.266] (-829.391) (-828.499) * (-827.412) [-830.523] (-829.586) (-832.519) -- 0:00:19
      681500 -- (-828.880) [-828.269] (-827.521) (-830.219) * [-829.209] (-829.003) (-828.125) (-829.168) -- 0:00:19
      682000 -- (-829.617) [-827.750] (-828.877) (-828.899) * (-835.333) (-829.255) (-829.140) [-828.732] -- 0:00:19
      682500 -- (-828.123) (-831.315) [-832.647] (-829.709) * [-829.345] (-827.702) (-827.431) (-832.714) -- 0:00:19
      683000 -- [-827.898] (-828.766) (-829.680) (-830.691) * (-828.012) (-830.251) [-828.556] (-833.867) -- 0:00:19
      683500 -- (-827.169) [-827.962] (-827.102) (-827.783) * (-831.239) (-829.353) [-828.425] (-831.088) -- 0:00:18
      684000 -- (-830.681) (-830.454) (-829.393) [-829.764] * (-829.050) (-830.977) (-828.087) [-829.154] -- 0:00:18
      684500 -- (-828.714) [-827.936] (-827.023) (-828.566) * [-829.138] (-836.086) (-827.984) (-827.866) -- 0:00:18
      685000 -- [-828.643] (-829.792) (-831.308) (-827.691) * (-830.077) (-828.853) [-828.572] (-829.229) -- 0:00:18

      Average standard deviation of split frequencies: 0.008547

      685500 -- [-829.145] (-831.083) (-837.035) (-830.443) * (-831.358) [-826.787] (-828.243) (-828.724) -- 0:00:18
      686000 -- (-832.378) (-830.576) (-827.996) [-830.034] * [-827.615] (-834.012) (-829.398) (-828.729) -- 0:00:18
      686500 -- (-829.764) (-828.796) (-827.621) [-827.794] * [-828.484] (-828.215) (-828.340) (-828.862) -- 0:00:18
      687000 -- (-830.459) (-831.378) [-826.815] (-827.384) * [-830.377] (-829.172) (-831.402) (-830.224) -- 0:00:18
      687500 -- (-832.928) [-827.163] (-830.798) (-830.638) * [-831.087] (-832.529) (-830.402) (-830.823) -- 0:00:18
      688000 -- (-833.292) (-827.518) [-828.499] (-829.363) * (-828.274) (-829.954) (-830.366) [-827.868] -- 0:00:18
      688500 -- [-828.660] (-829.386) (-828.294) (-828.299) * [-827.069] (-830.269) (-828.382) (-830.256) -- 0:00:18
      689000 -- [-827.450] (-828.864) (-828.188) (-828.951) * [-828.096] (-828.892) (-829.373) (-826.945) -- 0:00:18
      689500 -- (-827.421) (-829.410) [-827.602] (-830.024) * (-828.320) (-829.659) (-827.439) [-827.408] -- 0:00:18
      690000 -- (-829.653) (-827.523) (-830.688) [-829.089] * (-829.859) [-830.042] (-831.195) (-827.764) -- 0:00:18

      Average standard deviation of split frequencies: 0.008574

      690500 -- (-827.932) (-828.319) (-835.262) [-829.072] * (-836.570) [-827.871] (-829.845) (-827.304) -- 0:00:18
      691000 -- (-827.580) [-828.056] (-831.356) (-828.211) * (-834.751) [-827.937] (-828.180) (-827.447) -- 0:00:18
      691500 -- (-829.901) (-827.015) [-830.698] (-833.012) * (-833.162) [-828.754] (-829.853) (-828.898) -- 0:00:18
      692000 -- [-828.321] (-828.746) (-831.955) (-829.765) * (-828.165) [-830.404] (-830.648) (-829.248) -- 0:00:18
      692500 -- (-829.733) (-830.694) (-828.273) [-828.869] * [-827.399] (-829.294) (-831.287) (-832.186) -- 0:00:18
      693000 -- [-829.452] (-832.914) (-827.237) (-828.410) * (-828.654) (-829.039) (-829.529) [-829.304] -- 0:00:18
      693500 -- (-828.205) (-837.005) [-829.268] (-831.534) * [-830.018] (-829.780) (-827.970) (-829.720) -- 0:00:18
      694000 -- [-828.466] (-829.299) (-828.002) (-829.173) * [-830.240] (-827.916) (-827.958) (-831.496) -- 0:00:18
      694500 -- (-828.447) (-829.665) (-830.010) [-830.299] * [-832.713] (-832.473) (-829.631) (-830.408) -- 0:00:18
      695000 -- [-828.475] (-828.153) (-828.923) (-826.958) * [-829.090] (-830.434) (-826.666) (-831.659) -- 0:00:18

      Average standard deviation of split frequencies: 0.009144

      695500 -- (-828.938) (-827.747) (-829.133) [-827.287] * (-831.030) [-828.940] (-828.535) (-829.695) -- 0:00:18
      696000 -- [-828.763] (-828.641) (-828.270) (-829.027) * (-831.106) (-828.663) (-834.434) [-830.520] -- 0:00:18
      696500 -- (-830.090) [-829.156] (-828.804) (-828.401) * (-828.870) [-827.362] (-830.784) (-832.468) -- 0:00:18
      697000 -- [-830.322] (-829.349) (-830.922) (-826.744) * (-829.406) [-826.995] (-832.214) (-829.745) -- 0:00:18
      697500 -- [-830.624] (-828.286) (-830.363) (-829.643) * (-830.748) (-827.382) (-830.476) [-827.827] -- 0:00:18
      698000 -- (-831.048) [-828.106] (-830.126) (-830.366) * (-830.814) (-827.948) [-829.138] (-827.348) -- 0:00:18
      698500 -- (-831.950) (-831.374) (-826.815) [-829.165] * [-829.055] (-829.465) (-830.716) (-828.207) -- 0:00:18
      699000 -- [-830.402] (-830.225) (-827.935) (-827.373) * [-833.227] (-829.095) (-829.745) (-827.337) -- 0:00:18
      699500 -- (-829.555) (-828.206) [-827.839] (-829.051) * (-828.518) (-831.839) [-828.387] (-831.486) -- 0:00:18
      700000 -- (-829.725) (-828.062) (-827.100) [-832.836] * (-829.650) [-829.966] (-828.357) (-829.683) -- 0:00:18

      Average standard deviation of split frequencies: 0.008662

      700500 -- (-829.144) (-828.693) [-830.259] (-829.195) * [-830.048] (-828.646) (-827.888) (-829.108) -- 0:00:17
      701000 -- (-828.202) (-828.545) [-827.159] (-829.481) * (-832.845) [-829.410] (-827.439) (-828.902) -- 0:00:17
      701500 -- (-828.230) (-830.750) [-829.065] (-830.899) * (-830.976) (-827.218) [-828.211] (-830.084) -- 0:00:17
      702000 -- (-828.698) [-829.104] (-829.076) (-830.966) * [-832.798] (-827.618) (-833.610) (-828.332) -- 0:00:17
      702500 -- (-830.517) [-827.779] (-831.961) (-830.472) * (-829.686) (-828.126) [-833.754] (-827.347) -- 0:00:17
      703000 -- (-830.379) (-827.448) (-827.597) [-831.413] * [-828.792] (-830.056) (-827.573) (-829.763) -- 0:00:17
      703500 -- (-829.358) (-829.435) [-828.315] (-830.945) * [-832.491] (-828.847) (-827.967) (-829.097) -- 0:00:17
      704000 -- (-830.513) (-829.565) [-828.547] (-831.071) * (-827.501) [-831.753] (-828.186) (-828.591) -- 0:00:17
      704500 -- (-829.443) (-827.660) [-827.776] (-830.949) * (-828.934) [-831.681] (-827.702) (-833.125) -- 0:00:17
      705000 -- (-829.477) [-830.957] (-829.068) (-832.212) * (-827.198) (-827.951) [-827.702] (-829.318) -- 0:00:17

      Average standard deviation of split frequencies: 0.009056

      705500 -- (-827.606) (-831.695) (-827.145) [-830.603] * [-827.258] (-826.869) (-827.195) (-830.116) -- 0:00:17
      706000 -- [-828.619] (-830.455) (-827.211) (-829.836) * (-831.056) [-826.876] (-828.485) (-830.435) -- 0:00:17
      706500 -- [-829.726] (-830.174) (-827.330) (-832.126) * (-828.202) [-827.282] (-828.205) (-829.608) -- 0:00:17
      707000 -- (-829.998) (-832.679) (-827.701) [-829.299] * (-833.209) [-828.341] (-828.018) (-831.503) -- 0:00:17
      707500 -- (-830.718) (-828.844) [-827.710] (-829.901) * (-831.901) (-827.856) (-827.772) [-827.751] -- 0:00:17
      708000 -- (-829.013) [-828.829] (-830.629) (-827.351) * (-832.384) (-831.639) (-828.546) [-828.627] -- 0:00:17
      708500 -- (-829.706) (-828.216) (-829.148) [-827.738] * [-832.615] (-829.118) (-829.042) (-829.450) -- 0:00:17
      709000 -- (-827.694) (-827.221) [-828.505] (-828.686) * (-829.338) (-828.001) (-829.492) [-827.069] -- 0:00:17
      709500 -- [-828.714] (-826.844) (-830.547) (-831.210) * (-833.467) (-827.545) (-828.314) [-832.775] -- 0:00:17
      710000 -- (-827.141) (-828.600) (-831.403) [-829.143] * (-831.559) (-829.812) (-828.279) [-830.094] -- 0:00:17

      Average standard deviation of split frequencies: 0.009452

      710500 -- (-827.869) (-828.832) (-829.564) [-831.921] * (-831.026) (-829.761) (-827.344) [-829.683] -- 0:00:17
      711000 -- (-827.153) (-827.549) [-829.517] (-830.138) * (-830.020) (-829.028) (-833.135) [-833.789] -- 0:00:17
      711500 -- (-831.880) [-827.117] (-840.412) (-830.299) * [-828.125] (-830.086) (-834.121) (-827.889) -- 0:00:17
      712000 -- (-832.751) (-827.340) (-830.136) [-829.295] * (-837.171) (-829.263) [-829.216] (-828.229) -- 0:00:17
      712500 -- (-828.558) (-831.353) (-831.252) [-827.954] * (-828.129) (-828.844) (-829.690) [-828.967] -- 0:00:17
      713000 -- (-827.792) [-826.922] (-831.457) (-834.202) * (-827.391) (-830.611) (-826.999) [-829.104] -- 0:00:17
      713500 -- (-828.517) (-828.079) [-832.784] (-829.518) * (-826.779) [-829.226] (-827.265) (-828.832) -- 0:00:17
      714000 -- (-829.935) [-829.270] (-831.074) (-828.263) * (-829.240) [-830.911] (-828.670) (-829.319) -- 0:00:17
      714500 -- (-827.654) (-827.260) [-830.004] (-828.620) * (-828.817) [-828.001] (-831.267) (-827.566) -- 0:00:17
      715000 -- [-827.144] (-829.027) (-830.533) (-829.031) * (-830.981) (-827.779) [-828.355] (-828.609) -- 0:00:17

      Average standard deviation of split frequencies: 0.009670

      715500 -- [-829.737] (-834.787) (-829.590) (-831.536) * [-828.527] (-826.810) (-828.966) (-827.619) -- 0:00:17
      716000 -- [-832.397] (-829.349) (-829.301) (-827.528) * (-829.996) (-827.580) (-828.753) [-831.114] -- 0:00:17
      716500 -- (-829.196) [-827.370] (-830.281) (-829.087) * [-828.179] (-830.271) (-827.255) (-831.937) -- 0:00:17
      717000 -- (-831.836) (-828.612) (-827.757) [-829.140] * [-828.132] (-835.051) (-828.817) (-831.886) -- 0:00:16
      717500 -- (-832.899) (-829.774) [-828.882] (-830.226) * (-826.927) (-829.480) [-828.472] (-828.933) -- 0:00:16
      718000 -- (-827.947) (-833.919) [-829.478] (-830.798) * (-826.881) [-829.554] (-827.768) (-828.412) -- 0:00:16
      718500 -- (-827.071) (-834.951) (-828.651) [-827.748] * [-827.923] (-829.826) (-827.937) (-831.177) -- 0:00:16
      719000 -- (-834.34