--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:36:16 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/echA6/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1024.15 -1028.99
2 -1024.16 -1027.88
--------------------------------------
TOTAL -1024.15 -1028.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.874790 0.087177 0.344641 1.433962 0.847467 1501.00 1501.00 1.000
r(A<->C){all} 0.151304 0.017505 0.000054 0.420756 0.115148 167.45 245.08 1.004
r(A<->G){all} 0.169547 0.019921 0.000133 0.454036 0.135127 321.75 335.25 1.000
r(A<->T){all} 0.153898 0.017709 0.000060 0.425084 0.119090 141.77 180.52 1.001
r(C<->G){all} 0.208833 0.026647 0.000412 0.544682 0.166682 152.36 217.47 1.002
r(C<->T){all} 0.143778 0.017416 0.000215 0.435289 0.104400 265.92 284.81 1.000
r(G<->T){all} 0.172639 0.020888 0.000011 0.451814 0.135088 209.71 266.94 1.001
pi(A){all} 0.194627 0.000211 0.166867 0.223565 0.194463 1164.88 1194.64 1.000
pi(C){all} 0.276118 0.000262 0.244572 0.307426 0.275793 1278.40 1348.74 1.000
pi(G){all} 0.324623 0.000295 0.291474 0.358626 0.324028 1231.67 1249.37 1.000
pi(T){all} 0.204632 0.000215 0.176043 0.232981 0.204702 1064.51 1155.74 1.000
alpha{1,2} 0.289203 0.109145 0.000557 0.978628 0.182930 1376.15 1438.57 1.000
alpha{3} 0.404260 0.232958 0.000124 1.384001 0.232148 1169.04 1285.71 1.000
pinvar{all} 0.995225 0.000016 0.987648 0.999902 0.996382 1007.55 1183.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -979.874157
Model 2: PositiveSelection -979.649221
Model 0: one-ratio -979.649208
Model 7: beta -979.874155
Model 8: beta&w>1 -979.649221
Model 0 vs 1 0.44989799999984825
Model 2 vs 1 0.4498719999999139
Model 8 vs 7 0.449867999999924
>C1
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C2
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C3
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C4
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C5
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C6
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWSSQDVIEAQVARVEKRPPKFQGA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=247
C1 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C2 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C3 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C4 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C5 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C6 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
**************************************************
C1 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C2 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C3 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C4 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C5 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C6 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
**************************************************
C1 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C2 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C3 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C4 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C5 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C6 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
**************************************************
C1 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C2 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C3 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C4 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C5 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C6 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
**************************************************
C1 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C2 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C3 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C4 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C5 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C6 RVLNDDGSIEEAWPEHKKLFDKAWSSQDVIEAQVARVEKRPPKFQGA
************************:**********************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 247 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 247 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [7410]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [7410]--->[7410]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.493 Mb, Max= 30.799 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C2 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C3 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C4 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C5 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
C6 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
**************************************************
C1 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C2 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C3 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C4 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C5 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
C6 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
**************************************************
C1 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C2 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C3 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C4 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C5 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
C6 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
**************************************************
C1 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C2 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C3 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C4 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C5 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
C6 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
**************************************************
C1 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C2 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C3 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C4 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C5 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
C6 RVLNDDGSIEEAWPEHKKLFDKAWSSQDVIEAQVARVEKRPPKFQGA
************************:**********************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.60 C1 C6 99.60
TOP 5 0 99.60 C6 C1 99.60
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.60 C2 C6 99.60
TOP 5 1 99.60 C6 C2 99.60
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.60 C3 C6 99.60
TOP 5 2 99.60 C6 C3 99.60
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.60 C4 C6 99.60
TOP 5 3 99.60 C6 C4 99.60
BOT 4 5 99.60 C5 C6 99.60
TOP 5 4 99.60 C6 C5 99.60
AVG 0 C1 * 99.92
AVG 1 C2 * 99.92
AVG 2 C3 * 99.92
AVG 3 C4 * 99.92
AVG 4 C5 * 99.92
AVG 5 C6 * 99.60
TOT TOT * 99.87
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
C2 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
C3 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
C4 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
C5 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
C6 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
**************************************************
C1 TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
C2 TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
C3 TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
C4 TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
C5 TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
C6 TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
**************************************************
C1 AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
C2 AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
C3 AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
C4 AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
C5 AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
C6 AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
**************************************************
C1 ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
C2 ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
C3 ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
C4 ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
C5 ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
C6 ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
**************************************************
C1 CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
C2 CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
C3 CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
C4 CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
C5 CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
C6 CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
**************************************************
C1 GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
C2 GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
C3 GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
C4 GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
C5 GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
C6 GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
**************************************************
C1 GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
C2 GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
C3 GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
C4 GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
C5 GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
C6 GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
**************************************************
C1 TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
C2 TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
C3 TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
C4 TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
C5 TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
C6 TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
**************************************************
C1 TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
C2 TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
C3 TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
C4 TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
C5 TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
C6 TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
**************************************************
C1 GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
C2 GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
C3 GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
C4 GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
C5 GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
C6 GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
**************************************************
C1 GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
C2 GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
C3 GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
C4 GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
C5 GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
C6 GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
**************************************************
C1 GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
C2 GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
C3 GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
C4 GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
C5 GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
C6 GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
**************************************************
C1 CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
C2 CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
C3 CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
C4 CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
C5 CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
C6 CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
**************************************************
C1 GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
C2 GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
C3 GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
C4 GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
C5 GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
C6 GAAGCTCTTTGACAAGGCCTGGAGCAGCCAGGATGTCATCGAAGCGCAGG
*********************** **************************
C1 TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
C2 TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
C3 TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
C4 TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
C5 TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
C6 TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
*****************************************
>C1
ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>C2
ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>C3
ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>C4
ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>C5
ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG
TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>C6
ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG
TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG
AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG
ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG
CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA
GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC
GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT
TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC
TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG
GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT
GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT
GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG
CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA
GAAGCTCTTTGACAAGGCCTGGAGCAGCCAGGATGTCATCGAAGCGCAGG
TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>C1
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C2
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C3
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C4
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C5
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
>C6
MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
RVLNDDGSIEEAWPEHKKLFDKAWSSQDVIEAQVARVEKRPPKFQGA
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 741 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579775674
Setting output file names to "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1230170638
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 9912512636
Seed = 675413901
Swapseed = 1579775674
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1661.794835 -- -24.965149
Chain 2 -- -1661.796384 -- -24.965149
Chain 3 -- -1661.796288 -- -24.965149
Chain 4 -- -1661.796288 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1661.796288 -- -24.965149
Chain 2 -- -1661.796066 -- -24.965149
Chain 3 -- -1661.796384 -- -24.965149
Chain 4 -- -1661.796288 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1661.795] (-1661.796) (-1661.796) (-1661.796) * [-1661.796] (-1661.796) (-1661.796) (-1661.796)
500 -- (-1030.480) (-1042.157) (-1031.641) [-1030.736] * (-1038.205) (-1044.759) (-1040.361) [-1037.056] -- 0:00:00
1000 -- (-1028.226) (-1031.118) [-1030.518] (-1026.306) * [-1024.009] (-1028.384) (-1032.484) (-1029.217) -- 0:00:00
1500 -- (-1032.653) (-1031.573) (-1030.572) [-1022.804] * (-1032.370) (-1033.552) [-1025.222] (-1029.894) -- 0:00:00
2000 -- (-1026.713) (-1038.129) [-1033.266] (-1028.809) * (-1027.890) [-1026.894] (-1027.497) (-1029.558) -- 0:00:00
2500 -- (-1032.597) (-1034.069) [-1027.321] (-1029.248) * (-1029.084) [-1025.937] (-1032.032) (-1037.294) -- 0:00:00
3000 -- [-1028.241] (-1034.195) (-1031.602) (-1025.711) * (-1039.461) [-1027.552] (-1032.828) (-1037.217) -- 0:00:00
3500 -- (-1029.298) (-1032.155) [-1031.875] (-1031.266) * (-1034.385) (-1031.976) [-1025.550] (-1037.014) -- 0:00:00
4000 -- (-1028.088) [-1027.334] (-1030.257) (-1029.807) * (-1031.139) (-1030.908) [-1030.442] (-1027.190) -- 0:00:00
4500 -- [-1029.856] (-1029.680) (-1034.479) (-1030.368) * (-1025.203) (-1022.035) (-1035.589) [-1029.996] -- 0:00:00
5000 -- [-1028.503] (-1026.937) (-1034.575) (-1034.475) * (-1032.552) [-1028.901] (-1033.206) (-1028.417) -- 0:00:00
Average standard deviation of split frequencies: 0.104757
5500 -- (-1030.782) [-1031.342] (-1039.040) (-1030.672) * (-1032.644) (-1030.069) [-1027.618] (-1027.334) -- 0:00:00
6000 -- (-1030.071) (-1041.336) (-1024.872) [-1033.781] * (-1030.509) (-1031.953) [-1027.187] (-1027.302) -- 0:00:00
6500 -- (-1029.099) (-1029.435) [-1029.365] (-1024.357) * (-1028.584) (-1031.295) (-1031.014) [-1023.580] -- 0:00:00
7000 -- [-1031.064] (-1031.624) (-1029.047) (-1029.347) * [-1022.847] (-1041.274) (-1026.703) (-1031.313) -- 0:00:00
7500 -- [-1032.401] (-1033.297) (-1032.804) (-1035.893) * [-1032.291] (-1031.462) (-1030.919) (-1029.113) -- 0:00:00
8000 -- (-1025.732) (-1027.063) [-1033.367] (-1032.989) * (-1027.947) (-1042.326) (-1026.659) [-1027.245] -- 0:00:00
8500 -- (-1031.977) (-1031.533) [-1029.186] (-1031.727) * (-1033.304) [-1030.235] (-1027.510) (-1031.114) -- 0:00:00
9000 -- (-1040.944) [-1028.991] (-1029.291) (-1035.776) * [-1032.095] (-1026.619) (-1027.213) (-1027.597) -- 0:00:00
9500 -- (-1032.765) [-1028.251] (-1030.870) (-1031.068) * (-1030.871) (-1026.097) [-1023.470] (-1023.766) -- 0:00:00
10000 -- [-1034.347] (-1036.078) (-1023.710) (-1028.956) * (-1027.765) (-1027.864) (-1030.516) [-1031.438] -- 0:00:00
Average standard deviation of split frequencies: 0.054015
10500 -- (-1027.822) (-1029.580) [-1023.093] (-1032.717) * (-1025.498) (-1026.563) (-1026.514) [-1036.178] -- 0:00:00
11000 -- (-1032.834) [-1025.733] (-1024.123) (-1030.572) * (-1030.235) (-1026.417) [-1030.449] (-1034.634) -- 0:00:00
11500 -- [-1027.836] (-1033.268) (-1028.990) (-1027.361) * (-1028.294) (-1024.045) [-1026.533] (-1031.148) -- 0:00:00
12000 -- [-1027.555] (-1031.561) (-1026.620) (-1032.636) * (-1025.853) (-1022.219) [-1025.486] (-1027.090) -- 0:00:00
12500 -- [-1027.279] (-1041.978) (-1025.342) (-1033.927) * (-1029.173) (-1024.747) [-1030.704] (-1029.381) -- 0:01:19
13000 -- [-1027.588] (-1040.790) (-1024.412) (-1040.523) * [-1030.499] (-1025.920) (-1025.678) (-1030.837) -- 0:01:15
13500 -- [-1027.329] (-1026.711) (-1026.731) (-1025.704) * [-1028.663] (-1025.856) (-1030.131) (-1032.872) -- 0:01:13
14000 -- [-1030.783] (-1026.982) (-1026.924) (-1027.855) * (-1028.432) (-1027.777) [-1031.151] (-1032.413) -- 0:01:10
14500 -- (-1030.173) [-1028.834] (-1026.858) (-1028.440) * (-1032.363) (-1026.560) (-1031.295) [-1033.632] -- 0:01:07
15000 -- [-1025.553] (-1027.992) (-1024.552) (-1028.768) * (-1028.726) (-1032.857) [-1029.123] (-1034.466) -- 0:01:05
Average standard deviation of split frequencies: 0.031196
15500 -- (-1036.145) (-1027.987) (-1023.816) [-1027.301] * (-1030.649) (-1025.497) [-1028.473] (-1042.557) -- 0:01:03
16000 -- [-1025.954] (-1035.948) (-1026.863) (-1030.390) * [-1028.216] (-1025.172) (-1032.402) (-1032.092) -- 0:01:01
16500 -- [-1025.841] (-1035.984) (-1024.470) (-1037.807) * [-1030.058] (-1026.041) (-1032.771) (-1037.633) -- 0:00:59
17000 -- (-1032.373) (-1031.101) [-1024.841] (-1034.031) * (-1028.299) (-1025.371) [-1025.170] (-1035.731) -- 0:00:57
17500 -- [-1030.083] (-1027.185) (-1027.127) (-1038.423) * (-1029.519) [-1024.463] (-1029.724) (-1041.850) -- 0:00:56
18000 -- (-1036.049) [-1027.127] (-1026.713) (-1024.577) * [-1027.803] (-1024.628) (-1025.546) (-1027.583) -- 0:00:54
18500 -- (-1032.346) [-1033.222] (-1026.796) (-1027.727) * (-1032.571) (-1023.264) [-1024.494] (-1030.114) -- 0:00:53
19000 -- (-1028.703) [-1028.655] (-1024.723) (-1025.009) * (-1036.600) (-1027.531) [-1027.929] (-1034.383) -- 0:00:51
19500 -- [-1030.602] (-1030.029) (-1024.549) (-1028.151) * (-1033.334) (-1025.920) [-1029.213] (-1038.896) -- 0:00:50
20000 -- (-1032.328) [-1038.242] (-1024.207) (-1025.947) * (-1030.390) (-1027.487) (-1034.198) [-1029.487] -- 0:00:49
Average standard deviation of split frequencies: 0.037066
20500 -- (-1026.568) (-1034.596) (-1023.247) [-1024.504] * (-1032.425) (-1023.646) (-1027.399) [-1027.496] -- 0:00:47
21000 -- [-1026.205] (-1032.952) (-1028.597) (-1037.680) * [-1025.329] (-1022.073) (-1028.376) (-1039.901) -- 0:00:46
21500 -- [-1029.201] (-1040.640) (-1032.894) (-1027.285) * [-1029.744] (-1024.799) (-1026.711) (-1041.598) -- 0:00:45
22000 -- (-1032.699) (-1028.025) (-1027.158) [-1026.125] * (-1026.725) [-1024.598] (-1033.242) (-1045.684) -- 0:00:44
22500 -- (-1034.458) (-1029.289) (-1024.393) [-1026.326] * (-1038.234) [-1022.499] (-1024.939) (-1029.452) -- 0:00:43
23000 -- (-1031.317) (-1025.396) (-1023.352) [-1023.594] * (-1024.952) [-1022.857] (-1026.158) (-1029.678) -- 0:00:42
23500 -- (-1032.292) (-1023.406) [-1027.329] (-1024.895) * [-1028.787] (-1024.395) (-1026.468) (-1036.894) -- 0:00:41
24000 -- (-1030.761) (-1024.051) [-1024.954] (-1027.217) * [-1032.121] (-1024.860) (-1023.893) (-1032.401) -- 0:00:40
24500 -- (-1030.443) [-1022.022] (-1023.472) (-1028.654) * (-1033.030) (-1023.799) [-1026.162] (-1034.269) -- 0:00:39
25000 -- (-1031.621) [-1024.080] (-1023.199) (-1024.273) * (-1035.019) (-1027.243) (-1025.356) [-1036.716] -- 0:00:39
Average standard deviation of split frequencies: 0.033542
25500 -- (-1030.627) (-1022.825) [-1025.930] (-1024.023) * (-1035.123) (-1023.619) (-1026.926) [-1031.089] -- 0:00:38
26000 -- (-1027.034) (-1023.115) [-1027.521] (-1023.046) * (-1031.090) [-1025.804] (-1024.256) (-1029.609) -- 0:00:37
26500 -- (-1033.853) (-1027.037) (-1026.644) [-1023.871] * (-1033.583) (-1029.101) (-1024.216) [-1037.954] -- 0:00:36
27000 -- [-1026.299] (-1025.929) (-1029.595) (-1023.283) * [-1029.605] (-1025.631) (-1028.142) (-1023.390) -- 0:00:36
27500 -- (-1029.584) (-1026.754) (-1024.338) [-1025.730] * [-1034.455] (-1024.703) (-1021.619) (-1032.158) -- 0:01:10
28000 -- (-1026.400) [-1023.739] (-1025.282) (-1023.923) * (-1040.987) [-1023.272] (-1024.522) (-1033.246) -- 0:01:09
28500 -- (-1029.433) (-1025.365) [-1023.909] (-1024.921) * (-1041.516) (-1023.931) [-1025.837] (-1032.082) -- 0:01:08
29000 -- (-1042.984) (-1026.355) [-1022.640] (-1026.497) * [-1030.158] (-1026.498) (-1023.173) (-1028.696) -- 0:01:06
29500 -- (-1036.181) (-1025.909) (-1023.869) [-1024.726] * (-1029.766) (-1028.103) (-1025.584) [-1029.286] -- 0:01:05
30000 -- (-1027.576) (-1026.351) (-1024.407) [-1025.325] * (-1026.915) (-1027.829) (-1022.400) [-1025.328] -- 0:01:04
Average standard deviation of split frequencies: 0.025318
30500 -- (-1028.333) (-1030.174) (-1024.894) [-1025.183] * (-1026.713) [-1023.707] (-1023.957) (-1035.141) -- 0:01:03
31000 -- [-1030.718] (-1029.883) (-1027.211) (-1026.805) * (-1032.203) [-1023.341] (-1026.416) (-1036.016) -- 0:01:02
31500 -- (-1029.022) [-1024.035] (-1024.740) (-1026.963) * (-1028.152) (-1023.787) (-1023.631) [-1026.285] -- 0:01:01
32000 -- (-1031.881) (-1024.518) (-1024.350) [-1023.700] * [-1028.289] (-1022.489) (-1025.473) (-1028.284) -- 0:01:00
32500 -- (-1029.113) [-1023.470] (-1027.039) (-1024.979) * (-1023.954) (-1026.165) [-1022.301] (-1030.791) -- 0:00:59
33000 -- (-1028.673) [-1024.220] (-1024.971) (-1025.545) * (-1034.150) (-1024.434) [-1023.082] (-1033.571) -- 0:00:58
33500 -- (-1023.863) (-1025.353) [-1024.955] (-1024.147) * [-1024.998] (-1026.892) (-1022.796) (-1032.179) -- 0:00:57
34000 -- [-1025.590] (-1022.891) (-1025.805) (-1025.097) * [-1030.538] (-1025.905) (-1022.816) (-1038.791) -- 0:00:56
34500 -- (-1025.389) (-1026.159) [-1023.361] (-1026.571) * (-1032.462) (-1025.315) [-1026.534] (-1043.291) -- 0:00:55
35000 -- (-1025.460) (-1026.791) (-1024.449) [-1022.585] * (-1031.450) [-1024.244] (-1025.564) (-1030.197) -- 0:00:55
Average standard deviation of split frequencies: 0.030040
35500 -- (-1022.924) (-1026.546) [-1025.897] (-1027.042) * (-1032.921) (-1024.861) (-1027.902) [-1033.227] -- 0:00:54
36000 -- (-1028.936) (-1023.465) [-1025.607] (-1030.388) * (-1030.697) [-1026.172] (-1025.832) (-1029.944) -- 0:00:53
36500 -- (-1032.420) (-1028.330) [-1024.366] (-1028.360) * [-1029.663] (-1025.049) (-1029.906) (-1027.826) -- 0:00:52
37000 -- (-1024.288) [-1025.041] (-1023.877) (-1029.267) * (-1029.750) [-1025.967] (-1027.663) (-1027.406) -- 0:00:52
37500 -- (-1024.499) (-1024.445) (-1026.812) [-1031.904] * [-1026.651] (-1024.000) (-1025.980) (-1028.287) -- 0:00:51
38000 -- [-1023.333] (-1024.973) (-1028.977) (-1026.253) * (-1031.284) (-1028.664) [-1022.477] (-1032.953) -- 0:00:50
38500 -- [-1028.162] (-1028.287) (-1023.375) (-1029.781) * [-1036.359] (-1025.274) (-1027.432) (-1039.209) -- 0:00:49
39000 -- (-1024.217) (-1027.686) [-1024.149] (-1026.283) * [-1035.370] (-1023.386) (-1024.549) (-1032.565) -- 0:00:49
39500 -- (-1024.383) [-1025.537] (-1022.865) (-1026.189) * (-1031.839) (-1023.317) (-1030.993) [-1029.688] -- 0:00:48
40000 -- [-1024.464] (-1030.121) (-1025.688) (-1024.659) * (-1037.405) (-1029.674) (-1024.779) [-1028.830] -- 0:00:48
Average standard deviation of split frequencies: 0.031725
40500 -- [-1025.207] (-1026.396) (-1023.895) (-1031.092) * (-1039.811) [-1026.732] (-1024.988) (-1042.446) -- 0:00:47
41000 -- (-1025.286) (-1026.018) (-1023.218) [-1025.822] * (-1030.497) (-1025.624) [-1024.564] (-1027.741) -- 0:00:46
41500 -- (-1029.514) (-1026.664) [-1025.530] (-1026.660) * (-1028.227) [-1023.651] (-1026.986) (-1026.256) -- 0:00:46
42000 -- (-1025.890) (-1028.943) [-1023.745] (-1026.265) * [-1032.134] (-1022.438) (-1025.657) (-1025.893) -- 0:00:45
42500 -- (-1025.195) (-1026.866) (-1027.587) [-1024.981] * (-1037.072) (-1022.896) (-1025.993) [-1028.583] -- 0:00:45
43000 -- (-1024.338) [-1026.598] (-1028.423) (-1025.612) * [-1034.535] (-1023.997) (-1026.048) (-1029.140) -- 0:01:06
43500 -- (-1026.017) (-1025.440) [-1023.965] (-1025.184) * (-1030.527) (-1029.520) [-1027.327] (-1026.724) -- 0:01:05
44000 -- [-1025.411] (-1025.819) (-1024.484) (-1025.900) * (-1040.802) (-1028.965) [-1025.614] (-1022.256) -- 0:01:05
44500 -- (-1025.682) (-1026.510) [-1023.516] (-1024.971) * (-1030.107) (-1027.021) (-1025.033) [-1022.671] -- 0:01:04
45000 -- [-1024.443] (-1026.729) (-1023.496) (-1024.490) * [-1027.231] (-1025.040) (-1027.087) (-1025.780) -- 0:01:03
Average standard deviation of split frequencies: 0.034470
45500 -- (-1025.755) (-1025.895) [-1023.430] (-1026.939) * [-1025.450] (-1025.509) (-1025.142) (-1028.991) -- 0:01:02
46000 -- [-1024.133] (-1028.900) (-1024.977) (-1026.212) * (-1035.888) (-1024.696) [-1024.916] (-1026.596) -- 0:01:02
46500 -- (-1025.109) [-1025.681] (-1026.987) (-1024.501) * (-1025.953) (-1023.840) [-1022.982] (-1026.147) -- 0:01:01
47000 -- (-1024.156) [-1026.638] (-1028.345) (-1025.453) * (-1035.406) [-1023.286] (-1023.964) (-1024.631) -- 0:01:00
47500 -- (-1026.621) (-1024.501) (-1023.833) [-1025.198] * [-1029.729] (-1025.814) (-1023.203) (-1024.733) -- 0:01:00
48000 -- (-1024.987) (-1025.272) [-1023.968] (-1025.989) * (-1033.665) (-1028.336) [-1024.577] (-1024.785) -- 0:00:59
48500 -- (-1026.063) (-1023.425) [-1025.700] (-1029.384) * (-1033.349) [-1024.449] (-1025.253) (-1024.763) -- 0:00:58
49000 -- (-1025.199) (-1027.409) [-1025.028] (-1027.234) * (-1031.848) (-1023.515) [-1025.131] (-1025.895) -- 0:00:58
49500 -- [-1027.014] (-1025.610) (-1023.307) (-1025.612) * (-1026.996) (-1025.631) (-1022.938) [-1024.161] -- 0:00:57
50000 -- (-1027.504) [-1026.381] (-1023.927) (-1025.555) * [-1023.185] (-1025.191) (-1024.872) (-1027.700) -- 0:00:57
Average standard deviation of split frequencies: 0.038062
50500 -- (-1025.658) (-1025.956) (-1024.824) [-1025.200] * (-1030.243) (-1025.285) (-1023.538) [-1025.385] -- 0:00:56
51000 -- (-1026.125) (-1027.183) [-1023.121] (-1025.423) * (-1033.054) (-1026.076) (-1022.991) [-1027.990] -- 0:00:55
51500 -- [-1026.298] (-1029.721) (-1026.306) (-1028.441) * [-1029.443] (-1026.328) (-1026.254) (-1027.812) -- 0:00:55
52000 -- (-1029.315) (-1025.440) (-1027.924) [-1023.457] * [-1034.265] (-1026.028) (-1025.878) (-1024.982) -- 0:00:54
52500 -- (-1026.984) (-1025.181) (-1027.180) [-1024.283] * [-1028.168] (-1025.414) (-1026.796) (-1026.958) -- 0:00:54
53000 -- [-1024.629] (-1024.886) (-1024.255) (-1026.311) * [-1023.168] (-1025.136) (-1023.819) (-1028.680) -- 0:00:53
53500 -- (-1025.156) (-1024.408) [-1024.336] (-1026.996) * (-1027.750) [-1024.294] (-1027.028) (-1026.423) -- 0:00:53
54000 -- [-1024.197] (-1024.664) (-1026.926) (-1024.558) * (-1030.573) (-1026.791) [-1022.747] (-1030.968) -- 0:00:52
54500 -- (-1026.744) [-1026.924] (-1028.810) (-1029.326) * (-1037.611) [-1027.205] (-1022.366) (-1026.166) -- 0:00:52
55000 -- (-1026.045) (-1023.073) [-1028.444] (-1027.010) * [-1030.457] (-1024.408) (-1025.531) (-1024.682) -- 0:00:51
Average standard deviation of split frequencies: 0.029663
55500 -- [-1023.060] (-1025.203) (-1027.252) (-1027.684) * [-1030.565] (-1026.677) (-1029.114) (-1027.458) -- 0:00:51
56000 -- (-1024.217) (-1024.833) [-1023.268] (-1027.555) * [-1027.348] (-1023.843) (-1025.998) (-1027.736) -- 0:00:50
56500 -- [-1025.436] (-1026.803) (-1025.457) (-1025.045) * (-1029.154) (-1023.833) [-1024.787] (-1025.491) -- 0:00:50
57000 -- (-1026.650) (-1025.353) [-1023.568] (-1026.234) * (-1025.179) [-1026.943] (-1025.246) (-1025.781) -- 0:00:49
57500 -- (-1027.821) (-1027.804) [-1023.004] (-1024.694) * [-1027.160] (-1023.885) (-1022.555) (-1030.711) -- 0:00:49
58000 -- [-1024.072] (-1026.525) (-1022.698) (-1024.261) * (-1030.224) (-1023.009) [-1021.589] (-1027.904) -- 0:01:04
58500 -- (-1025.411) (-1025.536) [-1025.553] (-1025.462) * (-1025.265) [-1024.764] (-1023.556) (-1026.269) -- 0:01:04
59000 -- (-1026.298) (-1024.635) [-1025.604] (-1031.046) * (-1035.494) (-1026.232) (-1024.976) [-1024.757] -- 0:01:03
59500 -- (-1026.060) [-1024.546] (-1022.865) (-1027.257) * [-1031.566] (-1024.857) (-1024.277) (-1025.284) -- 0:01:03
60000 -- [-1026.487] (-1027.150) (-1027.284) (-1026.211) * (-1033.595) (-1024.990) (-1025.779) [-1026.841] -- 0:01:02
Average standard deviation of split frequencies: 0.031900
60500 -- (-1025.972) (-1025.530) [-1023.712] (-1025.318) * (-1027.843) [-1028.810] (-1025.247) (-1023.182) -- 0:01:02
61000 -- (-1026.924) [-1024.842] (-1023.263) (-1025.233) * [-1031.459] (-1023.756) (-1023.667) (-1026.189) -- 0:01:01
61500 -- (-1025.988) [-1025.084] (-1023.482) (-1025.901) * [-1031.036] (-1023.409) (-1024.321) (-1025.585) -- 0:01:01
62000 -- (-1026.494) (-1023.677) [-1024.720] (-1026.159) * [-1035.017] (-1023.494) (-1024.174) (-1024.656) -- 0:01:00
62500 -- [-1026.083] (-1025.876) (-1025.483) (-1026.092) * (-1030.394) [-1026.300] (-1024.638) (-1023.523) -- 0:01:00
63000 -- (-1026.494) (-1025.914) (-1025.940) [-1024.152] * (-1029.129) (-1023.261) [-1025.962] (-1023.766) -- 0:00:59
63500 -- (-1028.699) [-1025.450] (-1025.225) (-1025.724) * (-1028.167) (-1024.411) (-1023.251) [-1023.783] -- 0:00:58
64000 -- (-1024.999) (-1027.895) [-1025.225] (-1025.868) * [-1029.094] (-1028.834) (-1025.038) (-1022.424) -- 0:00:58
64500 -- (-1025.596) (-1026.441) [-1025.224] (-1027.984) * [-1031.073] (-1026.797) (-1024.139) (-1023.332) -- 0:00:58
65000 -- (-1031.507) (-1025.992) [-1024.752] (-1023.535) * (-1031.623) (-1024.707) [-1025.057] (-1023.799) -- 0:00:57
Average standard deviation of split frequencies: 0.030074
65500 -- (-1028.218) (-1023.437) (-1023.507) [-1022.793] * [-1029.788] (-1024.614) (-1029.268) (-1025.918) -- 0:00:57
66000 -- (-1027.764) (-1026.859) [-1022.870] (-1024.444) * [-1033.387] (-1026.057) (-1027.035) (-1024.603) -- 0:00:56
66500 -- (-1024.992) [-1025.776] (-1024.768) (-1025.925) * (-1028.676) (-1025.488) (-1023.608) [-1025.067] -- 0:00:56
67000 -- (-1025.190) [-1029.143] (-1026.837) (-1025.553) * [-1026.571] (-1024.102) (-1023.531) (-1024.848) -- 0:00:55
67500 -- (-1027.516) (-1023.881) [-1023.401] (-1025.221) * [-1033.978] (-1026.542) (-1024.373) (-1024.529) -- 0:00:55
68000 -- (-1024.146) (-1026.649) [-1029.186] (-1022.619) * [-1025.113] (-1024.101) (-1022.953) (-1025.662) -- 0:00:54
68500 -- (-1031.266) [-1027.334] (-1024.917) (-1025.687) * (-1031.012) [-1024.192] (-1025.552) (-1024.405) -- 0:00:54
69000 -- [-1027.191] (-1028.889) (-1024.218) (-1026.889) * (-1033.034) (-1025.409) [-1025.379] (-1023.397) -- 0:00:53
69500 -- (-1025.587) (-1028.456) [-1025.693] (-1029.904) * [-1028.636] (-1026.000) (-1025.681) (-1025.224) -- 0:00:53
70000 -- (-1025.264) (-1028.148) [-1023.669] (-1025.691) * (-1029.039) (-1029.637) (-1026.306) [-1025.310] -- 0:00:53
Average standard deviation of split frequencies: 0.029492
70500 -- (-1025.057) [-1023.103] (-1026.272) (-1027.615) * (-1036.428) (-1028.266) [-1027.437] (-1026.434) -- 0:00:52
71000 -- (-1028.203) [-1026.173] (-1027.244) (-1027.750) * [-1027.883] (-1027.852) (-1024.339) (-1021.958) -- 0:00:52
71500 -- (-1025.236) [-1027.516] (-1025.945) (-1025.925) * (-1040.268) (-1027.799) [-1026.166] (-1023.918) -- 0:00:51
72000 -- (-1026.995) [-1026.770] (-1027.642) (-1026.321) * (-1032.930) [-1024.284] (-1026.316) (-1023.894) -- 0:00:51
72500 -- (-1026.305) [-1025.519] (-1026.967) (-1025.044) * (-1037.481) (-1027.711) (-1023.021) [-1025.109] -- 0:00:51
73000 -- (-1026.425) (-1023.928) [-1026.101] (-1023.832) * [-1027.255] (-1024.286) (-1025.332) (-1027.511) -- 0:00:50
73500 -- [-1023.811] (-1025.315) (-1025.716) (-1024.603) * (-1031.448) [-1024.965] (-1025.258) (-1024.394) -- 0:01:03
74000 -- (-1024.239) [-1025.349] (-1026.206) (-1029.146) * (-1030.830) [-1022.649] (-1024.319) (-1024.806) -- 0:01:02
74500 -- [-1023.445] (-1026.648) (-1026.192) (-1029.170) * (-1048.553) [-1023.668] (-1023.948) (-1024.458) -- 0:01:02
75000 -- [-1025.779] (-1022.678) (-1023.704) (-1025.098) * (-1032.042) (-1025.512) [-1024.665] (-1024.017) -- 0:01:01
Average standard deviation of split frequencies: 0.025697
75500 -- [-1026.456] (-1025.461) (-1028.745) (-1024.863) * (-1025.535) [-1027.140] (-1022.440) (-1026.690) -- 0:01:01
76000 -- (-1027.025) (-1025.595) (-1029.412) [-1026.101] * (-1025.412) (-1028.499) (-1024.418) [-1024.224] -- 0:01:00
76500 -- (-1025.905) (-1025.240) (-1028.733) [-1024.976] * (-1028.598) (-1029.164) (-1025.412) [-1026.152] -- 0:01:00
77000 -- [-1026.404] (-1025.883) (-1026.790) (-1026.835) * (-1028.446) (-1025.058) (-1026.076) [-1025.789] -- 0:00:59
77500 -- [-1029.795] (-1025.534) (-1025.119) (-1028.535) * (-1028.553) [-1024.763] (-1026.056) (-1025.840) -- 0:00:59
78000 -- [-1025.180] (-1030.363) (-1025.962) (-1025.134) * [-1024.655] (-1024.235) (-1025.802) (-1026.891) -- 0:00:59
78500 -- [-1025.022] (-1023.867) (-1027.314) (-1024.967) * (-1023.927) (-1026.194) [-1025.544] (-1023.164) -- 0:00:58
79000 -- (-1028.133) [-1025.021] (-1028.877) (-1024.803) * [-1024.555] (-1024.895) (-1024.775) (-1025.895) -- 0:00:58
79500 -- (-1025.521) (-1024.979) (-1034.723) [-1028.448] * (-1024.335) (-1024.085) (-1024.466) [-1024.967] -- 0:00:57
80000 -- (-1026.286) [-1022.895] (-1030.695) (-1030.072) * [-1023.402] (-1024.984) (-1024.351) (-1028.729) -- 0:00:57
Average standard deviation of split frequencies: 0.023668
80500 -- (-1027.700) (-1030.310) [-1024.340] (-1028.661) * [-1024.353] (-1026.057) (-1027.609) (-1027.751) -- 0:00:57
81000 -- [-1024.816] (-1026.213) (-1025.361) (-1029.585) * (-1026.967) (-1023.529) (-1023.970) [-1023.879] -- 0:00:56
81500 -- (-1028.453) (-1025.487) (-1025.150) [-1022.715] * [-1025.223] (-1026.989) (-1025.185) (-1024.352) -- 0:00:56
82000 -- (-1025.521) (-1026.316) (-1023.670) [-1021.872] * (-1024.849) (-1025.868) (-1027.876) [-1023.882] -- 0:00:55
82500 -- (-1026.417) (-1024.749) (-1024.542) [-1023.233] * [-1023.347] (-1026.044) (-1026.471) (-1025.172) -- 0:00:55
83000 -- (-1023.515) (-1025.789) (-1026.096) [-1024.586] * (-1025.432) (-1026.310) (-1028.425) [-1025.993] -- 0:00:55
83500 -- (-1025.227) (-1026.581) [-1026.001] (-1023.824) * [-1025.558] (-1026.407) (-1027.932) (-1026.797) -- 0:00:54
84000 -- (-1026.184) (-1026.341) (-1025.276) [-1023.326] * [-1028.448] (-1025.205) (-1028.859) (-1022.481) -- 0:00:54
84500 -- (-1028.895) [-1026.011] (-1023.229) (-1022.526) * (-1024.934) (-1026.560) (-1026.258) [-1023.460] -- 0:00:54
85000 -- (-1028.446) [-1022.422] (-1024.199) (-1023.713) * (-1025.652) [-1026.675] (-1024.787) (-1025.440) -- 0:00:53
Average standard deviation of split frequencies: 0.023022
85500 -- (-1028.567) (-1022.612) (-1024.703) [-1024.564] * [-1024.694] (-1027.704) (-1027.891) (-1025.290) -- 0:00:53
86000 -- (-1025.788) [-1024.547] (-1028.763) (-1026.404) * (-1024.854) [-1025.437] (-1025.934) (-1026.629) -- 0:00:53
86500 -- [-1023.562] (-1024.162) (-1026.290) (-1030.211) * (-1026.909) (-1025.096) [-1026.123] (-1026.218) -- 0:00:52
87000 -- [-1025.418] (-1024.661) (-1023.807) (-1022.992) * (-1029.983) [-1025.183] (-1026.275) (-1028.018) -- 0:00:52
87500 -- (-1023.485) (-1023.361) [-1023.636] (-1026.800) * (-1029.282) [-1024.947] (-1027.600) (-1028.954) -- 0:00:52
88000 -- (-1024.839) [-1025.488] (-1028.019) (-1032.160) * (-1027.724) (-1025.732) [-1025.458] (-1024.782) -- 0:00:51
88500 -- (-1027.419) (-1025.070) (-1025.592) [-1025.059] * (-1025.844) (-1025.265) [-1025.715] (-1024.449) -- 0:01:01
89000 -- (-1025.447) (-1026.581) (-1023.944) [-1025.172] * (-1029.851) (-1024.457) (-1026.890) [-1024.342] -- 0:01:01
89500 -- (-1026.043) (-1024.836) (-1024.048) [-1023.245] * (-1029.213) (-1025.488) (-1028.159) [-1023.676] -- 0:01:01
90000 -- [-1025.181] (-1022.450) (-1025.933) (-1025.089) * (-1025.197) (-1030.799) (-1030.213) [-1023.033] -- 0:01:00
Average standard deviation of split frequencies: 0.019976
90500 -- [-1024.257] (-1022.952) (-1026.065) (-1025.319) * [-1023.254] (-1024.262) (-1025.010) (-1024.141) -- 0:01:00
91000 -- [-1023.534] (-1022.979) (-1026.152) (-1027.023) * (-1025.085) (-1026.466) [-1026.153] (-1028.690) -- 0:00:59
91500 -- (-1027.854) (-1026.399) [-1023.839] (-1027.872) * [-1026.221] (-1026.451) (-1026.090) (-1024.443) -- 0:00:59
92000 -- (-1024.880) (-1028.042) (-1026.265) [-1023.715] * (-1027.330) (-1026.691) (-1024.693) [-1023.370] -- 0:00:59
92500 -- (-1028.388) (-1026.970) (-1026.905) [-1025.656] * (-1025.866) (-1025.298) (-1022.989) [-1026.368] -- 0:00:58
93000 -- [-1025.893] (-1024.256) (-1025.880) (-1023.292) * (-1027.636) (-1024.242) (-1025.615) [-1027.256] -- 0:00:58
93500 -- (-1031.212) [-1026.391] (-1025.258) (-1024.191) * [-1025.014] (-1026.422) (-1024.988) (-1027.053) -- 0:00:58
94000 -- (-1027.521) (-1025.451) (-1024.645) [-1024.502] * [-1023.901] (-1025.954) (-1022.479) (-1025.874) -- 0:00:57
94500 -- [-1023.864] (-1025.934) (-1028.459) (-1025.325) * [-1025.040] (-1027.941) (-1027.168) (-1026.680) -- 0:00:57
95000 -- [-1024.266] (-1027.761) (-1026.313) (-1024.237) * (-1026.540) (-1027.684) [-1025.465] (-1024.554) -- 0:00:57
Average standard deviation of split frequencies: 0.019900
95500 -- (-1024.112) (-1023.497) [-1026.385] (-1023.836) * (-1028.911) (-1026.338) (-1026.768) [-1024.095] -- 0:00:56
96000 -- (-1024.313) (-1027.406) (-1025.337) [-1022.645] * (-1024.906) [-1023.655] (-1025.349) (-1022.500) -- 0:00:56
96500 -- (-1024.701) [-1030.332] (-1024.766) (-1024.207) * (-1027.759) (-1025.358) [-1024.603] (-1024.753) -- 0:00:56
97000 -- [-1024.275] (-1025.574) (-1025.584) (-1024.305) * (-1028.191) (-1029.442) (-1024.490) [-1024.142] -- 0:00:55
97500 -- (-1026.530) (-1024.744) (-1034.224) [-1024.722] * [-1026.564] (-1025.321) (-1024.315) (-1024.297) -- 0:00:55
98000 -- (-1027.827) (-1022.458) (-1027.155) [-1026.842] * [-1025.925] (-1024.819) (-1027.190) (-1024.504) -- 0:00:55
98500 -- (-1030.180) (-1024.853) [-1025.756] (-1028.637) * (-1033.779) (-1024.757) (-1030.489) [-1025.538] -- 0:00:54
99000 -- (-1026.619) [-1024.865] (-1027.865) (-1029.200) * (-1027.165) [-1029.879] (-1029.000) (-1022.638) -- 0:00:54
99500 -- [-1025.821] (-1023.600) (-1023.642) (-1026.677) * (-1024.320) (-1025.764) [-1024.528] (-1027.771) -- 0:00:54
100000 -- (-1025.262) [-1023.578] (-1024.104) (-1025.909) * (-1024.176) (-1025.363) (-1025.445) [-1028.479] -- 0:00:54
Average standard deviation of split frequencies: 0.022894
100500 -- (-1025.541) [-1025.911] (-1022.862) (-1026.563) * (-1026.186) [-1029.630] (-1025.136) (-1025.063) -- 0:00:53
101000 -- (-1027.785) (-1023.854) (-1024.314) [-1024.878] * (-1025.675) [-1027.562] (-1026.316) (-1026.815) -- 0:00:53
101500 -- (-1026.383) [-1025.613] (-1025.018) (-1027.088) * [-1023.431] (-1027.377) (-1026.627) (-1027.015) -- 0:00:53
102000 -- (-1026.892) [-1028.962] (-1024.258) (-1026.614) * (-1024.127) [-1023.284] (-1026.030) (-1026.037) -- 0:00:52
102500 -- [-1025.468] (-1024.405) (-1022.814) (-1025.141) * (-1023.441) [-1025.913] (-1025.107) (-1026.903) -- 0:00:52
103000 -- (-1027.517) (-1025.723) (-1024.144) [-1024.704] * (-1022.962) (-1024.322) (-1024.465) [-1024.887] -- 0:00:52
103500 -- (-1028.061) [-1022.108] (-1024.258) (-1023.970) * (-1024.554) (-1026.828) (-1024.935) [-1026.404] -- 0:01:00
104000 -- (-1025.801) (-1023.047) [-1023.002] (-1024.472) * [-1028.148] (-1027.252) (-1025.854) (-1024.815) -- 0:01:00
104500 -- (-1026.031) (-1022.369) [-1027.570] (-1026.483) * (-1023.008) (-1026.747) (-1026.181) [-1023.635] -- 0:00:59
105000 -- (-1027.743) [-1026.178] (-1025.645) (-1023.227) * (-1024.401) [-1025.890] (-1027.172) (-1025.513) -- 0:00:59
Average standard deviation of split frequencies: 0.021300
105500 -- [-1025.156] (-1023.890) (-1026.920) (-1022.989) * (-1026.668) (-1027.185) [-1027.621] (-1026.856) -- 0:00:59
106000 -- [-1024.227] (-1025.174) (-1025.370) (-1023.484) * (-1025.412) (-1025.452) (-1027.700) [-1025.055] -- 0:00:59
106500 -- [-1025.678] (-1028.366) (-1029.109) (-1022.956) * (-1029.351) [-1026.020] (-1028.640) (-1026.341) -- 0:00:58
107000 -- [-1026.932] (-1028.680) (-1024.933) (-1024.553) * (-1025.201) (-1026.708) (-1030.856) [-1026.981] -- 0:00:58
107500 -- (-1028.363) (-1023.589) [-1022.937] (-1026.187) * [-1025.231] (-1026.272) (-1034.251) (-1028.342) -- 0:00:58
108000 -- (-1029.926) (-1023.645) [-1023.740] (-1025.863) * (-1027.032) (-1025.385) (-1025.203) [-1031.968] -- 0:00:57
108500 -- [-1031.198] (-1029.382) (-1022.910) (-1026.322) * (-1021.987) [-1024.251] (-1025.954) (-1030.920) -- 0:00:57
109000 -- (-1028.640) (-1025.011) (-1023.772) [-1025.703] * [-1023.547] (-1027.169) (-1024.584) (-1025.708) -- 0:00:57
109500 -- (-1026.865) (-1025.826) (-1023.812) [-1023.499] * (-1023.211) (-1025.328) (-1024.479) [-1027.574] -- 0:00:56
110000 -- [-1024.587] (-1026.064) (-1030.118) (-1024.470) * (-1027.943) (-1025.159) [-1024.670] (-1028.715) -- 0:00:56
Average standard deviation of split frequencies: 0.021772
110500 -- (-1025.408) (-1028.497) (-1029.846) [-1024.547] * (-1026.943) (-1031.832) (-1025.049) [-1026.482] -- 0:00:56
111000 -- (-1023.442) (-1028.122) (-1026.400) [-1024.903] * [-1027.935] (-1031.911) (-1025.284) (-1028.624) -- 0:00:56
111500 -- (-1023.875) (-1024.919) (-1024.587) [-1026.846] * (-1031.983) (-1033.303) [-1023.796] (-1024.081) -- 0:00:55
112000 -- [-1027.194] (-1025.709) (-1024.155) (-1027.295) * [-1025.750] (-1030.998) (-1023.701) (-1026.002) -- 0:00:55
112500 -- (-1025.353) (-1028.450) [-1025.044] (-1027.786) * (-1024.816) (-1026.740) [-1027.757] (-1026.141) -- 0:00:55
113000 -- [-1022.962] (-1024.986) (-1027.220) (-1023.579) * [-1025.496] (-1025.135) (-1030.302) (-1026.041) -- 0:00:54
113500 -- (-1028.691) (-1027.988) (-1026.560) [-1023.751] * (-1027.770) (-1026.188) [-1026.170] (-1028.458) -- 0:00:54
114000 -- [-1026.249] (-1028.507) (-1025.770) (-1024.784) * (-1024.875) (-1026.983) (-1026.779) [-1024.217] -- 0:00:54
114500 -- (-1029.593) [-1026.830] (-1026.385) (-1029.201) * (-1024.990) (-1029.829) (-1028.174) [-1026.484] -- 0:00:54
115000 -- (-1025.030) [-1026.369] (-1025.972) (-1026.684) * (-1025.183) (-1025.201) [-1028.894] (-1025.502) -- 0:00:53
Average standard deviation of split frequencies: 0.021389
115500 -- [-1024.360] (-1024.653) (-1027.264) (-1024.720) * [-1026.104] (-1025.863) (-1027.041) (-1025.348) -- 0:00:53
116000 -- [-1025.139] (-1023.864) (-1026.410) (-1026.301) * [-1025.362] (-1024.620) (-1028.381) (-1024.552) -- 0:00:53
116500 -- (-1027.026) (-1024.457) [-1025.037] (-1028.680) * (-1025.069) (-1028.015) [-1028.761] (-1025.235) -- 0:00:53
117000 -- (-1028.128) (-1026.161) [-1025.082] (-1026.661) * (-1024.656) (-1026.305) [-1026.682] (-1028.045) -- 0:00:52
117500 -- (-1027.153) (-1026.926) [-1026.459] (-1025.692) * (-1024.248) (-1027.016) (-1027.914) [-1024.655] -- 0:00:52
118000 -- (-1024.147) [-1024.496] (-1024.943) (-1029.975) * (-1022.778) (-1025.544) [-1025.791] (-1031.042) -- 0:00:52
118500 -- (-1025.485) [-1025.173] (-1024.133) (-1026.114) * (-1022.498) [-1025.265] (-1028.196) (-1023.369) -- 0:00:52
119000 -- (-1024.773) (-1025.237) (-1024.466) [-1025.264] * [-1029.020] (-1028.721) (-1025.083) (-1027.955) -- 0:00:59
119500 -- (-1027.036) (-1025.392) (-1025.412) [-1024.861] * (-1026.040) (-1028.758) (-1024.588) [-1028.463] -- 0:00:58
120000 -- [-1024.313] (-1025.705) (-1024.965) (-1024.127) * (-1024.752) [-1025.789] (-1025.776) (-1024.721) -- 0:00:58
Average standard deviation of split frequencies: 0.021487
120500 -- (-1024.537) (-1025.523) (-1024.288) [-1023.599] * [-1026.290] (-1024.877) (-1027.172) (-1025.137) -- 0:00:58
121000 -- (-1022.829) (-1031.269) [-1026.385] (-1027.131) * [-1027.533] (-1024.781) (-1026.460) (-1024.639) -- 0:00:58
121500 -- [-1026.055] (-1026.950) (-1026.875) (-1024.343) * [-1030.778] (-1025.668) (-1024.816) (-1027.782) -- 0:00:57
122000 -- [-1026.858] (-1027.089) (-1025.864) (-1027.810) * (-1026.006) (-1025.573) [-1026.331] (-1030.121) -- 0:00:57
122500 -- (-1027.635) [-1026.795] (-1025.289) (-1026.435) * (-1022.617) [-1027.055] (-1024.286) (-1027.396) -- 0:00:57
123000 -- (-1024.257) [-1025.958] (-1034.996) (-1024.292) * [-1026.007] (-1025.642) (-1030.953) (-1027.023) -- 0:00:57
123500 -- (-1026.601) [-1022.612] (-1025.035) (-1026.628) * [-1027.940] (-1026.698) (-1029.101) (-1024.653) -- 0:00:56
124000 -- (-1029.588) [-1025.247] (-1024.825) (-1025.434) * (-1025.270) (-1028.525) [-1023.892] (-1023.638) -- 0:00:56
124500 -- (-1027.932) (-1023.605) [-1025.567] (-1029.864) * [-1023.727] (-1034.323) (-1024.460) (-1023.602) -- 0:00:56
125000 -- (-1027.720) (-1025.599) [-1025.876] (-1027.470) * (-1028.009) [-1024.547] (-1024.295) (-1026.050) -- 0:00:56
Average standard deviation of split frequencies: 0.021660
125500 -- [-1028.356] (-1022.949) (-1025.117) (-1027.346) * (-1022.334) (-1027.457) [-1028.489] (-1027.056) -- 0:00:55
126000 -- (-1027.057) [-1024.978] (-1027.956) (-1026.510) * [-1023.138] (-1031.416) (-1025.955) (-1026.084) -- 0:00:55
126500 -- (-1026.345) (-1023.459) (-1026.250) [-1023.188] * (-1024.005) (-1024.977) (-1026.361) [-1026.013] -- 0:00:55
127000 -- (-1025.548) (-1025.177) [-1023.937] (-1026.428) * (-1025.142) [-1025.359] (-1026.285) (-1027.386) -- 0:00:54
127500 -- [-1025.713] (-1024.242) (-1023.393) (-1024.957) * [-1024.522] (-1024.801) (-1025.577) (-1027.562) -- 0:00:54
128000 -- (-1025.679) (-1029.606) [-1028.368] (-1027.845) * (-1024.936) [-1025.263] (-1024.965) (-1029.354) -- 0:00:54
128500 -- [-1024.796] (-1025.164) (-1026.330) (-1026.601) * [-1027.378] (-1026.267) (-1025.537) (-1028.684) -- 0:00:54
129000 -- [-1024.470] (-1026.479) (-1024.403) (-1025.334) * (-1029.070) (-1024.138) (-1028.959) [-1027.164] -- 0:00:54
129500 -- [-1025.448] (-1024.303) (-1024.638) (-1023.797) * (-1026.647) (-1025.412) (-1026.351) [-1026.154] -- 0:00:53
130000 -- [-1024.648] (-1026.306) (-1031.970) (-1029.135) * (-1028.090) (-1025.611) [-1025.743] (-1025.153) -- 0:00:53
Average standard deviation of split frequencies: 0.021836
130500 -- (-1025.950) [-1026.951] (-1027.118) (-1024.156) * (-1024.716) (-1024.578) (-1027.807) [-1028.877] -- 0:00:53
131000 -- (-1026.466) (-1029.297) (-1027.160) [-1024.556] * (-1024.303) (-1024.332) [-1028.296] (-1027.404) -- 0:00:53
131500 -- (-1026.848) [-1025.096] (-1025.048) (-1024.222) * (-1026.896) (-1024.194) [-1026.903] (-1030.397) -- 0:00:52
132000 -- [-1024.491] (-1025.659) (-1027.294) (-1026.775) * (-1026.845) [-1025.371] (-1024.928) (-1026.804) -- 0:00:52
132500 -- (-1026.675) (-1026.207) (-1031.947) [-1032.106] * [-1026.162] (-1027.651) (-1026.481) (-1025.849) -- 0:00:52
133000 -- (-1025.571) [-1024.861] (-1025.047) (-1029.954) * (-1024.185) (-1028.507) (-1024.135) [-1027.576] -- 0:00:52
133500 -- (-1026.040) (-1027.567) (-1027.923) [-1025.542] * (-1026.691) (-1025.294) [-1024.446] (-1025.905) -- 0:00:51
134000 -- [-1026.475] (-1026.341) (-1025.929) (-1025.255) * (-1024.049) (-1028.260) (-1024.038) [-1023.733] -- 0:00:58
134500 -- (-1025.548) (-1028.300) (-1024.947) [-1023.564] * [-1027.522] (-1024.382) (-1025.291) (-1024.265) -- 0:00:57
135000 -- (-1024.606) (-1026.243) (-1029.636) [-1025.510] * [-1024.225] (-1026.578) (-1025.364) (-1024.599) -- 0:00:57
Average standard deviation of split frequencies: 0.020605
135500 -- (-1031.515) (-1023.913) [-1026.822] (-1026.873) * [-1023.842] (-1027.173) (-1025.754) (-1028.254) -- 0:00:57
136000 -- (-1029.826) (-1029.350) [-1026.923] (-1023.897) * [-1023.108] (-1025.802) (-1024.505) (-1028.173) -- 0:00:57
136500 -- (-1028.682) (-1028.727) (-1026.157) [-1024.035] * [-1022.203] (-1024.210) (-1024.379) (-1025.985) -- 0:00:56
137000 -- [-1024.123] (-1029.551) (-1025.075) (-1030.640) * [-1027.988] (-1026.428) (-1026.570) (-1025.579) -- 0:00:56
137500 -- (-1025.195) (-1024.061) [-1023.294] (-1027.418) * (-1025.589) [-1025.200] (-1027.484) (-1026.617) -- 0:00:56
138000 -- [-1027.029] (-1028.007) (-1023.490) (-1027.408) * (-1027.577) [-1024.672] (-1025.757) (-1032.778) -- 0:00:56
138500 -- (-1025.425) (-1024.005) [-1025.061] (-1031.419) * (-1025.615) (-1025.071) (-1026.003) [-1024.183] -- 0:00:55
139000 -- [-1024.640] (-1025.441) (-1028.680) (-1026.314) * [-1026.843] (-1025.149) (-1024.538) (-1024.063) -- 0:00:55
139500 -- (-1024.939) [-1022.690] (-1030.440) (-1025.948) * (-1025.056) [-1025.690] (-1024.093) (-1023.218) -- 0:00:55
140000 -- (-1024.896) [-1025.518] (-1029.801) (-1029.626) * (-1026.450) (-1030.091) [-1023.325] (-1025.508) -- 0:00:55
Average standard deviation of split frequencies: 0.023831
140500 -- (-1025.243) (-1024.022) (-1024.192) [-1025.002] * (-1022.820) (-1024.744) [-1024.633] (-1026.498) -- 0:00:55
141000 -- (-1024.496) (-1024.787) [-1023.240] (-1025.241) * [-1028.079] (-1023.989) (-1024.424) (-1026.131) -- 0:00:54
141500 -- (-1025.377) [-1022.464] (-1025.158) (-1026.423) * (-1025.915) [-1023.165] (-1024.333) (-1030.352) -- 0:00:54
142000 -- (-1027.623) [-1025.206] (-1024.339) (-1023.062) * [-1025.592] (-1024.170) (-1025.127) (-1026.069) -- 0:00:54
142500 -- [-1023.297] (-1023.883) (-1025.302) (-1025.771) * [-1025.127] (-1023.813) (-1025.098) (-1025.524) -- 0:00:54
143000 -- (-1024.566) (-1023.679) (-1025.153) [-1027.495] * (-1026.960) (-1023.912) [-1023.272] (-1027.110) -- 0:00:53
143500 -- (-1023.408) [-1021.946] (-1026.107) (-1026.199) * (-1025.982) (-1024.119) [-1026.620] (-1025.040) -- 0:00:53
144000 -- (-1025.500) (-1029.288) [-1025.428] (-1024.429) * (-1025.481) (-1024.808) (-1025.895) [-1026.254] -- 0:00:53
144500 -- (-1024.138) [-1024.206] (-1026.113) (-1026.525) * [-1026.115] (-1026.002) (-1025.429) (-1026.560) -- 0:00:53
145000 -- (-1025.373) (-1023.483) [-1031.945] (-1025.387) * [-1025.838] (-1022.065) (-1027.022) (-1025.506) -- 0:00:53
Average standard deviation of split frequencies: 0.022243
145500 -- [-1023.552] (-1025.383) (-1023.665) (-1027.250) * [-1027.857] (-1022.700) (-1025.930) (-1028.642) -- 0:00:52
146000 -- (-1025.564) (-1024.383) [-1025.224] (-1025.947) * (-1025.470) (-1027.389) (-1026.300) [-1025.109] -- 0:00:52
146500 -- (-1028.927) (-1024.668) (-1023.583) [-1030.472] * (-1024.692) (-1028.593) [-1025.065] (-1030.299) -- 0:00:52
147000 -- [-1024.678] (-1023.005) (-1023.904) (-1027.039) * (-1025.763) (-1027.556) [-1023.969] (-1027.765) -- 0:00:52
147500 -- (-1025.833) (-1022.753) (-1023.033) [-1025.931] * (-1028.254) (-1027.968) [-1023.254] (-1026.682) -- 0:00:52
148000 -- [-1025.695] (-1023.502) (-1027.826) (-1027.122) * (-1025.393) (-1033.243) (-1026.829) [-1023.974] -- 0:00:51
148500 -- (-1024.075) (-1025.318) (-1027.870) [-1025.469] * (-1023.004) [-1024.394] (-1024.786) (-1024.507) -- 0:00:51
149000 -- (-1024.053) [-1026.858] (-1026.664) (-1025.146) * (-1029.150) (-1027.163) [-1028.590] (-1027.293) -- 0:00:57
149500 -- (-1024.860) (-1025.498) (-1024.778) [-1025.837] * (-1025.435) (-1024.871) (-1025.879) [-1024.984] -- 0:00:56
150000 -- (-1026.751) (-1023.678) [-1024.739] (-1022.021) * (-1025.220) (-1025.683) (-1022.764) [-1024.475] -- 0:00:56
Average standard deviation of split frequencies: 0.021902
150500 -- (-1024.858) (-1025.359) [-1025.920] (-1023.388) * (-1023.956) (-1024.935) [-1024.191] (-1024.252) -- 0:00:56
151000 -- (-1025.779) (-1024.977) (-1027.130) [-1023.846] * (-1025.128) [-1022.973] (-1022.204) (-1025.011) -- 0:00:56
151500 -- (-1026.303) (-1025.686) [-1025.673] (-1025.950) * [-1025.703] (-1022.613) (-1024.388) (-1023.387) -- 0:00:56
152000 -- (-1024.103) (-1027.357) (-1024.625) [-1024.026] * [-1028.546] (-1023.276) (-1026.089) (-1024.815) -- 0:00:55
152500 -- [-1024.506] (-1025.393) (-1023.132) (-1024.697) * [-1024.677] (-1024.257) (-1026.044) (-1025.716) -- 0:00:55
153000 -- [-1027.097] (-1026.823) (-1023.546) (-1022.806) * (-1023.148) (-1023.963) [-1025.040] (-1024.212) -- 0:00:55
153500 -- (-1027.616) (-1026.875) [-1028.515] (-1026.044) * (-1026.198) (-1024.556) [-1024.523] (-1023.064) -- 0:00:55
154000 -- (-1027.575) (-1026.527) (-1025.980) [-1025.490] * (-1024.722) [-1025.108] (-1024.670) (-1023.352) -- 0:00:54
154500 -- (-1025.316) (-1030.626) (-1023.825) [-1024.605] * (-1024.685) [-1024.015] (-1024.274) (-1025.423) -- 0:00:54
155000 -- [-1026.673] (-1028.159) (-1024.112) (-1025.404) * (-1025.071) (-1023.185) [-1023.893] (-1028.626) -- 0:00:54
Average standard deviation of split frequencies: 0.019978
155500 -- (-1024.966) [-1025.698] (-1027.164) (-1030.611) * (-1025.058) [-1023.589] (-1023.732) (-1024.878) -- 0:00:54
156000 -- (-1029.529) (-1027.058) [-1025.574] (-1025.479) * (-1026.034) [-1022.741] (-1022.173) (-1026.694) -- 0:00:54
156500 -- (-1028.967) [-1024.214] (-1026.172) (-1025.284) * (-1025.339) (-1026.717) [-1025.915] (-1029.117) -- 0:00:53
157000 -- (-1026.765) (-1026.397) [-1026.507] (-1024.557) * (-1024.582) (-1023.118) [-1025.747] (-1025.200) -- 0:00:53
157500 -- (-1029.055) [-1026.163] (-1024.759) (-1024.760) * [-1026.795] (-1023.534) (-1025.931) (-1028.383) -- 0:00:53
158000 -- (-1028.881) [-1024.093] (-1028.141) (-1024.889) * (-1025.064) [-1023.206] (-1027.494) (-1024.413) -- 0:00:53
158500 -- [-1025.145] (-1028.884) (-1028.166) (-1025.168) * (-1029.760) (-1024.643) (-1025.132) [-1028.035] -- 0:00:53
159000 -- [-1024.326] (-1025.470) (-1026.990) (-1026.783) * (-1025.959) (-1027.247) (-1026.329) [-1025.938] -- 0:00:52
159500 -- (-1026.188) (-1029.723) [-1027.482] (-1028.141) * (-1025.699) (-1022.264) [-1024.715] (-1028.236) -- 0:00:52
160000 -- (-1025.344) [-1023.151] (-1031.002) (-1027.124) * (-1026.543) (-1024.669) [-1022.883] (-1025.649) -- 0:00:52
Average standard deviation of split frequencies: 0.018745
160500 -- (-1023.102) (-1025.059) (-1025.132) [-1026.600] * [-1026.519] (-1025.792) (-1029.580) (-1023.239) -- 0:00:52
161000 -- (-1023.950) (-1026.293) (-1026.699) [-1023.824] * (-1027.676) [-1025.479] (-1024.141) (-1027.946) -- 0:00:52
161500 -- [-1024.116] (-1026.546) (-1026.430) (-1026.447) * (-1025.916) [-1025.018] (-1025.610) (-1025.760) -- 0:00:51
162000 -- (-1023.603) (-1026.043) (-1028.110) [-1026.467] * (-1025.597) (-1025.112) [-1023.479] (-1024.836) -- 0:00:51
162500 -- [-1023.223] (-1023.311) (-1027.519) (-1027.792) * (-1027.902) (-1026.267) [-1022.755] (-1026.598) -- 0:00:51
163000 -- (-1024.744) [-1022.043] (-1026.851) (-1028.517) * (-1025.764) (-1025.954) (-1026.085) [-1024.085] -- 0:00:51
163500 -- (-1021.595) (-1023.176) (-1026.736) [-1027.577] * (-1025.872) (-1025.009) [-1024.400] (-1026.164) -- 0:00:51
164000 -- [-1025.978] (-1029.006) (-1025.354) (-1025.992) * (-1025.455) [-1024.491] (-1025.233) (-1027.268) -- 0:00:50
164500 -- (-1024.909) [-1023.111] (-1024.487) (-1025.630) * (-1028.641) [-1024.606] (-1027.689) (-1029.764) -- 0:00:55
165000 -- [-1026.976] (-1025.703) (-1025.544) (-1023.393) * (-1026.710) [-1027.792] (-1024.981) (-1026.799) -- 0:00:55
Average standard deviation of split frequencies: 0.019281
165500 -- (-1027.629) (-1027.964) [-1025.502] (-1025.148) * (-1024.561) (-1028.931) [-1026.770] (-1025.871) -- 0:00:55
166000 -- (-1034.230) (-1025.563) (-1026.391) [-1024.521] * [-1030.121] (-1023.120) (-1026.579) (-1022.966) -- 0:00:55
166500 -- (-1027.983) [-1021.989] (-1024.825) (-1024.834) * (-1024.561) [-1024.413] (-1025.720) (-1026.919) -- 0:00:55
167000 -- [-1029.029] (-1023.285) (-1025.684) (-1027.468) * (-1025.206) (-1024.419) (-1025.008) [-1026.250] -- 0:00:54
167500 -- (-1028.760) (-1022.499) [-1026.656] (-1030.961) * [-1025.941] (-1026.092) (-1028.314) (-1029.783) -- 0:00:54
168000 -- (-1023.923) [-1024.762] (-1026.403) (-1026.491) * (-1026.050) (-1023.685) (-1028.866) [-1027.173] -- 0:00:54
168500 -- (-1025.154) (-1024.111) (-1025.664) [-1026.333] * (-1025.788) [-1024.435] (-1032.874) (-1026.916) -- 0:00:54
169000 -- [-1023.115] (-1022.839) (-1026.807) (-1026.246) * [-1027.949] (-1032.262) (-1026.926) (-1025.677) -- 0:00:54
169500 -- [-1024.413] (-1023.548) (-1028.180) (-1025.712) * (-1026.425) (-1025.469) (-1023.434) [-1026.349] -- 0:00:53
170000 -- [-1026.074] (-1023.989) (-1032.334) (-1025.141) * (-1026.798) (-1025.926) [-1023.220] (-1025.526) -- 0:00:53
Average standard deviation of split frequencies: 0.018753
170500 -- (-1024.246) (-1024.665) [-1024.064] (-1026.997) * (-1028.837) (-1024.381) [-1024.659] (-1023.954) -- 0:00:53
171000 -- [-1025.719] (-1023.382) (-1024.102) (-1025.846) * (-1025.893) (-1026.349) (-1025.499) [-1022.919] -- 0:00:53
171500 -- (-1025.576) (-1025.166) (-1026.842) [-1024.888] * (-1027.485) [-1029.718] (-1023.503) (-1024.534) -- 0:00:53
172000 -- (-1023.369) [-1024.001] (-1028.044) (-1027.051) * (-1027.075) (-1028.948) [-1024.792] (-1025.448) -- 0:00:52
172500 -- (-1029.805) (-1024.902) (-1025.399) [-1025.910] * [-1026.575] (-1023.163) (-1023.619) (-1027.384) -- 0:00:52
173000 -- (-1021.930) [-1026.219] (-1023.567) (-1024.476) * [-1025.415] (-1024.436) (-1023.330) (-1025.100) -- 0:00:52
173500 -- (-1024.992) (-1025.690) [-1025.326] (-1027.273) * (-1028.634) (-1024.620) [-1024.702] (-1025.348) -- 0:00:52
174000 -- (-1024.175) (-1025.934) [-1023.578] (-1025.357) * (-1028.981) [-1026.134] (-1025.058) (-1025.251) -- 0:00:52
174500 -- (-1024.646) [-1023.657] (-1021.904) (-1027.458) * (-1026.208) (-1024.947) (-1025.002) [-1026.190] -- 0:00:52
175000 -- (-1024.055) (-1024.233) (-1025.747) [-1025.088] * (-1026.509) (-1025.320) (-1026.450) [-1027.075] -- 0:00:51
Average standard deviation of split frequencies: 0.016353
175500 -- (-1023.352) (-1024.455) (-1027.705) [-1025.871] * [-1024.112] (-1025.956) (-1027.560) (-1026.514) -- 0:00:51
176000 -- [-1023.615] (-1026.235) (-1027.208) (-1026.028) * (-1027.410) (-1027.615) (-1024.955) [-1026.170] -- 0:00:51
176500 -- (-1024.389) [-1022.649] (-1028.409) (-1026.500) * (-1024.312) (-1026.359) (-1025.281) [-1027.929] -- 0:00:51
177000 -- (-1023.002) (-1022.707) (-1026.168) [-1025.063] * (-1025.015) (-1025.367) [-1026.315] (-1024.190) -- 0:00:51
177500 -- (-1023.996) [-1025.445] (-1026.662) (-1025.085) * (-1023.749) [-1025.205] (-1024.964) (-1025.970) -- 0:00:50
178000 -- [-1027.022] (-1026.047) (-1032.221) (-1024.439) * (-1023.720) [-1022.930] (-1025.406) (-1024.099) -- 0:00:50
178500 -- (-1027.020) (-1023.670) [-1026.312] (-1025.346) * (-1024.726) (-1026.508) [-1026.914] (-1025.045) -- 0:00:50
179000 -- (-1026.405) [-1024.287] (-1030.098) (-1024.396) * [-1025.434] (-1023.958) (-1029.287) (-1025.564) -- 0:00:50
179500 -- (-1027.273) (-1021.757) [-1025.321] (-1025.363) * (-1024.620) [-1022.940] (-1032.778) (-1028.016) -- 0:00:54
180000 -- (-1026.607) [-1026.076] (-1026.655) (-1024.522) * (-1024.829) (-1024.054) (-1026.320) [-1024.743] -- 0:00:54
Average standard deviation of split frequencies: 0.016205
180500 -- (-1026.808) [-1022.550] (-1025.231) (-1025.702) * [-1026.021] (-1024.100) (-1025.199) (-1023.687) -- 0:00:54
181000 -- [-1022.984] (-1023.669) (-1026.612) (-1024.357) * (-1024.828) (-1023.914) (-1030.158) [-1023.983] -- 0:00:54
181500 -- (-1022.307) (-1023.996) (-1029.153) [-1024.683] * [-1028.143] (-1025.477) (-1028.333) (-1024.361) -- 0:00:54
182000 -- (-1024.573) [-1025.468] (-1024.472) (-1029.210) * (-1024.819) [-1024.630] (-1028.105) (-1022.108) -- 0:00:53
182500 -- (-1029.139) [-1023.640] (-1027.998) (-1025.793) * (-1028.409) [-1023.793] (-1026.502) (-1024.572) -- 0:00:53
183000 -- (-1030.813) [-1028.127] (-1028.340) (-1025.067) * (-1024.303) (-1027.756) [-1025.265] (-1024.615) -- 0:00:53
183500 -- [-1023.764] (-1028.118) (-1026.131) (-1026.281) * (-1024.966) (-1024.534) (-1028.040) [-1026.032] -- 0:00:53
184000 -- (-1025.331) [-1024.590] (-1028.394) (-1024.943) * (-1024.088) (-1027.085) [-1026.660] (-1026.464) -- 0:00:53
184500 -- (-1023.070) (-1026.605) (-1028.857) [-1025.151] * (-1027.868) (-1025.464) (-1025.449) [-1026.833] -- 0:00:53
185000 -- (-1024.323) (-1028.072) [-1023.307] (-1025.276) * (-1026.067) (-1026.251) [-1026.263] (-1031.422) -- 0:00:52
Average standard deviation of split frequencies: 0.015473
185500 -- (-1023.457) (-1025.663) [-1023.238] (-1025.819) * (-1027.231) (-1028.784) (-1025.093) [-1025.979] -- 0:00:52
186000 -- (-1024.173) (-1023.344) [-1024.082] (-1027.353) * (-1025.176) (-1025.837) [-1024.503] (-1025.836) -- 0:00:52
186500 -- (-1027.999) (-1024.578) (-1026.126) [-1025.257] * (-1023.862) (-1024.976) [-1024.231] (-1024.403) -- 0:00:52
187000 -- (-1025.710) (-1023.398) [-1025.746] (-1025.476) * (-1025.542) (-1026.077) (-1027.970) [-1024.866] -- 0:00:52
187500 -- (-1025.352) (-1025.426) [-1023.383] (-1026.447) * (-1025.138) (-1027.188) (-1025.013) [-1025.902] -- 0:00:52
188000 -- [-1023.622] (-1031.250) (-1027.989) (-1025.752) * [-1025.967] (-1025.833) (-1024.932) (-1027.530) -- 0:00:51
188500 -- (-1023.014) [-1026.321] (-1024.318) (-1025.713) * [-1024.223] (-1026.551) (-1028.651) (-1024.999) -- 0:00:51
189000 -- (-1029.448) (-1022.197) [-1023.144] (-1026.933) * [-1025.491] (-1024.987) (-1030.840) (-1025.903) -- 0:00:51
189500 -- (-1024.432) [-1022.734] (-1025.428) (-1030.567) * (-1028.182) (-1028.308) (-1030.201) [-1023.762] -- 0:00:51
190000 -- (-1026.934) (-1024.687) [-1025.560] (-1025.549) * (-1026.825) [-1023.826] (-1023.674) (-1025.479) -- 0:00:51
Average standard deviation of split frequencies: 0.015823
190500 -- (-1025.007) [-1025.827] (-1023.699) (-1024.741) * [-1025.952] (-1026.512) (-1028.371) (-1028.119) -- 0:00:50
191000 -- (-1026.171) [-1025.200] (-1027.269) (-1023.682) * (-1029.389) (-1024.044) [-1026.565] (-1035.263) -- 0:00:50
191500 -- (-1027.814) (-1023.335) (-1021.587) [-1024.549] * (-1025.044) [-1024.176] (-1025.287) (-1024.625) -- 0:00:50
192000 -- [-1023.544] (-1022.894) (-1024.562) (-1026.535) * (-1026.116) (-1023.779) [-1027.774] (-1024.755) -- 0:00:54
192500 -- (-1025.107) [-1025.351] (-1028.897) (-1027.314) * (-1024.477) [-1025.218] (-1027.722) (-1024.486) -- 0:00:54
193000 -- [-1023.239] (-1023.165) (-1026.589) (-1023.705) * (-1025.061) [-1025.176] (-1024.973) (-1031.025) -- 0:00:54
193500 -- (-1023.012) [-1024.236] (-1025.887) (-1024.150) * (-1026.537) (-1029.784) (-1024.960) [-1026.520] -- 0:00:54
194000 -- [-1025.502] (-1025.737) (-1023.930) (-1023.734) * (-1023.819) (-1028.258) (-1024.978) [-1023.920] -- 0:00:54
194500 -- (-1023.899) (-1025.241) [-1024.958] (-1024.085) * [-1023.823] (-1026.838) (-1025.249) (-1024.792) -- 0:00:53
195000 -- (-1028.509) (-1032.421) [-1025.219] (-1025.953) * (-1023.372) (-1029.752) (-1026.040) [-1026.583] -- 0:00:53
Average standard deviation of split frequencies: 0.016962
195500 -- (-1022.765) [-1024.038] (-1022.659) (-1024.968) * (-1022.948) [-1026.831] (-1024.272) (-1026.134) -- 0:00:53
196000 -- (-1028.061) (-1025.621) [-1023.951] (-1025.225) * (-1025.999) (-1028.120) (-1024.724) [-1023.821] -- 0:00:53
196500 -- (-1025.493) [-1024.385] (-1026.229) (-1026.499) * [-1024.157] (-1027.549) (-1021.712) (-1023.664) -- 0:00:53
197000 -- (-1024.917) (-1026.275) (-1026.815) [-1028.357] * (-1027.814) [-1024.817] (-1024.781) (-1025.277) -- 0:00:52
197500 -- (-1025.806) (-1025.938) [-1027.921] (-1025.330) * [-1024.406] (-1024.684) (-1024.319) (-1024.730) -- 0:00:52
198000 -- (-1027.966) (-1025.950) (-1023.799) [-1024.604] * (-1025.980) (-1026.811) [-1024.245] (-1027.893) -- 0:00:52
198500 -- [-1028.353] (-1025.559) (-1027.632) (-1029.671) * [-1025.089] (-1026.584) (-1025.381) (-1026.716) -- 0:00:52
199000 -- (-1035.431) (-1028.764) (-1027.630) [-1026.153] * (-1023.610) (-1024.694) [-1024.590] (-1027.701) -- 0:00:52
199500 -- (-1026.516) (-1025.696) (-1025.712) [-1024.711] * [-1026.501] (-1023.620) (-1026.704) (-1025.273) -- 0:00:52
200000 -- (-1024.964) (-1023.946) [-1025.076] (-1030.580) * (-1025.023) (-1029.532) (-1026.543) [-1027.599] -- 0:00:51
Average standard deviation of split frequencies: 0.016692
200500 -- (-1023.473) (-1024.573) (-1027.959) [-1027.378] * (-1024.507) (-1025.416) [-1026.259] (-1023.893) -- 0:00:51
201000 -- [-1023.284] (-1024.411) (-1024.978) (-1026.912) * (-1022.486) (-1026.839) (-1026.321) [-1022.732] -- 0:00:51
201500 -- [-1025.494] (-1023.473) (-1023.719) (-1027.676) * (-1024.318) [-1025.306] (-1028.099) (-1025.226) -- 0:00:51
202000 -- [-1024.778] (-1028.003) (-1024.397) (-1027.772) * (-1025.866) (-1024.059) (-1028.415) [-1026.892] -- 0:00:51
202500 -- (-1025.419) [-1025.643] (-1025.799) (-1024.799) * (-1029.802) [-1021.625] (-1027.709) (-1028.051) -- 0:00:51
203000 -- (-1026.487) (-1022.549) (-1026.438) [-1025.192] * (-1026.291) (-1024.632) [-1026.687] (-1027.911) -- 0:00:51
203500 -- (-1025.850) (-1026.591) [-1027.438] (-1026.587) * (-1025.130) (-1026.933) (-1028.171) [-1023.540] -- 0:00:50
204000 -- [-1023.353] (-1024.706) (-1029.497) (-1025.783) * (-1027.111) (-1024.713) [-1028.787] (-1030.390) -- 0:00:50
204500 -- (-1025.242) [-1024.478] (-1023.833) (-1030.583) * [-1025.366] (-1030.960) (-1024.826) (-1024.217) -- 0:00:50
205000 -- (-1023.752) (-1026.178) [-1027.049] (-1026.352) * (-1025.530) (-1027.001) [-1024.771] (-1025.247) -- 0:00:50
Average standard deviation of split frequencies: 0.015778
205500 -- [-1025.995] (-1024.366) (-1029.683) (-1028.364) * (-1025.199) (-1029.247) [-1025.180] (-1027.901) -- 0:00:50
206000 -- (-1027.048) (-1022.102) (-1025.027) [-1024.190] * [-1025.072] (-1028.841) (-1025.825) (-1027.115) -- 0:00:50
206500 -- (-1026.137) [-1023.972] (-1024.016) (-1029.721) * (-1023.704) [-1022.856] (-1025.609) (-1028.786) -- 0:00:53
207000 -- (-1024.531) [-1023.584] (-1026.157) (-1031.289) * [-1023.047] (-1024.624) (-1025.531) (-1023.227) -- 0:00:53
207500 -- (-1025.732) (-1025.268) [-1023.719] (-1033.156) * (-1023.823) (-1023.829) (-1026.196) [-1025.577] -- 0:00:53
208000 -- [-1029.360] (-1027.043) (-1025.634) (-1029.287) * (-1025.742) (-1030.013) [-1025.336] (-1024.706) -- 0:00:53
208500 -- (-1024.367) (-1025.720) (-1027.493) [-1024.817] * (-1025.350) [-1024.910] (-1027.166) (-1028.831) -- 0:00:53
209000 -- (-1029.169) [-1025.408] (-1024.744) (-1024.044) * (-1025.247) [-1027.477] (-1025.449) (-1026.104) -- 0:00:52
209500 -- (-1026.863) (-1023.589) [-1025.168] (-1024.690) * (-1026.877) (-1022.731) (-1024.960) [-1025.818] -- 0:00:52
210000 -- [-1025.028] (-1023.582) (-1023.667) (-1028.832) * (-1023.178) (-1024.982) [-1024.450] (-1026.140) -- 0:00:52
Average standard deviation of split frequencies: 0.015546
210500 -- [-1022.868] (-1025.271) (-1024.281) (-1026.971) * (-1023.417) (-1025.651) [-1026.673] (-1027.593) -- 0:00:52
211000 -- (-1027.232) [-1024.675] (-1024.918) (-1027.840) * (-1024.814) (-1029.229) (-1024.851) [-1023.412] -- 0:00:52
211500 -- (-1027.073) (-1025.416) [-1026.563] (-1026.718) * (-1022.807) (-1023.447) (-1029.207) [-1024.168] -- 0:00:52
212000 -- (-1028.220) (-1024.895) [-1025.326] (-1023.288) * (-1024.953) (-1026.418) (-1024.977) [-1024.679] -- 0:00:52
212500 -- [-1026.006] (-1024.596) (-1027.387) (-1027.013) * (-1026.446) (-1022.816) [-1026.051] (-1025.204) -- 0:00:51
213000 -- (-1024.073) (-1026.845) [-1024.138] (-1026.734) * (-1025.836) (-1023.429) (-1025.674) [-1024.676] -- 0:00:51
213500 -- (-1023.973) (-1026.778) [-1024.707] (-1027.686) * [-1025.397] (-1023.742) (-1025.421) (-1023.001) -- 0:00:51
214000 -- [-1026.092] (-1026.718) (-1026.754) (-1025.884) * [-1027.796] (-1028.013) (-1024.944) (-1026.332) -- 0:00:51
214500 -- (-1025.448) (-1025.222) [-1026.912] (-1030.442) * [-1023.571] (-1027.628) (-1027.853) (-1025.025) -- 0:00:51
215000 -- [-1025.908] (-1025.651) (-1024.308) (-1030.281) * [-1023.448] (-1027.995) (-1027.371) (-1025.235) -- 0:00:51
Average standard deviation of split frequencies: 0.015851
215500 -- (-1028.776) [-1025.634] (-1025.639) (-1025.539) * (-1024.247) (-1026.526) (-1026.177) [-1023.091] -- 0:00:50
216000 -- (-1026.125) (-1025.566) (-1026.891) [-1027.763] * (-1026.293) (-1024.109) [-1027.263] (-1022.870) -- 0:00:50
216500 -- [-1025.487] (-1025.424) (-1029.685) (-1031.948) * [-1023.514] (-1025.645) (-1027.818) (-1028.196) -- 0:00:50
217000 -- (-1029.155) (-1027.007) (-1026.139) [-1026.912] * (-1026.007) [-1022.949] (-1029.459) (-1023.537) -- 0:00:50
217500 -- (-1026.889) (-1027.209) [-1023.290] (-1026.354) * (-1024.402) [-1025.345] (-1024.021) (-1027.864) -- 0:00:50
218000 -- (-1026.186) (-1029.756) [-1025.358] (-1026.533) * (-1023.267) [-1026.675] (-1024.118) (-1025.069) -- 0:00:50
218500 -- (-1024.763) (-1026.320) [-1027.145] (-1030.700) * (-1023.227) (-1023.101) (-1023.693) [-1026.630] -- 0:00:50
219000 -- (-1023.518) [-1026.148] (-1025.067) (-1026.436) * (-1027.442) [-1023.518] (-1025.151) (-1026.123) -- 0:00:49
219500 -- (-1026.928) [-1024.953] (-1028.474) (-1029.307) * (-1024.760) (-1023.883) [-1024.608] (-1023.406) -- 0:00:49
220000 -- (-1025.351) (-1029.499) (-1026.438) [-1026.553] * (-1024.295) [-1024.805] (-1027.920) (-1027.358) -- 0:00:49
Average standard deviation of split frequencies: 0.015629
220500 -- (-1027.722) (-1030.728) (-1023.267) [-1023.653] * (-1023.838) (-1024.332) (-1031.445) [-1023.555] -- 0:00:49
221000 -- (-1022.345) (-1024.962) (-1023.534) [-1024.439] * (-1025.336) (-1026.094) [-1028.219] (-1024.810) -- 0:00:49
221500 -- (-1027.164) (-1025.461) [-1022.522] (-1024.286) * (-1026.662) (-1024.925) [-1029.219] (-1023.043) -- 0:00:49
222000 -- (-1024.820) [-1028.840] (-1025.830) (-1024.624) * (-1025.304) (-1027.464) [-1028.179] (-1025.117) -- 0:00:52
222500 -- (-1027.198) (-1022.866) [-1025.723] (-1025.357) * [-1022.103] (-1024.964) (-1025.676) (-1023.553) -- 0:00:52
223000 -- (-1024.748) [-1024.183] (-1024.619) (-1024.755) * [-1022.929] (-1025.444) (-1026.439) (-1023.475) -- 0:00:52
223500 -- (-1025.953) (-1024.727) (-1023.672) [-1025.508] * (-1023.823) (-1025.053) [-1027.838] (-1025.476) -- 0:00:52
224000 -- (-1021.590) [-1025.456] (-1022.966) (-1024.599) * [-1022.293] (-1023.533) (-1024.367) (-1023.780) -- 0:00:51
224500 -- (-1024.292) (-1021.913) (-1029.002) [-1024.759] * (-1026.219) (-1025.447) [-1026.384] (-1025.369) -- 0:00:51
225000 -- (-1025.579) (-1024.069) (-1027.596) [-1023.464] * (-1028.305) (-1023.299) [-1022.511] (-1026.260) -- 0:00:51
Average standard deviation of split frequencies: 0.015435
225500 -- (-1024.337) (-1027.388) (-1027.479) [-1025.030] * [-1025.931] (-1027.020) (-1024.396) (-1023.680) -- 0:00:51
226000 -- (-1025.517) (-1024.594) [-1025.821] (-1024.424) * (-1024.001) [-1026.157] (-1030.703) (-1022.591) -- 0:00:51
226500 -- (-1025.692) (-1022.723) [-1026.508] (-1026.218) * (-1026.312) (-1028.708) [-1030.187] (-1024.373) -- 0:00:51
227000 -- [-1025.859] (-1025.010) (-1025.625) (-1024.712) * (-1024.137) (-1025.838) (-1024.857) [-1024.059] -- 0:00:51
227500 -- [-1023.980] (-1026.019) (-1027.353) (-1025.786) * (-1026.571) (-1026.018) (-1025.245) [-1024.527] -- 0:00:50
228000 -- (-1024.337) [-1025.180] (-1025.629) (-1025.430) * (-1030.110) [-1025.094] (-1023.160) (-1022.962) -- 0:00:50
228500 -- [-1026.511] (-1024.134) (-1026.946) (-1031.068) * (-1027.060) (-1025.909) [-1023.295] (-1024.197) -- 0:00:50
229000 -- (-1026.216) [-1023.350] (-1027.045) (-1025.254) * [-1028.135] (-1026.610) (-1024.610) (-1026.879) -- 0:00:50
229500 -- (-1025.028) (-1025.052) (-1027.097) [-1026.662] * (-1023.239) [-1026.503] (-1025.692) (-1023.873) -- 0:00:50
230000 -- (-1026.449) [-1026.033] (-1023.801) (-1025.287) * (-1024.022) [-1024.497] (-1026.162) (-1026.625) -- 0:00:50
Average standard deviation of split frequencies: 0.016463
230500 -- (-1024.081) (-1023.333) [-1025.006] (-1024.615) * (-1026.628) (-1025.650) (-1024.384) [-1025.683] -- 0:00:50
231000 -- (-1023.644) [-1025.458] (-1031.662) (-1026.749) * (-1024.225) [-1025.048] (-1025.592) (-1030.037) -- 0:00:49
231500 -- (-1025.417) (-1025.710) (-1031.192) [-1028.146] * (-1025.423) [-1025.819] (-1026.419) (-1035.125) -- 0:00:49
232000 -- (-1024.350) (-1027.633) (-1024.281) [-1023.606] * [-1025.473] (-1026.516) (-1024.534) (-1026.714) -- 0:00:49
232500 -- [-1025.377] (-1026.421) (-1024.176) (-1023.502) * [-1025.318] (-1026.317) (-1029.445) (-1023.542) -- 0:00:49
233000 -- (-1022.713) (-1025.510) (-1023.623) [-1027.183] * (-1024.935) [-1024.000] (-1026.911) (-1022.588) -- 0:00:49
233500 -- (-1022.803) (-1027.627) (-1025.359) [-1025.038] * (-1024.175) [-1021.999] (-1026.424) (-1023.627) -- 0:00:49
234000 -- (-1027.597) (-1024.218) [-1024.217] (-1025.007) * (-1025.083) (-1024.989) [-1026.282] (-1025.263) -- 0:00:49
234500 -- (-1023.090) (-1028.092) (-1024.254) [-1024.520] * [-1024.707] (-1025.739) (-1025.212) (-1025.647) -- 0:00:48
235000 -- (-1023.030) (-1025.893) (-1028.494) [-1030.798] * [-1023.040] (-1028.484) (-1025.096) (-1026.971) -- 0:00:48
Average standard deviation of split frequencies: 0.017278
235500 -- (-1025.271) (-1026.872) (-1022.748) [-1025.068] * [-1026.250] (-1026.699) (-1024.761) (-1029.840) -- 0:00:48
236000 -- [-1028.481] (-1024.557) (-1023.463) (-1024.143) * (-1023.754) (-1027.220) (-1024.920) [-1023.708] -- 0:00:48
236500 -- (-1026.211) (-1026.141) (-1025.852) [-1023.850] * [-1022.757] (-1026.308) (-1025.603) (-1025.734) -- 0:00:48
237000 -- (-1025.608) [-1026.314] (-1023.565) (-1024.980) * (-1026.922) [-1025.770] (-1025.509) (-1023.909) -- 0:00:51
237500 -- (-1024.325) (-1027.134) [-1027.347] (-1032.193) * [-1021.622] (-1025.087) (-1023.464) (-1026.394) -- 0:00:51
238000 -- (-1023.689) (-1025.229) [-1026.014] (-1025.023) * (-1025.575) (-1025.208) (-1030.990) [-1029.333] -- 0:00:51
238500 -- (-1022.734) [-1026.169] (-1027.030) (-1026.223) * (-1025.042) (-1025.096) (-1024.036) [-1031.328] -- 0:00:51
239000 -- [-1022.735] (-1030.265) (-1025.209) (-1025.221) * (-1024.891) [-1025.061] (-1027.086) (-1027.136) -- 0:00:50
239500 -- (-1024.189) (-1024.900) [-1024.966] (-1024.845) * [-1023.636] (-1025.874) (-1030.120) (-1026.424) -- 0:00:50
240000 -- (-1023.299) [-1023.414] (-1024.373) (-1025.294) * [-1024.357] (-1026.328) (-1024.065) (-1027.316) -- 0:00:50
Average standard deviation of split frequencies: 0.017433
240500 -- [-1025.741] (-1025.757) (-1026.921) (-1025.891) * [-1025.859] (-1028.797) (-1024.116) (-1025.722) -- 0:00:50
241000 -- [-1024.070] (-1025.898) (-1027.256) (-1025.691) * (-1025.026) (-1025.213) [-1025.673] (-1024.705) -- 0:00:50
241500 -- (-1024.930) (-1027.613) [-1026.341] (-1027.118) * (-1025.537) [-1022.571] (-1025.038) (-1024.189) -- 0:00:50
242000 -- [-1023.077] (-1026.326) (-1024.584) (-1024.262) * (-1027.944) (-1028.599) [-1024.069] (-1024.786) -- 0:00:50
242500 -- [-1025.289] (-1027.624) (-1025.856) (-1025.086) * [-1025.743] (-1022.892) (-1023.786) (-1026.064) -- 0:00:49
243000 -- [-1024.775] (-1028.579) (-1023.716) (-1024.932) * (-1028.621) (-1025.405) [-1026.421] (-1027.933) -- 0:00:49
243500 -- (-1025.888) [-1026.216] (-1025.700) (-1026.788) * (-1027.829) [-1025.771] (-1026.422) (-1025.827) -- 0:00:49
244000 -- (-1022.707) (-1025.162) [-1027.085] (-1026.771) * (-1025.384) (-1025.015) [-1026.636] (-1023.722) -- 0:00:49
244500 -- (-1026.910) [-1025.194] (-1025.279) (-1026.837) * (-1025.624) (-1023.989) (-1025.509) [-1024.022] -- 0:00:49
245000 -- (-1026.262) (-1023.482) [-1024.558] (-1025.940) * (-1025.430) [-1024.477] (-1026.326) (-1022.826) -- 0:00:49
Average standard deviation of split frequencies: 0.018013
245500 -- [-1024.226] (-1026.531) (-1024.982) (-1025.201) * (-1026.748) (-1026.359) (-1025.515) [-1024.387] -- 0:00:49
246000 -- (-1025.881) (-1025.049) (-1024.994) [-1024.808] * (-1030.669) (-1027.422) [-1026.139] (-1023.653) -- 0:00:49
246500 -- (-1026.254) (-1024.970) [-1023.905] (-1026.252) * (-1025.357) (-1025.482) (-1035.151) [-1022.958] -- 0:00:48
247000 -- (-1023.776) (-1026.163) [-1023.732] (-1026.851) * (-1023.868) [-1025.424] (-1023.873) (-1022.688) -- 0:00:48
247500 -- (-1023.086) (-1031.284) [-1022.052] (-1025.645) * [-1023.930] (-1029.557) (-1029.286) (-1024.782) -- 0:00:48
248000 -- [-1023.307] (-1025.890) (-1028.682) (-1027.573) * (-1025.598) (-1026.424) [-1025.613] (-1023.819) -- 0:00:48
248500 -- (-1024.893) [-1025.325] (-1027.459) (-1023.419) * (-1024.844) [-1023.106] (-1026.845) (-1023.334) -- 0:00:48
249000 -- [-1022.899] (-1023.382) (-1023.945) (-1028.864) * (-1027.394) (-1024.997) [-1026.173] (-1023.916) -- 0:00:48
249500 -- (-1023.747) [-1022.673] (-1028.136) (-1024.786) * (-1025.813) (-1024.669) (-1027.198) [-1024.671] -- 0:00:48
250000 -- (-1023.468) (-1024.566) [-1023.447] (-1030.873) * (-1030.357) (-1024.684) (-1025.226) [-1026.830] -- 0:00:48
Average standard deviation of split frequencies: 0.016716
250500 -- (-1024.406) (-1026.018) [-1024.304] (-1031.447) * (-1025.814) (-1025.063) [-1025.521] (-1026.353) -- 0:00:47
251000 -- (-1025.778) [-1024.709] (-1026.303) (-1024.073) * (-1025.517) (-1027.302) [-1023.921] (-1023.373) -- 0:00:47
251500 -- [-1026.454] (-1025.535) (-1025.494) (-1025.573) * (-1024.172) (-1026.976) [-1022.509] (-1025.749) -- 0:00:47
252000 -- (-1028.628) (-1029.716) (-1023.238) [-1024.891] * [-1025.376] (-1025.383) (-1029.360) (-1027.553) -- 0:00:50
252500 -- (-1028.324) [-1034.076] (-1023.438) (-1026.783) * (-1024.437) [-1023.921] (-1026.275) (-1022.204) -- 0:00:50
253000 -- (-1023.044) [-1027.493] (-1029.539) (-1025.067) * (-1025.177) (-1025.621) (-1026.210) [-1023.218] -- 0:00:50
253500 -- (-1026.818) [-1025.263] (-1023.198) (-1024.432) * [-1026.615] (-1024.978) (-1025.134) (-1026.032) -- 0:00:50
254000 -- (-1023.225) (-1027.665) (-1024.991) [-1023.552] * (-1026.334) (-1025.505) [-1024.269] (-1023.402) -- 0:00:49
254500 -- (-1026.028) [-1023.647] (-1024.294) (-1025.511) * (-1025.698) [-1028.080] (-1024.337) (-1026.172) -- 0:00:49
255000 -- (-1023.621) [-1024.265] (-1029.741) (-1024.540) * (-1024.991) (-1025.653) (-1027.047) [-1028.247] -- 0:00:49
Average standard deviation of split frequencies: 0.017084
255500 -- (-1022.784) (-1023.052) (-1029.061) [-1022.981] * (-1024.453) (-1023.917) (-1029.582) [-1024.257] -- 0:00:49
256000 -- [-1025.888] (-1024.025) (-1024.781) (-1024.874) * (-1024.207) (-1023.032) [-1025.015] (-1024.341) -- 0:00:49
256500 -- (-1032.808) (-1026.106) [-1027.314] (-1023.323) * [-1022.009] (-1027.042) (-1030.952) (-1024.434) -- 0:00:49
257000 -- (-1027.110) (-1030.400) (-1024.836) [-1023.367] * (-1024.016) [-1025.744] (-1025.808) (-1026.473) -- 0:00:49
257500 -- [-1023.666] (-1027.204) (-1024.630) (-1024.528) * (-1026.063) [-1025.752] (-1028.277) (-1023.296) -- 0:00:49
258000 -- [-1022.853] (-1027.771) (-1026.825) (-1024.028) * (-1023.425) (-1031.154) (-1025.311) [-1025.239] -- 0:00:48
258500 -- [-1026.066] (-1025.942) (-1026.070) (-1025.787) * (-1028.965) (-1027.842) (-1027.368) [-1023.327] -- 0:00:48
259000 -- (-1024.122) (-1029.435) (-1027.424) [-1025.692] * [-1026.389] (-1023.821) (-1023.405) (-1024.281) -- 0:00:48
259500 -- (-1023.495) (-1024.702) (-1026.253) [-1026.082] * [-1026.042] (-1024.864) (-1025.859) (-1026.314) -- 0:00:48
260000 -- (-1024.474) [-1027.290] (-1024.588) (-1028.647) * (-1028.943) [-1022.971] (-1024.076) (-1025.712) -- 0:00:48
Average standard deviation of split frequencies: 0.014563
260500 -- (-1024.203) (-1027.319) (-1025.052) [-1025.421] * [-1026.360] (-1025.013) (-1024.549) (-1023.467) -- 0:00:48
261000 -- [-1022.442] (-1025.658) (-1028.014) (-1023.397) * (-1027.307) (-1023.272) [-1025.507] (-1025.067) -- 0:00:48
261500 -- [-1025.139] (-1025.668) (-1025.589) (-1025.761) * (-1024.044) [-1024.423] (-1025.211) (-1025.670) -- 0:00:48
262000 -- [-1022.680] (-1024.740) (-1023.716) (-1025.367) * [-1021.987] (-1023.875) (-1029.161) (-1028.205) -- 0:00:47
262500 -- (-1021.960) (-1027.610) [-1023.962] (-1025.149) * (-1023.924) (-1025.015) (-1030.871) [-1023.168] -- 0:00:47
263000 -- (-1025.162) (-1023.874) (-1029.634) [-1024.144] * [-1023.104] (-1024.553) (-1027.955) (-1022.984) -- 0:00:47
263500 -- (-1024.246) (-1024.226) (-1027.567) [-1029.261] * (-1024.719) [-1025.496] (-1026.121) (-1024.587) -- 0:00:47
264000 -- (-1025.196) [-1026.546] (-1027.692) (-1029.156) * (-1032.778) [-1024.737] (-1025.816) (-1025.046) -- 0:00:47
264500 -- (-1027.067) (-1026.672) [-1024.216] (-1029.170) * [-1023.821] (-1024.377) (-1024.393) (-1025.673) -- 0:00:47
265000 -- (-1023.137) (-1026.295) (-1023.656) [-1029.437] * [-1026.983] (-1024.479) (-1025.021) (-1025.102) -- 0:00:47
Average standard deviation of split frequencies: 0.015763
265500 -- (-1024.541) [-1023.769] (-1023.637) (-1025.331) * (-1028.204) (-1026.391) [-1026.603] (-1026.617) -- 0:00:47
266000 -- (-1025.530) (-1026.188) (-1025.957) [-1024.357] * (-1025.689) (-1030.225) (-1025.712) [-1026.060] -- 0:00:46
266500 -- (-1023.988) [-1026.176] (-1027.535) (-1024.229) * [-1024.102] (-1026.182) (-1030.130) (-1027.994) -- 0:00:46
267000 -- [-1022.407] (-1025.377) (-1026.185) (-1027.242) * [-1028.365] (-1023.537) (-1029.000) (-1028.892) -- 0:00:46
267500 -- (-1023.308) (-1026.910) (-1027.512) [-1026.199] * (-1027.241) [-1022.304] (-1025.924) (-1026.545) -- 0:00:49
268000 -- (-1028.552) (-1026.309) (-1025.232) [-1024.287] * (-1026.333) (-1021.939) (-1024.821) [-1025.861] -- 0:00:49
268500 -- [-1023.351] (-1027.570) (-1025.417) (-1025.065) * (-1024.789) [-1023.040] (-1022.815) (-1023.488) -- 0:00:49
269000 -- (-1024.276) (-1024.502) [-1026.270] (-1025.963) * (-1024.330) [-1022.839] (-1031.736) (-1023.551) -- 0:00:48
269500 -- (-1025.233) (-1027.310) [-1022.070] (-1027.490) * (-1024.372) [-1023.821] (-1026.600) (-1024.532) -- 0:00:48
270000 -- (-1028.183) (-1022.365) (-1023.284) [-1024.155] * (-1025.673) [-1022.103] (-1024.425) (-1027.072) -- 0:00:48
Average standard deviation of split frequencies: 0.016866
270500 -- [-1025.654] (-1023.474) (-1024.702) (-1024.564) * (-1026.380) (-1028.568) (-1028.221) [-1023.626] -- 0:00:48
271000 -- [-1025.112] (-1024.675) (-1024.711) (-1028.039) * (-1027.480) (-1024.938) (-1023.941) [-1024.920] -- 0:00:48
271500 -- (-1023.216) (-1028.860) (-1022.999) [-1026.509] * (-1026.293) (-1026.323) (-1026.604) [-1024.868] -- 0:00:48
272000 -- [-1024.630] (-1028.520) (-1023.849) (-1025.611) * (-1028.033) (-1026.255) (-1022.583) [-1024.928] -- 0:00:48
272500 -- [-1029.150] (-1025.873) (-1033.288) (-1026.015) * (-1023.855) (-1025.029) (-1025.255) [-1026.496] -- 0:00:48
273000 -- (-1023.915) [-1024.315] (-1031.237) (-1024.902) * (-1025.012) [-1026.046] (-1025.231) (-1027.500) -- 0:00:47
273500 -- (-1024.437) (-1026.702) [-1024.216] (-1025.836) * [-1024.443] (-1027.459) (-1027.231) (-1026.815) -- 0:00:47
274000 -- [-1022.973] (-1023.233) (-1027.089) (-1024.599) * (-1025.948) (-1027.311) (-1026.715) [-1026.902] -- 0:00:47
274500 -- (-1022.872) (-1023.471) [-1026.462] (-1028.628) * (-1023.360) (-1026.736) (-1025.098) [-1027.097] -- 0:00:47
275000 -- [-1023.583] (-1028.648) (-1022.898) (-1025.465) * (-1025.465) (-1024.880) (-1025.713) [-1024.246] -- 0:00:47
Average standard deviation of split frequencies: 0.017744
275500 -- (-1023.056) (-1022.854) (-1026.664) [-1025.991] * [-1027.094] (-1027.468) (-1026.199) (-1025.824) -- 0:00:47
276000 -- [-1023.199] (-1025.080) (-1026.460) (-1026.715) * (-1025.388) (-1027.471) (-1023.891) [-1027.411] -- 0:00:47
276500 -- (-1025.428) (-1022.969) (-1023.740) [-1026.928] * (-1025.374) (-1023.946) (-1025.846) [-1025.901] -- 0:00:47
277000 -- (-1024.375) (-1024.716) (-1024.642) [-1026.333] * (-1022.387) (-1024.816) (-1023.799) [-1025.047] -- 0:00:46
277500 -- (-1024.944) [-1025.604] (-1024.306) (-1027.420) * (-1023.744) [-1022.362] (-1024.306) (-1025.643) -- 0:00:46
278000 -- (-1022.556) [-1024.926] (-1024.844) (-1029.311) * (-1024.372) [-1022.785] (-1024.315) (-1024.981) -- 0:00:46
278500 -- [-1023.399] (-1021.969) (-1024.175) (-1029.975) * [-1024.701] (-1023.951) (-1025.666) (-1027.205) -- 0:00:46
279000 -- (-1024.424) [-1023.049] (-1024.501) (-1025.392) * (-1024.051) (-1023.473) [-1023.362] (-1026.524) -- 0:00:46
279500 -- (-1025.608) (-1025.819) [-1024.545] (-1025.362) * (-1033.453) (-1024.075) [-1024.245] (-1027.025) -- 0:00:46
280000 -- (-1025.086) (-1024.325) (-1024.003) [-1024.190] * (-1029.612) (-1024.789) [-1026.790] (-1026.505) -- 0:00:46
Average standard deviation of split frequencies: 0.016442
280500 -- (-1025.049) (-1027.660) [-1023.456] (-1025.618) * (-1025.276) (-1026.878) (-1024.112) [-1026.800] -- 0:00:46
281000 -- [-1024.604] (-1025.105) (-1024.985) (-1030.766) * [-1023.195] (-1027.558) (-1025.685) (-1024.224) -- 0:00:46
281500 -- (-1023.506) [-1023.136] (-1027.984) (-1025.438) * (-1025.477) (-1027.011) (-1026.430) [-1025.532] -- 0:00:45
282000 -- (-1022.889) (-1025.656) [-1028.598] (-1029.025) * (-1028.640) (-1024.661) [-1025.116] (-1026.643) -- 0:00:45
282500 -- [-1026.601] (-1027.430) (-1027.901) (-1024.932) * (-1025.068) (-1025.622) (-1025.278) [-1025.864] -- 0:00:48
283000 -- (-1024.476) (-1023.496) [-1024.677] (-1025.258) * (-1024.202) [-1024.157] (-1024.480) (-1026.952) -- 0:00:48
283500 -- [-1024.045] (-1028.269) (-1027.213) (-1024.828) * (-1030.097) (-1024.460) [-1026.363] (-1024.881) -- 0:00:48
284000 -- (-1026.289) [-1026.554] (-1027.204) (-1023.390) * (-1023.697) [-1023.340] (-1024.793) (-1024.899) -- 0:00:47
284500 -- (-1022.660) (-1025.033) [-1027.049] (-1023.979) * [-1023.054] (-1024.014) (-1030.122) (-1024.798) -- 0:00:47
285000 -- (-1023.402) [-1025.139] (-1025.293) (-1026.538) * (-1028.262) [-1022.598] (-1026.081) (-1026.980) -- 0:00:47
Average standard deviation of split frequencies: 0.016396
285500 -- (-1025.574) [-1025.576] (-1028.126) (-1026.197) * (-1026.853) (-1024.122) [-1025.016] (-1024.414) -- 0:00:47
286000 -- (-1027.350) (-1031.720) [-1022.411] (-1024.260) * (-1029.349) [-1026.007] (-1024.519) (-1024.191) -- 0:00:47
286500 -- (-1025.771) (-1025.168) (-1025.411) [-1025.160] * (-1027.217) (-1026.487) (-1025.083) [-1026.194] -- 0:00:47
287000 -- [-1024.288] (-1026.046) (-1024.160) (-1027.093) * [-1024.479] (-1023.249) (-1025.984) (-1024.993) -- 0:00:47
287500 -- (-1023.653) (-1025.624) (-1022.990) [-1023.658] * (-1024.472) [-1025.139] (-1027.317) (-1023.950) -- 0:00:47
288000 -- (-1023.088) (-1027.319) [-1026.298] (-1025.478) * (-1025.102) (-1025.374) (-1025.309) [-1026.857] -- 0:00:46
288500 -- [-1022.731] (-1025.803) (-1027.076) (-1027.403) * (-1026.250) (-1022.931) (-1025.974) [-1024.673] -- 0:00:46
289000 -- (-1024.993) [-1024.208] (-1024.882) (-1028.787) * (-1022.347) (-1027.851) (-1027.080) [-1024.911] -- 0:00:46
289500 -- (-1022.501) (-1024.659) [-1025.527] (-1027.129) * (-1025.460) (-1026.539) [-1028.268] (-1027.956) -- 0:00:46
290000 -- [-1023.041] (-1028.521) (-1024.265) (-1029.252) * (-1024.901) (-1026.319) [-1026.778] (-1022.261) -- 0:00:46
Average standard deviation of split frequencies: 0.015877
290500 -- [-1024.347] (-1023.280) (-1028.525) (-1024.446) * [-1023.930] (-1028.407) (-1026.920) (-1024.445) -- 0:00:46
291000 -- [-1026.788] (-1024.896) (-1025.747) (-1025.011) * [-1023.558] (-1025.968) (-1027.942) (-1022.683) -- 0:00:46
291500 -- (-1027.682) (-1022.507) (-1026.228) [-1023.394] * [-1023.140] (-1026.370) (-1025.812) (-1024.799) -- 0:00:46
292000 -- (-1023.779) (-1024.348) (-1024.581) [-1024.713] * (-1029.772) (-1025.105) (-1027.411) [-1029.288] -- 0:00:46
292500 -- (-1023.080) [-1024.204] (-1027.501) (-1023.869) * (-1026.710) (-1024.201) [-1025.799] (-1031.279) -- 0:00:45
293000 -- (-1025.871) (-1025.350) (-1025.637) [-1025.155] * (-1023.210) (-1026.906) [-1026.752] (-1023.638) -- 0:00:45
293500 -- (-1027.036) (-1028.300) [-1028.991] (-1026.525) * (-1024.962) (-1024.114) (-1026.040) [-1023.176] -- 0:00:45
294000 -- [-1028.998] (-1025.224) (-1024.764) (-1025.109) * (-1028.096) (-1022.640) [-1024.990] (-1024.249) -- 0:00:45
294500 -- (-1026.025) (-1028.270) (-1024.113) [-1026.673] * (-1025.352) [-1023.190] (-1026.274) (-1024.299) -- 0:00:45
295000 -- (-1026.455) (-1027.243) [-1024.357] (-1024.897) * [-1028.586] (-1027.046) (-1025.950) (-1025.791) -- 0:00:45
Average standard deviation of split frequencies: 0.016177
295500 -- (-1025.443) [-1025.275] (-1024.384) (-1022.649) * (-1025.593) (-1029.744) (-1023.814) [-1029.111] -- 0:00:45
296000 -- (-1023.623) [-1023.611] (-1026.524) (-1027.608) * (-1026.599) [-1028.553] (-1026.891) (-1024.905) -- 0:00:45
296500 -- [-1025.525] (-1025.715) (-1029.231) (-1026.118) * (-1025.903) (-1029.746) (-1024.813) [-1025.328] -- 0:00:45
297000 -- [-1025.291] (-1025.784) (-1025.778) (-1029.551) * (-1023.754) (-1029.793) (-1030.430) [-1026.506] -- 0:00:44
297500 -- (-1025.949) (-1025.823) [-1024.567] (-1028.067) * [-1024.510] (-1024.881) (-1026.287) (-1026.878) -- 0:00:44
298000 -- (-1028.548) (-1023.939) [-1025.744] (-1023.736) * (-1025.522) [-1024.203] (-1024.329) (-1028.066) -- 0:00:47
298500 -- (-1026.178) [-1024.374] (-1023.137) (-1024.237) * [-1024.139] (-1024.279) (-1025.335) (-1032.351) -- 0:00:47
299000 -- (-1025.408) (-1023.473) (-1025.449) [-1023.946] * (-1026.736) [-1027.730] (-1024.557) (-1027.081) -- 0:00:46
299500 -- (-1027.540) (-1025.215) [-1028.221] (-1024.623) * (-1025.739) [-1024.203] (-1023.368) (-1027.823) -- 0:00:46
300000 -- (-1024.576) [-1022.335] (-1026.730) (-1025.656) * [-1026.714] (-1025.187) (-1023.273) (-1023.582) -- 0:00:46
Average standard deviation of split frequencies: 0.015018
300500 -- (-1024.983) [-1025.631] (-1024.249) (-1025.884) * (-1026.551) [-1024.895] (-1026.348) (-1026.460) -- 0:00:46
301000 -- (-1024.669) (-1028.863) (-1023.034) [-1026.672] * (-1028.580) (-1028.032) [-1024.649] (-1023.918) -- 0:00:46
301500 -- (-1027.263) (-1027.654) (-1026.341) [-1027.917] * (-1026.277) (-1027.178) [-1027.677] (-1025.391) -- 0:00:46
302000 -- (-1027.866) [-1026.146] (-1024.649) (-1024.459) * (-1026.625) (-1024.896) (-1028.431) [-1029.992] -- 0:00:46
302500 -- (-1024.721) (-1024.065) [-1026.827] (-1025.470) * [-1028.793] (-1025.103) (-1027.672) (-1032.092) -- 0:00:46
303000 -- (-1024.630) (-1027.399) (-1027.325) [-1024.302] * (-1023.958) (-1025.396) [-1023.108] (-1023.766) -- 0:00:46
303500 -- (-1024.604) (-1024.809) [-1026.860] (-1022.521) * (-1028.086) (-1023.791) (-1025.744) [-1026.028] -- 0:00:45
304000 -- (-1024.448) (-1023.527) (-1024.597) [-1024.599] * (-1029.636) (-1025.990) [-1027.986] (-1029.208) -- 0:00:45
304500 -- (-1022.807) [-1022.929] (-1028.763) (-1022.934) * (-1028.519) (-1027.941) (-1025.406) [-1024.861] -- 0:00:45
305000 -- (-1024.965) [-1028.278] (-1025.480) (-1025.934) * (-1025.841) (-1027.401) [-1024.581] (-1026.616) -- 0:00:45
Average standard deviation of split frequencies: 0.014757
305500 -- (-1023.710) (-1023.722) [-1027.651] (-1024.855) * (-1025.985) (-1023.983) (-1024.549) [-1026.582] -- 0:00:45
306000 -- (-1023.223) [-1024.636] (-1028.242) (-1024.861) * (-1024.395) (-1028.620) [-1027.840] (-1025.011) -- 0:00:45
306500 -- [-1024.798] (-1034.381) (-1024.346) (-1027.013) * (-1024.559) (-1026.917) [-1024.219] (-1025.341) -- 0:00:45
307000 -- (-1025.439) (-1025.853) (-1025.286) [-1023.470] * (-1023.540) (-1022.847) [-1022.719] (-1025.764) -- 0:00:45
307500 -- [-1024.522] (-1025.287) (-1025.096) (-1025.434) * (-1027.814) [-1025.682] (-1028.616) (-1024.550) -- 0:00:45
308000 -- (-1024.677) [-1026.321] (-1025.667) (-1025.072) * (-1024.120) (-1027.368) (-1027.232) [-1023.848] -- 0:00:44
308500 -- (-1024.805) (-1026.431) [-1027.266] (-1025.342) * (-1026.127) (-1023.615) [-1026.622] (-1031.300) -- 0:00:44
309000 -- (-1024.592) (-1025.960) [-1027.854] (-1025.112) * (-1026.784) (-1023.104) (-1026.328) [-1022.850] -- 0:00:44
309500 -- (-1029.283) [-1027.995] (-1026.484) (-1024.195) * (-1023.151) [-1024.126] (-1023.668) (-1026.711) -- 0:00:44
310000 -- (-1025.282) (-1028.899) (-1030.311) [-1025.006] * [-1022.595] (-1027.728) (-1024.194) (-1028.152) -- 0:00:44
Average standard deviation of split frequencies: 0.015174
310500 -- (-1023.005) (-1026.866) (-1028.115) [-1024.595] * (-1024.188) [-1024.450] (-1025.260) (-1027.645) -- 0:00:44
311000 -- (-1023.637) (-1027.762) [-1025.457] (-1024.856) * (-1021.533) (-1024.053) (-1025.236) [-1026.337] -- 0:00:44
311500 -- (-1024.359) (-1026.675) (-1026.451) [-1025.578] * (-1024.908) [-1024.264] (-1026.650) (-1026.399) -- 0:00:44
312000 -- (-1023.433) (-1025.663) [-1024.200] (-1024.144) * (-1025.638) (-1026.447) [-1024.783] (-1026.275) -- 0:00:44
312500 -- (-1025.659) [-1025.251] (-1024.970) (-1022.792) * [-1023.472] (-1028.175) (-1026.229) (-1026.535) -- 0:00:44
313000 -- (-1025.826) (-1023.523) [-1026.954] (-1025.959) * (-1026.678) (-1024.659) (-1026.606) [-1023.677] -- 0:00:46
313500 -- (-1022.670) (-1028.532) [-1022.492] (-1029.417) * (-1021.497) [-1024.275] (-1026.870) (-1023.646) -- 0:00:45
314000 -- (-1024.739) [-1024.308] (-1025.717) (-1024.702) * (-1023.469) (-1024.669) (-1026.940) [-1022.919] -- 0:00:45
314500 -- [-1025.739] (-1025.762) (-1029.694) (-1026.806) * (-1027.035) (-1023.316) [-1024.449] (-1024.965) -- 0:00:45
315000 -- (-1025.609) [-1024.505] (-1025.232) (-1025.139) * (-1024.555) [-1023.501] (-1029.335) (-1026.275) -- 0:00:45
Average standard deviation of split frequencies: 0.016410
315500 -- [-1024.076] (-1029.015) (-1023.406) (-1026.370) * (-1026.644) (-1027.552) [-1023.844] (-1027.620) -- 0:00:45
316000 -- (-1023.916) [-1021.932] (-1025.063) (-1030.162) * (-1024.641) [-1025.437] (-1026.690) (-1023.826) -- 0:00:45
316500 -- [-1025.827] (-1023.664) (-1022.386) (-1025.716) * [-1029.742] (-1023.981) (-1026.521) (-1025.962) -- 0:00:45
317000 -- (-1027.103) (-1028.010) (-1024.152) [-1025.722] * (-1024.474) (-1024.175) (-1024.286) [-1025.816] -- 0:00:45
317500 -- (-1027.253) (-1025.371) (-1026.386) [-1023.586] * (-1023.386) (-1027.629) (-1025.218) [-1025.102] -- 0:00:45
318000 -- (-1026.046) [-1024.289] (-1026.550) (-1025.588) * (-1029.571) (-1024.956) [-1027.749] (-1025.509) -- 0:00:45
318500 -- (-1029.869) [-1025.357] (-1026.439) (-1026.731) * (-1022.706) (-1028.029) (-1028.060) [-1028.480] -- 0:00:44
319000 -- [-1025.572] (-1026.226) (-1023.179) (-1030.338) * (-1022.513) [-1029.954] (-1029.236) (-1026.195) -- 0:00:44
319500 -- (-1025.020) [-1024.762] (-1024.399) (-1028.348) * [-1022.610] (-1024.820) (-1027.872) (-1025.990) -- 0:00:44
320000 -- (-1026.823) [-1024.871] (-1022.896) (-1025.987) * [-1024.727] (-1026.431) (-1026.282) (-1027.040) -- 0:00:44
Average standard deviation of split frequencies: 0.016253
320500 -- [-1024.289] (-1028.308) (-1024.346) (-1025.820) * [-1025.693] (-1027.691) (-1024.946) (-1024.368) -- 0:00:44
321000 -- [-1021.537] (-1025.804) (-1025.811) (-1025.484) * [-1022.526] (-1024.087) (-1024.236) (-1024.442) -- 0:00:44
321500 -- (-1021.312) (-1033.012) [-1024.011] (-1025.277) * (-1026.258) [-1023.641] (-1026.692) (-1023.917) -- 0:00:44
322000 -- (-1024.583) (-1032.731) [-1023.690] (-1026.012) * (-1025.275) (-1029.072) [-1025.777] (-1024.331) -- 0:00:44
322500 -- [-1034.823] (-1030.995) (-1025.291) (-1025.846) * [-1026.966] (-1031.879) (-1027.042) (-1023.765) -- 0:00:44
323000 -- (-1024.035) (-1025.806) [-1024.191] (-1025.911) * [-1022.201] (-1025.434) (-1025.689) (-1027.487) -- 0:00:44
323500 -- (-1026.829) (-1026.255) [-1023.892] (-1027.763) * (-1025.894) (-1025.419) [-1027.182] (-1023.980) -- 0:00:43
324000 -- (-1025.595) (-1026.685) [-1023.488] (-1025.327) * (-1024.614) (-1023.308) (-1025.273) [-1024.348] -- 0:00:43
324500 -- (-1024.605) [-1028.858] (-1023.842) (-1025.848) * (-1024.933) (-1023.460) [-1024.863] (-1022.805) -- 0:00:43
325000 -- (-1029.247) [-1025.085] (-1024.907) (-1025.758) * (-1024.128) (-1028.303) (-1026.288) [-1024.585] -- 0:00:43
Average standard deviation of split frequencies: 0.015183
325500 -- (-1022.790) [-1027.863] (-1023.122) (-1027.890) * [-1025.702] (-1024.601) (-1024.946) (-1026.373) -- 0:00:43
326000 -- (-1031.027) (-1025.595) (-1025.891) [-1023.299] * (-1030.270) (-1027.060) [-1023.775] (-1027.512) -- 0:00:43
326500 -- (-1025.784) (-1025.214) [-1025.408] (-1024.918) * (-1028.195) (-1027.294) (-1025.252) [-1025.157] -- 0:00:43
327000 -- (-1023.440) (-1024.928) [-1026.392] (-1030.192) * (-1025.609) (-1024.332) [-1026.648] (-1026.077) -- 0:00:43
327500 -- [-1025.658] (-1024.545) (-1025.898) (-1023.709) * (-1024.130) (-1025.049) [-1025.562] (-1026.200) -- 0:00:43
328000 -- [-1026.449] (-1031.873) (-1026.541) (-1025.156) * [-1023.168] (-1025.487) (-1024.491) (-1024.243) -- 0:00:45
328500 -- [-1027.134] (-1026.356) (-1026.018) (-1026.316) * (-1025.788) (-1028.501) [-1030.555] (-1027.260) -- 0:00:44
329000 -- (-1025.899) (-1026.082) [-1024.425] (-1027.593) * [-1024.136] (-1025.163) (-1024.433) (-1025.232) -- 0:00:44
329500 -- [-1025.673] (-1025.002) (-1025.364) (-1026.360) * [-1022.911] (-1026.469) (-1023.954) (-1024.823) -- 0:00:44
330000 -- (-1026.339) [-1025.126] (-1028.231) (-1025.092) * [-1022.946] (-1026.177) (-1024.121) (-1026.078) -- 0:00:44
Average standard deviation of split frequencies: 0.015307
330500 -- (-1023.234) [-1026.934] (-1025.278) (-1025.970) * (-1023.421) (-1023.944) [-1024.058] (-1024.539) -- 0:00:44
331000 -- (-1025.581) (-1028.209) [-1022.087] (-1024.934) * [-1023.233] (-1028.986) (-1023.701) (-1024.582) -- 0:00:44
331500 -- (-1026.461) (-1025.587) [-1023.838] (-1026.350) * [-1026.428] (-1027.253) (-1023.641) (-1025.960) -- 0:00:44
332000 -- (-1026.692) (-1024.761) (-1027.978) [-1025.294] * (-1023.716) [-1025.775] (-1024.200) (-1027.247) -- 0:00:44
332500 -- (-1029.611) (-1024.355) (-1026.825) [-1023.043] * (-1023.298) (-1024.664) [-1026.581] (-1026.752) -- 0:00:44
333000 -- (-1025.206) [-1024.520] (-1024.402) (-1023.565) * [-1022.238] (-1026.165) (-1026.573) (-1024.962) -- 0:00:44
333500 -- [-1025.194] (-1025.996) (-1024.621) (-1026.540) * [-1024.325] (-1027.666) (-1030.306) (-1025.577) -- 0:00:43
334000 -- [-1023.550] (-1027.852) (-1024.684) (-1024.122) * [-1024.951] (-1027.128) (-1030.258) (-1026.010) -- 0:00:43
334500 -- [-1024.478] (-1026.078) (-1025.544) (-1025.721) * (-1027.027) (-1027.193) (-1027.951) [-1025.303] -- 0:00:43
335000 -- [-1023.447] (-1025.871) (-1024.754) (-1026.031) * (-1026.356) (-1026.555) (-1026.377) [-1025.357] -- 0:00:43
Average standard deviation of split frequencies: 0.014768
335500 -- (-1024.835) [-1026.742] (-1021.987) (-1027.748) * [-1025.596] (-1023.971) (-1026.263) (-1028.024) -- 0:00:43
336000 -- [-1025.192] (-1026.631) (-1023.611) (-1027.312) * (-1026.088) (-1024.804) [-1025.859] (-1027.199) -- 0:00:43
336500 -- (-1025.371) (-1027.952) [-1023.634] (-1025.420) * [-1023.784] (-1026.629) (-1034.823) (-1025.473) -- 0:00:43
337000 -- [-1026.888] (-1025.819) (-1027.683) (-1029.142) * [-1022.507] (-1027.547) (-1026.249) (-1029.616) -- 0:00:43
337500 -- [-1023.097] (-1023.875) (-1027.332) (-1029.812) * (-1023.914) (-1024.937) (-1022.237) [-1025.032] -- 0:00:43
338000 -- (-1026.461) (-1024.340) [-1023.308] (-1029.087) * (-1024.613) [-1025.105] (-1025.263) (-1029.495) -- 0:00:43
338500 -- (-1027.757) (-1025.285) (-1026.253) [-1028.115] * [-1024.919] (-1025.699) (-1027.261) (-1025.525) -- 0:00:42
339000 -- (-1025.658) (-1025.224) [-1025.059] (-1025.721) * (-1025.895) (-1026.105) (-1025.545) [-1023.596] -- 0:00:42
339500 -- (-1023.426) [-1023.091] (-1028.722) (-1024.820) * (-1023.657) (-1028.820) [-1024.337] (-1024.950) -- 0:00:42
340000 -- (-1027.586) (-1026.833) (-1025.400) [-1024.983] * (-1023.773) (-1025.234) (-1024.011) [-1025.741] -- 0:00:42
Average standard deviation of split frequencies: 0.014857
340500 -- (-1026.318) (-1025.180) [-1024.308] (-1026.492) * (-1024.008) (-1025.252) (-1025.552) [-1025.211] -- 0:00:42
341000 -- (-1026.807) (-1026.098) (-1024.172) [-1025.939] * (-1027.460) [-1026.716] (-1026.300) (-1024.543) -- 0:00:42
341500 -- [-1026.002] (-1026.977) (-1025.425) (-1028.487) * (-1027.051) (-1024.619) (-1026.475) [-1027.025] -- 0:00:42
342000 -- (-1027.615) (-1027.911) (-1026.482) [-1028.381] * (-1026.080) (-1025.784) (-1025.409) [-1022.442] -- 0:00:42
342500 -- (-1027.300) (-1026.850) (-1026.946) [-1027.310] * [-1026.510] (-1025.838) (-1026.349) (-1026.817) -- 0:00:42
343000 -- [-1024.102] (-1025.239) (-1024.937) (-1027.872) * (-1026.592) [-1026.719] (-1026.814) (-1027.454) -- 0:00:42
343500 -- (-1023.748) (-1023.990) [-1026.133] (-1027.614) * (-1023.848) (-1025.773) (-1024.116) [-1026.659] -- 0:00:43
344000 -- [-1023.871] (-1026.862) (-1026.336) (-1027.573) * (-1027.146) (-1023.794) (-1024.283) [-1025.172] -- 0:00:43
344500 -- (-1024.448) (-1035.113) (-1024.878) [-1027.361] * (-1023.693) (-1023.598) [-1024.577] (-1021.853) -- 0:00:43
345000 -- (-1027.549) (-1025.733) [-1025.794] (-1026.208) * (-1024.555) (-1025.651) [-1023.914] (-1024.151) -- 0:00:43
Average standard deviation of split frequencies: 0.015130
345500 -- [-1024.888] (-1024.959) (-1024.375) (-1028.157) * (-1024.925) [-1024.988] (-1025.092) (-1023.617) -- 0:00:43
346000 -- (-1024.370) [-1024.294] (-1025.402) (-1024.944) * (-1025.947) (-1024.765) [-1024.635] (-1025.968) -- 0:00:43
346500 -- [-1024.106] (-1024.428) (-1023.432) (-1026.456) * (-1024.555) (-1024.706) [-1025.902] (-1030.407) -- 0:00:43
347000 -- (-1026.433) (-1023.918) (-1025.289) [-1025.292] * (-1026.116) [-1025.284] (-1025.653) (-1023.088) -- 0:00:43
347500 -- (-1024.635) (-1026.208) [-1026.891] (-1024.223) * (-1025.481) (-1025.360) (-1025.409) [-1024.290] -- 0:00:43
348000 -- (-1025.151) [-1022.947] (-1023.991) (-1025.733) * (-1025.745) (-1024.142) [-1025.074] (-1023.574) -- 0:00:43
348500 -- (-1025.400) (-1025.022) (-1025.519) [-1026.088] * (-1024.777) (-1027.394) [-1024.148] (-1025.043) -- 0:00:42
349000 -- (-1024.245) [-1024.717] (-1023.042) (-1026.317) * (-1030.015) (-1029.939) (-1022.987) [-1023.725] -- 0:00:42
349500 -- [-1022.274] (-1024.924) (-1025.151) (-1028.870) * (-1030.129) [-1028.519] (-1022.985) (-1024.498) -- 0:00:42
350000 -- [-1025.651] (-1025.446) (-1024.233) (-1029.436) * (-1023.677) (-1027.680) [-1025.637] (-1026.665) -- 0:00:42
Average standard deviation of split frequencies: 0.014221
350500 -- (-1023.204) (-1026.144) [-1025.217] (-1025.439) * (-1029.367) (-1024.889) [-1022.882] (-1027.593) -- 0:00:42
351000 -- [-1023.585] (-1024.989) (-1024.181) (-1025.957) * (-1028.050) (-1024.070) (-1024.949) [-1024.644] -- 0:00:42
351500 -- (-1025.192) [-1023.362] (-1025.504) (-1026.538) * (-1022.440) (-1022.513) (-1025.941) [-1023.727] -- 0:00:42
352000 -- (-1028.475) (-1022.610) [-1023.513] (-1023.553) * (-1027.673) (-1027.636) [-1025.861] (-1026.122) -- 0:00:42
352500 -- (-1025.140) (-1029.117) [-1027.310] (-1026.079) * (-1025.536) [-1022.438] (-1027.430) (-1025.156) -- 0:00:42
353000 -- [-1023.518] (-1029.943) (-1025.251) (-1025.263) * (-1023.967) (-1026.592) [-1028.964] (-1025.680) -- 0:00:42
353500 -- (-1026.695) (-1030.369) (-1023.409) [-1031.955] * (-1025.857) [-1024.612] (-1032.552) (-1026.563) -- 0:00:42
354000 -- (-1025.068) (-1025.126) (-1024.752) [-1026.247] * [-1024.121] (-1025.612) (-1027.697) (-1024.744) -- 0:00:41
354500 -- (-1024.386) [-1023.110] (-1023.950) (-1028.057) * [-1025.975] (-1027.234) (-1025.261) (-1022.609) -- 0:00:41
355000 -- (-1028.000) [-1026.459] (-1023.917) (-1026.154) * (-1027.422) [-1023.277] (-1024.681) (-1025.917) -- 0:00:41
Average standard deviation of split frequencies: 0.014235
355500 -- (-1026.352) [-1026.383] (-1024.355) (-1026.213) * (-1024.752) [-1024.877] (-1024.788) (-1024.542) -- 0:00:41
356000 -- (-1027.743) (-1024.602) [-1027.984] (-1026.104) * [-1025.871] (-1025.396) (-1027.622) (-1025.066) -- 0:00:41
356500 -- [-1024.054] (-1025.339) (-1028.031) (-1026.763) * (-1028.092) (-1024.419) (-1025.768) [-1024.957] -- 0:00:41
357000 -- (-1027.138) [-1023.557] (-1022.205) (-1023.856) * (-1026.224) (-1023.638) (-1024.897) [-1025.971] -- 0:00:41
357500 -- (-1024.740) (-1024.965) (-1023.847) [-1023.920] * (-1025.943) (-1025.393) [-1025.366] (-1025.808) -- 0:00:41
358000 -- (-1025.698) [-1024.232] (-1024.702) (-1025.539) * (-1028.667) [-1024.201] (-1026.249) (-1025.630) -- 0:00:41
358500 -- (-1024.614) (-1025.762) [-1024.164] (-1025.190) * (-1029.637) [-1026.188] (-1029.145) (-1024.411) -- 0:00:42
359000 -- (-1025.307) (-1024.064) [-1021.826] (-1027.150) * (-1025.506) [-1027.760] (-1025.922) (-1025.271) -- 0:00:42
359500 -- [-1024.256] (-1026.422) (-1023.042) (-1030.118) * (-1025.293) [-1026.685] (-1024.625) (-1023.639) -- 0:00:42
360000 -- [-1022.769] (-1025.893) (-1025.926) (-1030.261) * [-1025.894] (-1026.157) (-1024.877) (-1027.448) -- 0:00:42
Average standard deviation of split frequencies: 0.014033
360500 -- (-1026.662) (-1025.174) [-1022.416] (-1027.376) * (-1025.151) (-1023.590) [-1026.120] (-1032.422) -- 0:00:42
361000 -- (-1027.715) [-1025.580] (-1023.193) (-1027.221) * (-1022.698) (-1023.532) (-1026.103) [-1029.664] -- 0:00:42
361500 -- [-1024.786] (-1025.753) (-1026.100) (-1031.107) * (-1026.113) [-1023.073] (-1026.288) (-1026.791) -- 0:00:42
362000 -- (-1024.913) (-1027.418) (-1024.081) [-1028.063] * (-1026.462) (-1025.623) [-1022.339] (-1024.675) -- 0:00:42
362500 -- (-1025.599) (-1029.016) (-1023.091) [-1027.755] * (-1025.788) (-1026.487) (-1027.036) [-1026.230] -- 0:00:42
363000 -- [-1025.096] (-1025.416) (-1026.974) (-1027.225) * (-1031.549) (-1023.939) (-1025.830) [-1025.139] -- 0:00:42
363500 -- (-1021.934) (-1026.129) (-1025.690) [-1026.545] * (-1022.129) (-1026.743) [-1024.489] (-1025.557) -- 0:00:42
364000 -- [-1024.166] (-1026.447) (-1024.187) (-1026.274) * (-1028.404) (-1030.358) [-1027.241] (-1024.474) -- 0:00:41
364500 -- [-1025.281] (-1025.775) (-1026.518) (-1026.339) * (-1024.421) [-1025.652] (-1026.402) (-1025.160) -- 0:00:41
365000 -- (-1027.070) (-1025.105) [-1023.172] (-1025.545) * (-1026.496) [-1026.292] (-1023.808) (-1030.089) -- 0:00:41
Average standard deviation of split frequencies: 0.013910
365500 -- (-1026.439) (-1025.045) (-1025.063) [-1025.835] * (-1024.063) (-1023.208) [-1025.575] (-1026.394) -- 0:00:41
366000 -- (-1028.055) [-1024.710] (-1030.543) (-1025.554) * (-1024.171) (-1024.263) (-1025.050) [-1026.028] -- 0:00:41
366500 -- (-1024.853) (-1025.630) [-1022.196] (-1026.073) * [-1024.011] (-1027.469) (-1028.399) (-1023.669) -- 0:00:41
367000 -- (-1027.426) [-1027.107] (-1027.093) (-1024.730) * (-1027.386) (-1023.029) (-1029.391) [-1026.730] -- 0:00:41
367500 -- (-1028.808) (-1028.847) [-1024.309] (-1023.814) * (-1028.244) [-1022.941] (-1026.247) (-1024.495) -- 0:00:41
368000 -- [-1023.056] (-1025.414) (-1023.756) (-1026.997) * (-1027.753) [-1024.156] (-1026.557) (-1026.529) -- 0:00:41
368500 -- (-1029.488) (-1028.530) [-1025.657] (-1026.252) * (-1025.801) (-1024.439) (-1027.535) [-1025.788] -- 0:00:41
369000 -- (-1025.759) (-1024.074) [-1023.167] (-1026.414) * (-1028.894) [-1024.398] (-1024.671) (-1026.809) -- 0:00:41
369500 -- (-1028.340) (-1025.516) [-1025.240] (-1026.152) * (-1030.074) [-1026.274] (-1029.573) (-1030.459) -- 0:00:40
370000 -- (-1027.958) (-1025.716) (-1022.597) [-1027.745] * (-1023.926) (-1026.180) [-1022.962] (-1025.466) -- 0:00:40
Average standard deviation of split frequencies: 0.013655
370500 -- (-1025.878) (-1026.873) [-1025.079] (-1027.064) * (-1025.216) (-1025.836) (-1023.228) [-1025.132] -- 0:00:40
371000 -- (-1025.755) (-1025.520) (-1027.972) [-1025.190] * (-1025.442) (-1027.443) [-1025.216] (-1023.464) -- 0:00:40
371500 -- (-1024.987) (-1028.792) (-1026.129) [-1026.064] * (-1027.372) (-1028.056) [-1025.179] (-1023.774) -- 0:00:40
372000 -- (-1024.601) (-1024.751) (-1025.985) [-1025.061] * (-1026.396) (-1027.180) (-1027.224) [-1027.567] -- 0:00:40
372500 -- (-1024.531) (-1023.979) [-1025.575] (-1025.723) * (-1025.215) (-1025.991) (-1028.269) [-1024.030] -- 0:00:40
373000 -- (-1025.419) (-1024.605) (-1025.821) [-1024.244] * (-1024.733) (-1025.684) (-1025.542) [-1025.339] -- 0:00:40
373500 -- (-1025.726) (-1027.478) (-1029.312) [-1024.719] * [-1025.903] (-1024.967) (-1026.268) (-1024.582) -- 0:00:40
374000 -- (-1024.158) (-1023.951) (-1029.111) [-1025.674] * (-1026.994) (-1026.420) (-1025.364) [-1024.641] -- 0:00:41
374500 -- (-1024.361) (-1025.413) (-1028.750) [-1025.371] * (-1024.872) (-1023.003) [-1024.448] (-1024.534) -- 0:00:41
375000 -- [-1023.928] (-1025.387) (-1028.810) (-1025.320) * [-1026.451] (-1026.483) (-1025.296) (-1025.821) -- 0:00:41
Average standard deviation of split frequencies: 0.012999
375500 -- [-1024.762] (-1022.950) (-1026.910) (-1027.098) * (-1024.948) (-1029.866) [-1024.956] (-1027.786) -- 0:00:41
376000 -- (-1024.603) [-1026.290] (-1025.584) (-1024.816) * (-1025.568) (-1025.984) (-1030.288) [-1026.138] -- 0:00:41
376500 -- [-1026.954] (-1023.439) (-1024.553) (-1026.500) * [-1028.870] (-1025.214) (-1030.006) (-1025.074) -- 0:00:41
377000 -- (-1026.191) [-1029.419] (-1025.212) (-1023.063) * (-1028.363) (-1027.961) (-1025.742) [-1025.534] -- 0:00:41
377500 -- (-1023.230) (-1023.917) [-1024.125] (-1026.644) * (-1029.280) (-1026.249) (-1028.816) [-1026.759] -- 0:00:41
378000 -- (-1025.886) (-1025.624) [-1028.279] (-1031.371) * (-1028.929) (-1025.279) [-1025.486] (-1024.678) -- 0:00:41
378500 -- [-1023.139] (-1029.194) (-1027.499) (-1025.942) * (-1025.799) (-1025.494) (-1026.855) [-1026.192] -- 0:00:41
379000 -- (-1022.507) (-1025.622) [-1023.749] (-1025.562) * (-1024.405) [-1025.471] (-1025.962) (-1025.850) -- 0:00:40
379500 -- (-1025.148) (-1025.264) [-1024.238] (-1024.955) * (-1024.543) [-1024.327] (-1026.776) (-1025.597) -- 0:00:40
380000 -- [-1023.664] (-1024.944) (-1024.907) (-1027.122) * (-1029.384) (-1028.797) (-1024.086) [-1023.942] -- 0:00:40
Average standard deviation of split frequencies: 0.013622
380500 -- (-1024.688) (-1025.545) (-1025.715) [-1024.235] * (-1029.215) [-1027.236] (-1024.587) (-1023.776) -- 0:00:40
381000 -- (-1024.377) [-1029.001] (-1026.852) (-1025.720) * [-1023.951] (-1025.251) (-1025.199) (-1025.826) -- 0:00:40
381500 -- (-1023.300) (-1028.965) (-1023.974) [-1025.549] * (-1024.246) (-1024.905) (-1026.302) [-1025.649] -- 0:00:40
382000 -- [-1024.674] (-1028.461) (-1027.213) (-1024.533) * (-1023.785) [-1024.856] (-1025.940) (-1025.520) -- 0:00:40
382500 -- [-1024.764] (-1023.641) (-1025.414) (-1025.333) * (-1024.084) (-1027.865) [-1024.270] (-1026.505) -- 0:00:40
383000 -- [-1023.735] (-1024.303) (-1026.195) (-1025.758) * (-1024.949) [-1027.232] (-1026.683) (-1025.895) -- 0:00:40
383500 -- (-1026.017) [-1024.610] (-1029.113) (-1025.622) * (-1023.515) [-1026.976] (-1027.999) (-1026.507) -- 0:00:40
384000 -- (-1026.630) (-1029.477) (-1028.828) [-1024.982] * [-1025.106] (-1029.515) (-1027.761) (-1029.009) -- 0:00:40
384500 -- [-1025.120] (-1027.424) (-1027.518) (-1026.891) * (-1028.250) (-1027.555) [-1026.786] (-1025.709) -- 0:00:40
385000 -- (-1022.981) (-1024.659) (-1023.688) [-1024.662] * (-1024.477) (-1027.055) (-1027.670) [-1025.535] -- 0:00:39
Average standard deviation of split frequencies: 0.012405
385500 -- [-1025.657] (-1024.115) (-1024.697) (-1027.487) * (-1024.067) (-1026.112) (-1027.310) [-1024.040] -- 0:00:39
386000 -- (-1024.282) (-1023.608) [-1027.609] (-1025.496) * (-1026.216) (-1026.746) [-1026.133] (-1022.962) -- 0:00:39
386500 -- (-1024.599) (-1032.141) [-1024.540] (-1027.712) * (-1028.442) (-1027.117) (-1026.689) [-1028.431] -- 0:00:39
387000 -- (-1022.653) (-1024.557) (-1024.782) [-1028.012] * (-1025.967) (-1025.046) (-1025.993) [-1031.703] -- 0:00:39
387500 -- (-1024.495) (-1028.595) [-1025.005] (-1026.396) * (-1026.701) (-1024.157) (-1022.813) [-1029.983] -- 0:00:39
388000 -- (-1025.420) [-1031.504] (-1025.205) (-1025.865) * (-1026.337) (-1030.247) (-1024.453) [-1025.940] -- 0:00:39
388500 -- [-1024.256] (-1027.149) (-1025.285) (-1029.201) * [-1026.455] (-1032.141) (-1023.933) (-1024.641) -- 0:00:39
389000 -- (-1026.327) (-1027.117) [-1024.632] (-1025.468) * (-1027.978) (-1025.704) (-1025.221) [-1023.903] -- 0:00:40
389500 -- (-1023.593) (-1027.215) [-1024.347] (-1029.267) * (-1026.206) (-1025.282) [-1022.564] (-1028.093) -- 0:00:40
390000 -- (-1025.416) [-1024.709] (-1024.965) (-1025.609) * [-1025.310] (-1024.261) (-1027.260) (-1023.618) -- 0:00:40
Average standard deviation of split frequencies: 0.011128
390500 -- (-1028.699) (-1025.146) [-1024.262] (-1024.110) * [-1023.068] (-1026.954) (-1023.528) (-1027.047) -- 0:00:40
391000 -- (-1025.204) (-1025.556) [-1028.053] (-1024.268) * (-1024.303) (-1027.723) [-1025.864] (-1031.295) -- 0:00:40
391500 -- (-1025.497) (-1025.434) (-1024.144) [-1023.489] * [-1024.541] (-1025.742) (-1025.316) (-1025.368) -- 0:00:40
392000 -- (-1025.822) (-1024.345) (-1025.062) [-1026.706] * (-1021.757) (-1030.531) (-1026.041) [-1024.609] -- 0:00:40
392500 -- (-1025.049) (-1026.280) [-1024.616] (-1026.357) * (-1024.320) (-1025.142) [-1024.308] (-1023.982) -- 0:00:40
393000 -- (-1025.360) [-1024.941] (-1025.373) (-1025.023) * (-1026.867) [-1023.906] (-1026.423) (-1027.023) -- 0:00:40
393500 -- (-1024.871) (-1025.971) (-1025.246) [-1025.144] * (-1023.463) (-1024.673) (-1028.269) [-1024.658] -- 0:00:40
394000 -- (-1026.747) (-1027.231) [-1024.811] (-1025.622) * (-1030.771) [-1024.390] (-1028.698) (-1026.499) -- 0:00:39
394500 -- (-1027.308) [-1027.853] (-1024.281) (-1025.678) * (-1023.533) (-1022.419) (-1024.049) [-1024.083] -- 0:00:39
395000 -- [-1026.746] (-1026.374) (-1024.729) (-1026.034) * [-1026.594] (-1028.058) (-1024.863) (-1024.644) -- 0:00:39
Average standard deviation of split frequencies: 0.010651
395500 -- (-1030.107) (-1026.590) (-1025.081) [-1028.848] * [-1026.522] (-1025.222) (-1024.534) (-1024.601) -- 0:00:39
396000 -- (-1025.835) [-1026.321] (-1024.825) (-1032.573) * (-1027.527) (-1026.989) (-1023.838) [-1024.603] -- 0:00:39
396500 -- (-1027.392) (-1025.507) [-1022.997] (-1025.329) * (-1025.297) [-1022.641] (-1028.709) (-1027.306) -- 0:00:39
397000 -- (-1025.425) (-1026.085) (-1023.446) [-1025.994] * (-1025.154) [-1022.269] (-1028.169) (-1026.959) -- 0:00:39
397500 -- (-1025.276) [-1025.594] (-1025.754) (-1028.789) * (-1023.981) [-1023.067] (-1025.850) (-1025.249) -- 0:00:39
398000 -- [-1024.111] (-1025.865) (-1024.281) (-1026.828) * (-1024.982) [-1025.201] (-1028.643) (-1026.782) -- 0:00:39
398500 -- [-1024.614] (-1029.962) (-1023.759) (-1025.531) * (-1024.261) [-1024.247] (-1027.400) (-1025.834) -- 0:00:39
399000 -- (-1025.152) [-1024.863] (-1026.644) (-1028.257) * (-1025.539) [-1024.908] (-1026.091) (-1026.470) -- 0:00:39
399500 -- [-1024.566] (-1024.448) (-1024.434) (-1027.244) * [-1025.118] (-1024.860) (-1029.280) (-1025.696) -- 0:00:39
400000 -- (-1028.018) (-1024.872) (-1024.688) [-1024.015] * (-1026.237) [-1025.295] (-1024.795) (-1024.941) -- 0:00:39
Average standard deviation of split frequencies: 0.010465
400500 -- [-1024.929] (-1025.664) (-1024.345) (-1023.558) * (-1028.162) (-1025.480) (-1026.005) [-1025.198] -- 0:00:38
401000 -- (-1024.171) [-1026.847] (-1024.869) (-1024.976) * (-1028.837) [-1025.525] (-1025.096) (-1025.298) -- 0:00:38
401500 -- (-1028.558) [-1027.136] (-1026.647) (-1028.070) * (-1024.337) [-1025.014] (-1024.892) (-1023.235) -- 0:00:38
402000 -- [-1024.954] (-1022.950) (-1024.988) (-1025.501) * (-1029.913) (-1026.082) [-1025.260] (-1026.424) -- 0:00:38
402500 -- (-1023.167) [-1024.010] (-1025.579) (-1029.563) * [-1025.671] (-1025.530) (-1025.298) (-1026.921) -- 0:00:38
403000 -- (-1026.676) [-1027.884] (-1025.323) (-1028.567) * [-1025.330] (-1022.824) (-1028.111) (-1025.495) -- 0:00:38
403500 -- (-1027.068) (-1027.778) [-1025.400] (-1025.696) * [-1027.034] (-1027.646) (-1025.325) (-1023.814) -- 0:00:38
404000 -- (-1025.321) (-1035.914) (-1023.839) [-1025.420] * [-1025.442] (-1027.595) (-1025.227) (-1029.063) -- 0:00:38
404500 -- [-1025.011] (-1032.560) (-1023.935) (-1025.502) * [-1027.465] (-1024.802) (-1027.173) (-1024.382) -- 0:00:39
405000 -- (-1028.418) (-1024.897) [-1025.143] (-1032.099) * [-1026.330] (-1027.218) (-1024.897) (-1024.580) -- 0:00:39
Average standard deviation of split frequencies: 0.012039
405500 -- [-1024.990] (-1023.810) (-1024.208) (-1030.481) * (-1026.098) [-1028.502] (-1025.208) (-1026.606) -- 0:00:39
406000 -- [-1025.064] (-1024.700) (-1024.979) (-1029.284) * (-1025.851) (-1026.594) (-1028.577) [-1026.198] -- 0:00:39
406500 -- (-1024.360) (-1026.237) (-1025.385) [-1023.062] * (-1025.623) [-1025.995] (-1026.876) (-1022.955) -- 0:00:39
407000 -- (-1025.121) [-1026.064] (-1025.874) (-1025.641) * (-1025.591) [-1022.153] (-1025.606) (-1024.420) -- 0:00:39
407500 -- (-1024.390) (-1027.184) [-1023.045] (-1028.991) * (-1024.146) [-1025.123] (-1025.024) (-1026.599) -- 0:00:39
408000 -- (-1026.197) (-1027.444) (-1027.137) [-1028.957] * (-1024.445) [-1023.526] (-1025.142) (-1023.557) -- 0:00:39
408500 -- (-1024.353) (-1027.802) (-1026.677) [-1025.297] * (-1028.040) [-1023.305] (-1025.501) (-1026.658) -- 0:00:39
409000 -- (-1024.976) (-1024.509) [-1028.688] (-1028.431) * (-1023.467) (-1026.175) (-1023.826) [-1024.855] -- 0:00:39
409500 -- (-1026.137) (-1023.686) (-1024.489) [-1025.340] * (-1025.232) (-1024.220) [-1024.702] (-1026.492) -- 0:00:38
410000 -- (-1025.476) (-1023.099) (-1028.499) [-1026.764] * (-1028.474) [-1024.259] (-1026.108) (-1024.988) -- 0:00:38
Average standard deviation of split frequencies: 0.012204
410500 -- [-1024.260] (-1024.307) (-1028.950) (-1029.361) * (-1025.329) (-1026.595) [-1027.408] (-1023.617) -- 0:00:38
411000 -- (-1025.618) (-1025.967) (-1028.655) [-1024.490] * (-1026.477) (-1028.183) (-1024.777) [-1022.656] -- 0:00:38
411500 -- (-1031.454) [-1024.005] (-1024.250) (-1026.890) * (-1025.664) (-1024.569) (-1025.618) [-1026.356] -- 0:00:38
412000 -- (-1028.215) (-1029.432) [-1022.178] (-1027.858) * (-1025.183) [-1024.678] (-1026.213) (-1025.155) -- 0:00:38
412500 -- (-1024.416) (-1027.878) (-1024.290) [-1023.866] * (-1030.753) (-1023.682) [-1027.006] (-1024.968) -- 0:00:38
413000 -- (-1025.347) (-1026.037) [-1024.982] (-1025.729) * [-1026.850] (-1022.853) (-1027.693) (-1024.476) -- 0:00:38
413500 -- (-1025.835) (-1025.606) (-1026.658) [-1026.171] * (-1024.440) (-1022.189) [-1025.762] (-1025.006) -- 0:00:38
414000 -- (-1026.552) (-1024.207) (-1026.690) [-1027.610] * (-1022.923) (-1025.217) (-1024.690) [-1026.658] -- 0:00:38
414500 -- (-1023.489) (-1026.974) (-1028.707) [-1025.733] * (-1025.081) (-1028.618) (-1030.072) [-1026.644] -- 0:00:38
415000 -- [-1024.173] (-1025.066) (-1025.664) (-1024.301) * (-1025.237) (-1024.838) [-1024.800] (-1026.098) -- 0:00:38
Average standard deviation of split frequencies: 0.012823
415500 -- (-1023.839) (-1026.224) (-1025.235) [-1025.095] * (-1025.133) (-1022.295) (-1024.470) [-1024.728] -- 0:00:37
416000 -- (-1023.499) (-1031.576) [-1025.692] (-1026.383) * (-1029.258) [-1023.151] (-1026.077) (-1027.001) -- 0:00:37
416500 -- [-1026.472] (-1030.546) (-1022.205) (-1029.480) * (-1024.701) [-1025.968] (-1027.123) (-1023.935) -- 0:00:37
417000 -- (-1025.454) (-1031.037) [-1023.631] (-1027.167) * (-1029.007) (-1027.221) [-1026.433] (-1024.150) -- 0:00:37
417500 -- (-1025.878) (-1023.939) [-1027.389] (-1027.055) * (-1027.794) (-1026.524) (-1026.651) [-1021.530] -- 0:00:37
418000 -- [-1026.411] (-1023.552) (-1028.261) (-1026.879) * [-1027.561] (-1023.786) (-1030.974) (-1026.847) -- 0:00:37
418500 -- (-1029.136) [-1025.811] (-1023.594) (-1024.230) * (-1027.457) (-1030.780) (-1027.708) [-1027.765] -- 0:00:37
419000 -- [-1025.741] (-1025.289) (-1026.510) (-1026.169) * [-1024.171] (-1029.781) (-1025.756) (-1025.138) -- 0:00:37
419500 -- (-1025.891) (-1025.094) [-1025.549] (-1032.476) * (-1024.487) [-1025.395] (-1026.512) (-1025.748) -- 0:00:38
420000 -- [-1025.988] (-1023.545) (-1025.050) (-1027.455) * (-1026.007) [-1025.581] (-1026.741) (-1024.540) -- 0:00:38
Average standard deviation of split frequencies: 0.013261
420500 -- (-1025.125) [-1026.318] (-1027.043) (-1025.092) * (-1031.021) (-1026.776) [-1023.106] (-1023.629) -- 0:00:38
421000 -- [-1023.243] (-1025.213) (-1025.628) (-1028.760) * (-1030.353) (-1025.961) [-1023.733] (-1024.252) -- 0:00:38
421500 -- (-1023.110) (-1024.263) (-1023.782) [-1027.709] * (-1028.625) (-1024.671) (-1024.641) [-1024.102] -- 0:00:38
422000 -- (-1025.107) (-1025.105) [-1028.074] (-1029.431) * (-1026.796) (-1024.712) [-1025.464] (-1027.872) -- 0:00:38
422500 -- [-1024.524] (-1023.459) (-1025.305) (-1027.912) * [-1025.608] (-1029.066) (-1026.316) (-1024.176) -- 0:00:38
423000 -- (-1026.939) [-1024.876] (-1025.781) (-1023.570) * (-1030.777) [-1026.242] (-1027.368) (-1024.436) -- 0:00:38
423500 -- [-1025.920] (-1026.661) (-1028.565) (-1028.202) * (-1024.354) (-1025.501) [-1024.652] (-1023.662) -- 0:00:38
424000 -- [-1025.448] (-1024.067) (-1026.287) (-1025.882) * (-1022.899) (-1025.093) (-1023.654) [-1030.205] -- 0:00:38
424500 -- (-1024.121) (-1026.731) (-1025.894) [-1027.210] * (-1025.245) [-1028.299] (-1025.501) (-1024.679) -- 0:00:37
425000 -- [-1024.746] (-1026.704) (-1024.656) (-1031.743) * (-1025.487) (-1029.173) [-1025.802] (-1025.470) -- 0:00:37
Average standard deviation of split frequencies: 0.012726
425500 -- (-1027.498) (-1028.019) [-1023.514] (-1026.682) * [-1024.753] (-1024.960) (-1023.084) (-1023.747) -- 0:00:37
426000 -- [-1024.420] (-1026.632) (-1023.798) (-1024.145) * (-1027.816) (-1028.305) [-1025.017] (-1024.031) -- 0:00:37
426500 -- (-1027.853) (-1029.952) [-1025.348] (-1024.775) * (-1025.744) (-1025.966) (-1027.829) [-1023.819] -- 0:00:37
427000 -- (-1024.741) [-1026.240] (-1024.675) (-1024.227) * [-1028.235] (-1023.689) (-1024.645) (-1028.009) -- 0:00:37
427500 -- (-1024.321) (-1026.723) (-1026.134) [-1022.529] * (-1025.137) (-1029.205) [-1026.424] (-1026.204) -- 0:00:37
428000 -- (-1025.677) [-1026.920] (-1030.551) (-1025.569) * (-1027.693) [-1026.571] (-1027.735) (-1028.595) -- 0:00:37
428500 -- (-1026.429) (-1026.158) [-1025.526] (-1024.673) * [-1025.559] (-1029.964) (-1025.733) (-1027.636) -- 0:00:37
429000 -- (-1023.285) (-1024.274) (-1027.673) [-1027.665] * (-1031.274) (-1029.591) [-1025.946] (-1026.310) -- 0:00:37
429500 -- [-1028.475] (-1025.190) (-1025.206) (-1024.211) * (-1027.485) (-1026.867) [-1026.463] (-1024.128) -- 0:00:37
430000 -- (-1024.191) (-1022.488) (-1025.537) [-1025.506] * (-1024.498) (-1026.083) [-1024.816] (-1026.483) -- 0:00:37
Average standard deviation of split frequencies: 0.012831
430500 -- (-1028.763) (-1024.077) (-1025.750) [-1030.142] * (-1029.626) [-1026.779] (-1027.253) (-1025.673) -- 0:00:37
431000 -- [-1024.779] (-1023.998) (-1025.568) (-1026.776) * [-1024.880] (-1023.825) (-1027.254) (-1025.596) -- 0:00:36
431500 -- (-1026.547) (-1026.739) (-1025.368) [-1024.366] * (-1024.198) (-1029.179) [-1026.674] (-1025.572) -- 0:00:36
432000 -- (-1024.456) [-1030.371] (-1024.699) (-1026.433) * (-1027.121) [-1027.337] (-1026.050) (-1024.224) -- 0:00:36
432500 -- (-1024.352) (-1024.394) (-1026.339) [-1024.269] * (-1027.469) (-1023.806) (-1025.397) [-1029.639] -- 0:00:36
433000 -- (-1025.488) [-1026.862] (-1027.157) (-1026.083) * (-1026.761) (-1023.039) [-1027.255] (-1026.554) -- 0:00:36
433500 -- (-1026.636) (-1025.014) [-1027.402] (-1025.514) * (-1025.077) (-1025.684) (-1024.878) [-1025.261] -- 0:00:36
434000 -- (-1026.107) (-1022.729) (-1024.745) [-1023.015] * (-1025.965) (-1025.494) (-1025.969) [-1023.156] -- 0:00:36
434500 -- (-1023.800) (-1024.677) (-1026.132) [-1027.098] * (-1024.634) (-1025.189) [-1026.043] (-1028.103) -- 0:00:37
435000 -- (-1026.211) [-1026.719] (-1027.482) (-1027.070) * (-1026.947) (-1023.346) (-1025.775) [-1025.247] -- 0:00:37
Average standard deviation of split frequencies: 0.013547
435500 -- (-1025.119) (-1029.416) (-1026.471) [-1028.836] * (-1028.627) (-1026.299) [-1024.147] (-1024.638) -- 0:00:37
436000 -- [-1029.020] (-1027.726) (-1026.398) (-1025.436) * (-1030.302) (-1026.252) [-1024.086] (-1024.994) -- 0:00:37
436500 -- (-1027.207) (-1024.041) [-1023.871] (-1025.345) * (-1028.845) (-1027.817) (-1026.227) [-1026.249] -- 0:00:37
437000 -- (-1022.683) [-1022.644] (-1024.384) (-1025.559) * (-1026.739) (-1025.457) (-1025.120) [-1028.102] -- 0:00:37
437500 -- (-1024.598) [-1026.262] (-1025.020) (-1028.945) * (-1024.658) (-1024.493) (-1027.776) [-1023.972] -- 0:00:37
438000 -- (-1024.312) [-1025.523] (-1023.968) (-1026.208) * [-1023.403] (-1026.671) (-1025.189) (-1024.869) -- 0:00:37
438500 -- (-1026.385) (-1025.989) (-1030.910) [-1026.746] * (-1024.197) (-1024.435) (-1025.020) [-1025.528] -- 0:00:37
439000 -- (-1026.293) [-1025.556] (-1028.685) (-1025.367) * [-1026.029] (-1025.019) (-1022.846) (-1026.504) -- 0:00:37
439500 -- (-1025.280) (-1025.348) (-1025.819) [-1027.390] * (-1026.352) [-1024.129] (-1026.365) (-1024.837) -- 0:00:36
440000 -- [-1024.956] (-1025.063) (-1025.960) (-1025.271) * (-1025.504) [-1026.072] (-1024.733) (-1028.542) -- 0:00:36
Average standard deviation of split frequencies: 0.012183
440500 -- [-1025.065] (-1025.097) (-1026.008) (-1026.325) * (-1025.733) (-1022.500) (-1026.807) [-1024.957] -- 0:00:36
441000 -- (-1027.519) (-1025.470) (-1031.389) [-1030.679] * (-1024.359) (-1025.899) (-1024.886) [-1022.730] -- 0:00:36
441500 -- [-1023.992] (-1024.297) (-1025.379) (-1029.411) * (-1024.130) (-1027.133) [-1023.286] (-1023.809) -- 0:00:36
442000 -- (-1026.364) (-1026.046) [-1026.941] (-1025.043) * (-1025.040) (-1026.987) (-1029.334) [-1023.910] -- 0:00:36
442500 -- (-1024.469) (-1029.121) (-1024.795) [-1026.117] * (-1024.381) (-1025.909) (-1027.169) [-1028.462] -- 0:00:36
443000 -- (-1025.654) (-1025.040) (-1023.720) [-1024.713] * [-1026.281] (-1023.767) (-1026.353) (-1025.537) -- 0:00:36
443500 -- (-1029.028) (-1027.711) [-1026.960] (-1026.234) * (-1024.360) (-1023.647) (-1028.945) [-1024.079] -- 0:00:36
444000 -- (-1026.508) (-1026.069) [-1026.072] (-1028.413) * (-1031.463) (-1023.699) (-1023.663) [-1023.875] -- 0:00:36
444500 -- [-1024.099] (-1025.770) (-1029.107) (-1031.142) * [-1025.084] (-1023.154) (-1025.699) (-1025.178) -- 0:00:36
445000 -- (-1026.641) (-1024.547) [-1025.007] (-1037.044) * [-1024.651] (-1022.786) (-1025.587) (-1029.447) -- 0:00:36
Average standard deviation of split frequencies: 0.011979
445500 -- (-1026.954) [-1024.347] (-1025.480) (-1026.315) * (-1024.218) (-1021.445) (-1029.101) [-1024.710] -- 0:00:36
446000 -- (-1024.693) (-1024.497) [-1025.231] (-1026.228) * [-1025.309] (-1023.915) (-1025.470) (-1025.552) -- 0:00:36
446500 -- (-1027.310) (-1026.769) (-1024.879) [-1025.077] * [-1025.079] (-1021.981) (-1027.023) (-1029.905) -- 0:00:35
447000 -- [-1024.073] (-1026.748) (-1024.806) (-1025.969) * (-1024.517) [-1023.143] (-1026.654) (-1025.435) -- 0:00:35
447500 -- [-1028.723] (-1026.235) (-1024.585) (-1025.793) * (-1022.771) [-1026.257] (-1025.735) (-1026.908) -- 0:00:35
448000 -- (-1025.036) (-1025.232) [-1024.609] (-1028.827) * (-1023.328) [-1023.649] (-1024.747) (-1028.161) -- 0:00:35
448500 -- (-1025.375) (-1025.330) (-1029.094) [-1024.148] * (-1028.485) (-1026.714) [-1022.711] (-1027.791) -- 0:00:35
449000 -- (-1026.230) [-1024.812] (-1027.655) (-1026.339) * (-1033.344) [-1025.969] (-1023.185) (-1028.035) -- 0:00:35
449500 -- (-1025.944) (-1025.813) (-1026.349) [-1026.157] * (-1036.577) (-1024.436) (-1026.993) [-1026.872] -- 0:00:35
450000 -- (-1024.292) (-1030.937) [-1026.367] (-1023.541) * (-1025.393) (-1029.425) [-1027.918] (-1025.678) -- 0:00:36
Average standard deviation of split frequencies: 0.010518
450500 -- (-1026.354) (-1028.026) (-1025.712) [-1026.645] * (-1024.097) [-1023.743] (-1027.127) (-1026.048) -- 0:00:36
451000 -- [-1024.606] (-1030.763) (-1024.868) (-1024.860) * (-1023.772) (-1023.719) [-1025.726] (-1024.132) -- 0:00:36
451500 -- [-1023.541] (-1024.731) (-1024.489) (-1027.855) * (-1026.499) (-1028.965) [-1025.736] (-1027.471) -- 0:00:36
452000 -- [-1027.794] (-1025.331) (-1024.396) (-1024.037) * (-1027.579) (-1031.637) (-1023.766) [-1026.195] -- 0:00:36
452500 -- (-1027.063) (-1026.788) [-1025.113] (-1024.444) * (-1025.424) [-1026.024] (-1024.307) (-1025.933) -- 0:00:36
453000 -- (-1025.534) [-1023.098] (-1024.366) (-1023.315) * [-1029.322] (-1022.991) (-1024.243) (-1026.989) -- 0:00:36
453500 -- [-1022.642] (-1024.800) (-1027.010) (-1024.086) * (-1031.244) [-1023.830] (-1028.840) (-1026.581) -- 0:00:36
454000 -- (-1025.950) (-1026.289) (-1026.793) [-1027.930] * [-1026.967] (-1023.554) (-1025.778) (-1031.531) -- 0:00:36
454500 -- (-1025.906) (-1025.803) (-1025.493) [-1029.635] * (-1025.599) [-1023.998] (-1027.143) (-1027.586) -- 0:00:36
455000 -- (-1024.672) (-1026.942) (-1027.250) [-1026.000] * [-1024.408] (-1024.663) (-1027.612) (-1023.283) -- 0:00:35
Average standard deviation of split frequencies: 0.011154
455500 -- (-1025.675) [-1024.974] (-1028.592) (-1027.229) * (-1023.829) [-1022.812] (-1035.145) (-1026.854) -- 0:00:35
456000 -- [-1025.636] (-1025.771) (-1033.888) (-1023.725) * [-1025.677] (-1025.817) (-1027.688) (-1023.568) -- 0:00:35
456500 -- (-1027.591) [-1027.177] (-1032.059) (-1023.671) * (-1025.976) (-1021.713) [-1027.801] (-1027.293) -- 0:00:35
457000 -- [-1034.546] (-1025.979) (-1026.415) (-1027.028) * (-1026.447) (-1023.515) (-1025.388) [-1025.643] -- 0:00:35
457500 -- (-1029.494) [-1025.623] (-1025.603) (-1023.430) * [-1026.119] (-1024.993) (-1027.543) (-1024.786) -- 0:00:35
458000 -- (-1024.973) [-1023.082] (-1029.923) (-1026.758) * [-1024.642] (-1022.674) (-1026.813) (-1024.923) -- 0:00:35
458500 -- (-1026.370) (-1030.224) [-1028.331] (-1026.568) * [-1024.804] (-1023.778) (-1027.822) (-1025.610) -- 0:00:35
459000 -- (-1026.374) (-1024.326) [-1024.747] (-1026.924) * (-1025.562) [-1024.580] (-1023.685) (-1023.578) -- 0:00:35
459500 -- (-1026.524) (-1024.628) [-1024.000] (-1026.376) * (-1025.258) (-1022.895) (-1026.740) [-1023.666] -- 0:00:35
460000 -- (-1027.535) (-1031.760) [-1028.236] (-1025.357) * (-1025.440) (-1022.447) [-1023.749] (-1030.033) -- 0:00:35
Average standard deviation of split frequencies: 0.011472
460500 -- (-1029.235) (-1024.405) [-1024.703] (-1027.501) * (-1025.131) [-1021.902] (-1027.742) (-1032.419) -- 0:00:35
461000 -- (-1023.351) [-1024.557] (-1025.227) (-1027.336) * [-1024.227] (-1022.908) (-1027.250) (-1028.081) -- 0:00:35
461500 -- (-1021.716) (-1025.544) [-1023.993] (-1024.869) * (-1026.275) (-1025.800) [-1023.559] (-1028.952) -- 0:00:35
462000 -- [-1024.699] (-1030.764) (-1024.506) (-1026.631) * (-1024.602) [-1025.497] (-1023.379) (-1027.666) -- 0:00:34
462500 -- (-1021.933) (-1026.124) [-1026.223] (-1027.268) * [-1024.743] (-1025.755) (-1028.147) (-1025.094) -- 0:00:34
463000 -- (-1025.549) (-1026.424) [-1022.212] (-1023.062) * (-1024.252) (-1024.646) (-1025.828) [-1025.195] -- 0:00:34
463500 -- (-1026.605) [-1025.181] (-1023.990) (-1022.990) * [-1022.902] (-1023.946) (-1026.610) (-1025.367) -- 0:00:34
464000 -- [-1025.009] (-1026.547) (-1027.287) (-1027.273) * (-1025.327) (-1024.798) [-1029.965] (-1025.090) -- 0:00:34
464500 -- (-1027.033) (-1026.049) [-1024.624] (-1026.292) * (-1025.233) [-1024.612] (-1024.376) (-1023.780) -- 0:00:34
465000 -- (-1027.641) [-1024.993] (-1028.341) (-1024.341) * (-1023.888) (-1026.925) (-1024.700) [-1022.944] -- 0:00:35
Average standard deviation of split frequencies: 0.011128
465500 -- (-1025.996) (-1026.602) [-1024.485] (-1026.845) * (-1027.048) [-1023.639] (-1026.611) (-1024.104) -- 0:00:35
466000 -- (-1022.654) [-1026.845] (-1025.868) (-1025.095) * [-1027.568] (-1024.023) (-1024.552) (-1025.442) -- 0:00:35
466500 -- (-1024.244) [-1025.410] (-1026.673) (-1026.622) * (-1028.543) [-1027.879] (-1025.474) (-1025.574) -- 0:00:35
467000 -- [-1023.220] (-1027.035) (-1026.168) (-1030.284) * (-1027.532) (-1026.953) [-1025.368] (-1025.947) -- 0:00:35
467500 -- (-1023.603) (-1025.799) (-1024.409) [-1022.355] * (-1027.930) (-1028.223) [-1024.490] (-1027.982) -- 0:00:35
468000 -- (-1027.081) [-1028.111] (-1026.101) (-1025.879) * (-1025.924) (-1026.075) [-1024.906] (-1025.666) -- 0:00:35
468500 -- (-1027.800) (-1025.479) [-1023.244] (-1029.973) * (-1030.871) [-1029.745] (-1023.842) (-1027.738) -- 0:00:35
469000 -- (-1026.864) (-1027.227) [-1026.106] (-1030.185) * (-1028.377) [-1025.050] (-1024.594) (-1025.802) -- 0:00:35
469500 -- [-1024.305] (-1024.436) (-1025.506) (-1026.325) * (-1029.010) (-1028.341) [-1023.610] (-1025.630) -- 0:00:35
470000 -- (-1024.304) [-1023.457] (-1025.804) (-1027.109) * (-1031.695) (-1025.919) [-1027.764] (-1026.214) -- 0:00:34
Average standard deviation of split frequencies: 0.010912
470500 -- (-1027.298) [-1025.254] (-1025.926) (-1028.398) * (-1025.120) (-1024.205) (-1024.497) [-1026.201] -- 0:00:34
471000 -- (-1023.888) (-1024.400) (-1027.047) [-1026.190] * (-1025.464) (-1025.129) [-1025.172] (-1029.103) -- 0:00:34
471500 -- [-1025.935] (-1026.573) (-1027.538) (-1031.155) * [-1024.481] (-1026.308) (-1023.866) (-1027.536) -- 0:00:34
472000 -- (-1026.051) (-1023.634) [-1025.152] (-1031.543) * (-1025.175) (-1028.718) (-1024.620) [-1024.367] -- 0:00:34
472500 -- (-1029.247) (-1024.159) (-1027.786) [-1028.078] * (-1027.165) (-1034.834) [-1023.398] (-1026.214) -- 0:00:34
473000 -- [-1021.812] (-1024.917) (-1024.944) (-1025.578) * (-1027.438) [-1026.798] (-1031.592) (-1025.409) -- 0:00:34
473500 -- [-1023.188] (-1026.070) (-1024.752) (-1026.264) * (-1026.857) [-1029.167] (-1029.297) (-1024.488) -- 0:00:34
474000 -- (-1022.378) (-1025.516) [-1024.658] (-1025.922) * (-1030.232) (-1023.209) [-1026.519] (-1025.383) -- 0:00:34
474500 -- (-1023.744) (-1025.179) [-1025.614] (-1023.661) * [-1026.525] (-1029.904) (-1027.018) (-1024.774) -- 0:00:34
475000 -- (-1024.235) (-1022.940) (-1024.582) [-1025.691] * [-1025.060] (-1032.049) (-1023.659) (-1025.019) -- 0:00:34
Average standard deviation of split frequencies: 0.010008
475500 -- (-1024.826) [-1024.486] (-1027.135) (-1028.490) * (-1024.112) [-1024.390] (-1025.343) (-1022.907) -- 0:00:34
476000 -- (-1023.197) (-1024.175) [-1025.244] (-1026.457) * (-1023.370) [-1026.035] (-1026.162) (-1025.671) -- 0:00:34
476500 -- (-1023.185) (-1027.480) (-1026.165) [-1025.077] * [-1026.657] (-1024.798) (-1027.762) (-1026.371) -- 0:00:34
477000 -- (-1024.587) (-1024.924) [-1026.512] (-1026.588) * (-1023.478) (-1026.167) (-1024.048) [-1024.747] -- 0:00:33
477500 -- (-1031.108) (-1023.672) [-1024.657] (-1024.261) * (-1025.251) (-1023.636) [-1025.548] (-1025.033) -- 0:00:33
478000 -- (-1025.960) (-1025.881) (-1026.312) [-1023.275] * (-1027.245) (-1025.188) (-1023.472) [-1023.721] -- 0:00:33
478500 -- (-1021.742) (-1025.696) [-1024.210] (-1023.442) * (-1025.256) (-1024.859) (-1024.161) [-1024.711] -- 0:00:33
479000 -- (-1029.308) (-1024.028) (-1025.880) [-1029.052] * (-1026.562) (-1026.220) [-1025.627] (-1022.662) -- 0:00:33
479500 -- [-1024.759] (-1026.227) (-1032.612) (-1023.756) * (-1023.479) [-1024.545] (-1029.649) (-1027.410) -- 0:00:33
480000 -- [-1023.203] (-1026.320) (-1026.209) (-1024.738) * (-1030.563) (-1028.274) (-1026.245) [-1027.027] -- 0:00:33
Average standard deviation of split frequencies: 0.010220
480500 -- (-1027.510) [-1022.676] (-1024.921) (-1023.290) * [-1024.144] (-1023.153) (-1029.270) (-1031.222) -- 0:00:34
481000 -- (-1030.029) (-1024.848) (-1024.899) [-1025.159] * [-1022.119] (-1022.924) (-1023.504) (-1027.391) -- 0:00:34
481500 -- (-1029.553) (-1026.111) (-1026.934) [-1027.693] * [-1024.621] (-1023.721) (-1026.355) (-1024.350) -- 0:00:34
482000 -- (-1026.088) [-1024.062] (-1023.629) (-1026.340) * [-1023.486] (-1029.524) (-1028.562) (-1025.865) -- 0:00:34
482500 -- (-1025.339) (-1024.101) (-1030.376) [-1027.485] * (-1024.350) [-1028.328] (-1023.451) (-1026.678) -- 0:00:34
483000 -- (-1025.332) [-1026.379] (-1026.037) (-1025.928) * [-1025.215] (-1023.950) (-1024.558) (-1028.070) -- 0:00:34
483500 -- (-1024.988) (-1024.533) (-1024.553) [-1026.705] * (-1023.173) (-1025.083) [-1023.724] (-1025.228) -- 0:00:34
484000 -- (-1025.820) (-1025.509) [-1025.118] (-1026.011) * [-1023.147] (-1023.947) (-1028.304) (-1024.888) -- 0:00:34
484500 -- [-1024.552] (-1029.147) (-1024.397) (-1024.440) * (-1028.903) (-1026.526) (-1026.505) [-1024.891] -- 0:00:34
485000 -- (-1027.151) [-1023.102] (-1030.053) (-1027.492) * (-1027.595) (-1024.488) (-1027.019) [-1027.876] -- 0:00:33
Average standard deviation of split frequencies: 0.009802
485500 -- (-1025.956) [-1023.141] (-1027.717) (-1025.293) * (-1024.043) [-1022.451] (-1029.690) (-1025.652) -- 0:00:33
486000 -- (-1026.752) (-1024.340) [-1022.895] (-1028.086) * (-1026.892) [-1024.827] (-1029.410) (-1024.539) -- 0:00:33
486500 -- (-1025.987) (-1025.390) (-1026.220) [-1025.772] * (-1023.918) [-1024.950] (-1031.202) (-1025.183) -- 0:00:33
487000 -- (-1022.618) [-1023.236] (-1023.603) (-1025.931) * [-1025.174] (-1028.794) (-1029.764) (-1028.073) -- 0:00:33
487500 -- (-1025.256) (-1023.512) [-1023.491] (-1027.606) * [-1025.308] (-1026.760) (-1025.867) (-1027.400) -- 0:00:33
488000 -- (-1025.684) (-1023.341) [-1025.813] (-1033.039) * (-1027.664) (-1026.507) [-1026.945] (-1027.633) -- 0:00:33
488500 -- (-1026.858) (-1024.485) [-1026.883] (-1032.506) * (-1025.067) [-1024.452] (-1025.815) (-1027.439) -- 0:00:33
489000 -- (-1024.833) [-1025.394] (-1024.996) (-1031.045) * [-1023.234] (-1024.238) (-1024.402) (-1024.187) -- 0:00:33
489500 -- [-1025.645] (-1024.284) (-1026.690) (-1027.274) * (-1023.299) [-1024.656] (-1024.263) (-1023.991) -- 0:00:33
490000 -- [-1026.164] (-1023.778) (-1027.462) (-1027.942) * (-1025.307) [-1028.085] (-1024.691) (-1024.712) -- 0:00:33
Average standard deviation of split frequencies: 0.009810
490500 -- [-1026.144] (-1025.163) (-1024.939) (-1028.122) * (-1025.544) [-1024.969] (-1026.314) (-1024.366) -- 0:00:33
491000 -- [-1021.951] (-1028.600) (-1024.059) (-1025.214) * [-1023.235] (-1024.375) (-1024.954) (-1024.116) -- 0:00:33
491500 -- (-1029.917) (-1030.008) (-1025.389) [-1025.154] * [-1028.400] (-1023.884) (-1027.577) (-1033.358) -- 0:00:33
492000 -- (-1024.584) (-1028.855) [-1025.075] (-1024.414) * (-1027.273) [-1024.263] (-1025.871) (-1028.701) -- 0:00:33
492500 -- (-1024.242) (-1023.642) (-1027.591) [-1027.125] * (-1025.432) [-1024.825] (-1027.646) (-1028.056) -- 0:00:32
493000 -- (-1026.423) (-1022.513) (-1024.472) [-1024.722] * (-1023.541) (-1023.038) (-1027.722) [-1025.079] -- 0:00:32
493500 -- [-1023.691] (-1024.074) (-1025.022) (-1025.874) * (-1024.710) [-1025.910] (-1028.287) (-1024.348) -- 0:00:32
494000 -- (-1026.806) (-1026.705) [-1024.916] (-1024.421) * (-1026.301) [-1025.193] (-1029.040) (-1025.412) -- 0:00:32
494500 -- (-1028.443) [-1023.182] (-1029.924) (-1028.309) * (-1028.475) (-1027.058) (-1025.267) [-1025.560] -- 0:00:32
495000 -- [-1024.921] (-1024.770) (-1025.474) (-1027.604) * [-1024.484] (-1024.999) (-1026.073) (-1027.228) -- 0:00:32
Average standard deviation of split frequencies: 0.009554
495500 -- (-1027.617) (-1025.217) (-1026.204) [-1030.074] * (-1023.346) (-1026.337) [-1025.837] (-1026.486) -- 0:00:33
496000 -- (-1028.693) [-1024.943] (-1025.268) (-1028.936) * [-1023.612] (-1023.620) (-1029.155) (-1022.938) -- 0:00:33
496500 -- [-1025.098] (-1025.278) (-1024.753) (-1025.447) * (-1027.045) [-1022.923] (-1024.729) (-1025.986) -- 0:00:33
497000 -- [-1022.393] (-1023.879) (-1024.785) (-1024.385) * (-1024.331) (-1026.909) [-1024.379] (-1026.690) -- 0:00:33
497500 -- [-1023.974] (-1026.268) (-1026.681) (-1025.854) * [-1027.954] (-1027.141) (-1028.479) (-1024.876) -- 0:00:33
498000 -- (-1022.435) [-1026.100] (-1025.170) (-1023.767) * (-1031.153) [-1028.340] (-1025.205) (-1025.598) -- 0:00:33
498500 -- (-1023.388) (-1024.144) [-1027.378] (-1025.791) * (-1025.395) (-1027.092) (-1022.850) [-1024.634] -- 0:00:33
499000 -- (-1025.797) (-1023.030) (-1027.382) [-1025.939] * (-1025.145) (-1024.541) [-1023.462] (-1024.916) -- 0:00:33
499500 -- [-1023.234] (-1023.258) (-1025.547) (-1026.352) * (-1027.111) (-1024.619) (-1028.319) [-1025.195] -- 0:00:33
500000 -- [-1022.603] (-1027.972) (-1025.575) (-1026.036) * [-1023.276] (-1025.841) (-1026.216) (-1023.745) -- 0:00:33
Average standard deviation of split frequencies: 0.010451
500500 -- [-1024.452] (-1025.210) (-1025.564) (-1024.634) * (-1024.635) (-1025.218) (-1025.696) [-1024.568] -- 0:00:32
501000 -- (-1023.605) (-1022.830) [-1023.077] (-1025.443) * [-1026.524] (-1027.128) (-1026.717) (-1023.214) -- 0:00:32
501500 -- (-1025.437) (-1023.832) (-1026.028) [-1025.290] * (-1025.278) (-1025.656) (-1024.136) [-1023.485] -- 0:00:32
502000 -- [-1024.050] (-1024.964) (-1024.623) (-1026.422) * (-1037.672) (-1024.994) (-1025.128) [-1024.708] -- 0:00:32
502500 -- (-1025.365) (-1025.131) [-1022.289] (-1025.453) * (-1029.961) (-1028.853) (-1026.682) [-1026.752] -- 0:00:32
503000 -- (-1025.434) (-1023.475) [-1024.871] (-1026.451) * (-1027.188) (-1025.875) [-1024.623] (-1023.156) -- 0:00:32
503500 -- (-1024.556) (-1026.696) (-1033.374) [-1027.082] * [-1026.057] (-1025.471) (-1028.801) (-1025.479) -- 0:00:32
504000 -- (-1024.307) (-1025.644) [-1024.248] (-1024.562) * (-1026.126) (-1026.568) (-1025.055) [-1024.455] -- 0:00:32
504500 -- (-1023.639) [-1024.406] (-1026.234) (-1023.525) * [-1025.359] (-1030.139) (-1026.422) (-1024.631) -- 0:00:32
505000 -- [-1022.881] (-1025.343) (-1025.937) (-1024.805) * (-1026.099) (-1032.481) (-1025.137) [-1025.109] -- 0:00:32
Average standard deviation of split frequencies: 0.011040
505500 -- (-1025.562) (-1023.199) [-1026.049] (-1025.005) * (-1024.122) (-1032.350) [-1024.496] (-1024.689) -- 0:00:32
506000 -- [-1026.828] (-1022.952) (-1025.280) (-1026.490) * (-1026.245) [-1025.922] (-1025.882) (-1026.739) -- 0:00:32
506500 -- [-1024.498] (-1022.466) (-1025.567) (-1027.219) * (-1024.611) [-1025.612] (-1024.262) (-1025.260) -- 0:00:32
507000 -- (-1025.579) [-1022.639] (-1028.352) (-1026.703) * (-1028.748) [-1026.279] (-1026.296) (-1027.008) -- 0:00:32
507500 -- [-1023.446] (-1022.907) (-1027.470) (-1029.113) * (-1026.827) [-1026.240] (-1026.449) (-1024.851) -- 0:00:32
508000 -- [-1025.532] (-1024.082) (-1025.802) (-1028.106) * (-1024.621) (-1027.291) [-1028.811] (-1025.849) -- 0:00:31
508500 -- [-1023.873] (-1026.730) (-1023.995) (-1029.582) * (-1034.417) [-1025.603] (-1029.737) (-1029.467) -- 0:00:31
509000 -- (-1023.559) (-1025.825) [-1023.112] (-1025.739) * (-1025.095) [-1025.812] (-1027.376) (-1028.609) -- 0:00:31
509500 -- (-1022.096) [-1028.054] (-1025.928) (-1026.635) * [-1026.228] (-1024.158) (-1025.687) (-1029.160) -- 0:00:31
510000 -- [-1024.461] (-1026.178) (-1024.527) (-1024.773) * (-1025.416) (-1026.735) [-1026.054] (-1026.736) -- 0:00:31
Average standard deviation of split frequencies: 0.010718
510500 -- (-1027.121) (-1027.421) [-1026.148] (-1024.601) * [-1026.723] (-1028.764) (-1026.816) (-1023.280) -- 0:00:32
511000 -- (-1023.243) (-1030.754) (-1024.888) [-1027.471] * (-1025.279) (-1025.659) [-1022.455] (-1026.395) -- 0:00:32
511500 -- (-1022.676) [-1024.553] (-1027.622) (-1026.675) * [-1027.086] (-1026.921) (-1025.255) (-1026.133) -- 0:00:32
512000 -- [-1026.909] (-1026.360) (-1024.529) (-1024.546) * [-1027.817] (-1028.394) (-1023.382) (-1026.813) -- 0:00:32
512500 -- (-1027.113) (-1025.089) [-1027.208] (-1026.090) * (-1026.143) (-1027.722) (-1025.478) [-1027.152] -- 0:00:32
513000 -- (-1025.316) (-1027.002) (-1022.269) [-1024.463] * [-1025.360] (-1025.662) (-1025.145) (-1023.671) -- 0:00:32
513500 -- (-1022.858) (-1024.868) [-1024.938] (-1026.660) * [-1025.827] (-1023.332) (-1024.559) (-1028.530) -- 0:00:32
514000 -- [-1026.760] (-1025.413) (-1027.106) (-1028.231) * (-1027.972) [-1025.280] (-1026.826) (-1025.145) -- 0:00:32
514500 -- (-1023.813) (-1026.938) [-1024.428] (-1028.160) * (-1024.526) [-1026.508] (-1027.834) (-1024.648) -- 0:00:32
515000 -- (-1026.621) (-1031.609) (-1025.877) [-1027.180] * [-1025.512] (-1027.319) (-1024.163) (-1025.531) -- 0:00:32
Average standard deviation of split frequencies: 0.011673
515500 -- (-1026.596) (-1028.950) (-1023.726) [-1025.217] * (-1026.952) (-1026.396) (-1024.557) [-1023.080] -- 0:00:31
516000 -- [-1025.120] (-1023.789) (-1023.385) (-1026.691) * (-1029.009) (-1022.880) [-1025.543] (-1026.475) -- 0:00:31
516500 -- (-1026.614) [-1023.928] (-1025.755) (-1026.500) * [-1025.108] (-1024.898) (-1023.733) (-1024.899) -- 0:00:31
517000 -- [-1025.551] (-1027.516) (-1026.004) (-1024.068) * (-1026.610) [-1025.333] (-1023.193) (-1023.420) -- 0:00:31
517500 -- (-1026.737) (-1025.729) (-1025.090) [-1027.298] * (-1023.721) [-1025.154] (-1025.004) (-1023.361) -- 0:00:31
518000 -- [-1022.810] (-1025.006) (-1029.217) (-1025.946) * [-1023.287] (-1024.431) (-1026.867) (-1030.335) -- 0:00:31
518500 -- (-1025.721) (-1023.580) (-1026.335) [-1023.668] * (-1026.282) (-1024.068) [-1025.627] (-1026.680) -- 0:00:31
519000 -- [-1023.554] (-1025.359) (-1025.687) (-1024.610) * (-1027.370) (-1024.895) (-1024.483) [-1022.518] -- 0:00:31
519500 -- [-1026.469] (-1027.027) (-1023.736) (-1030.597) * [-1023.943] (-1024.948) (-1023.127) (-1030.275) -- 0:00:31
520000 -- [-1023.723] (-1027.901) (-1023.745) (-1027.559) * (-1026.382) (-1026.718) [-1024.871] (-1028.617) -- 0:00:31
Average standard deviation of split frequencies: 0.011921
520500 -- (-1023.323) [-1024.902] (-1030.476) (-1025.023) * (-1025.204) (-1024.509) (-1023.275) [-1026.653] -- 0:00:31
521000 -- (-1025.341) [-1025.256] (-1029.380) (-1027.053) * (-1025.437) (-1026.322) (-1024.315) [-1026.690] -- 0:00:31
521500 -- [-1024.583] (-1025.185) (-1031.212) (-1027.934) * [-1024.210] (-1023.623) (-1029.244) (-1027.860) -- 0:00:31
522000 -- (-1025.167) [-1024.896] (-1023.520) (-1026.963) * (-1024.557) (-1026.250) [-1024.472] (-1027.768) -- 0:00:31
522500 -- (-1028.329) (-1024.098) (-1028.988) [-1025.089] * (-1025.822) [-1023.230] (-1025.338) (-1023.193) -- 0:00:31
523000 -- (-1025.567) (-1023.404) (-1026.709) [-1026.160] * (-1025.596) (-1029.339) [-1023.711] (-1023.417) -- 0:00:31
523500 -- [-1030.567] (-1029.321) (-1023.958) (-1027.418) * (-1026.923) [-1021.864] (-1025.403) (-1024.441) -- 0:00:30
524000 -- [-1022.893] (-1025.192) (-1022.705) (-1030.362) * (-1026.410) (-1023.241) [-1025.035] (-1027.511) -- 0:00:30
524500 -- (-1024.653) (-1026.087) [-1026.084] (-1026.098) * [-1026.433] (-1022.007) (-1028.277) (-1029.687) -- 0:00:30
525000 -- (-1028.065) (-1028.407) [-1034.704] (-1026.093) * [-1023.426] (-1024.425) (-1026.406) (-1031.260) -- 0:00:30
Average standard deviation of split frequencies: 0.011900
525500 -- (-1025.541) [-1023.655] (-1025.988) (-1025.322) * [-1024.136] (-1026.193) (-1024.949) (-1030.440) -- 0:00:30
526000 -- (-1027.125) (-1025.468) [-1023.567] (-1025.786) * (-1024.366) (-1024.679) [-1024.921] (-1028.315) -- 0:00:31
526500 -- (-1027.203) [-1029.141] (-1025.890) (-1026.367) * (-1024.564) [-1023.900] (-1025.740) (-1026.508) -- 0:00:31
527000 -- (-1027.069) [-1026.137] (-1025.023) (-1026.294) * (-1025.522) (-1026.078) [-1022.940] (-1024.016) -- 0:00:31
527500 -- (-1023.955) [-1026.623] (-1025.142) (-1026.787) * (-1025.130) [-1023.835] (-1026.522) (-1027.973) -- 0:00:31
528000 -- [-1023.095] (-1025.137) (-1027.423) (-1027.368) * (-1024.233) (-1033.405) (-1024.641) [-1024.984] -- 0:00:31
528500 -- (-1025.133) (-1024.734) [-1028.071] (-1024.504) * (-1024.464) [-1027.550] (-1025.224) (-1023.565) -- 0:00:31
529000 -- (-1027.943) (-1024.050) [-1027.983] (-1027.641) * [-1024.416] (-1024.411) (-1025.320) (-1029.429) -- 0:00:31
529500 -- (-1029.189) (-1024.802) [-1023.561] (-1027.884) * (-1024.508) (-1029.676) [-1023.241] (-1030.801) -- 0:00:31
530000 -- [-1025.262] (-1023.703) (-1027.120) (-1026.716) * (-1023.071) (-1027.107) [-1027.111] (-1025.418) -- 0:00:31
Average standard deviation of split frequencies: 0.011153
530500 -- (-1027.933) [-1024.787] (-1027.347) (-1025.105) * (-1026.356) (-1023.942) (-1024.617) [-1025.671] -- 0:00:30
531000 -- [-1027.390] (-1024.146) (-1025.110) (-1025.549) * (-1023.410) (-1023.485) (-1022.874) [-1029.925] -- 0:00:30
531500 -- (-1026.318) [-1023.178] (-1025.388) (-1024.424) * (-1023.934) [-1026.916] (-1023.343) (-1026.944) -- 0:00:30
532000 -- [-1026.374] (-1028.541) (-1027.422) (-1026.674) * (-1024.749) (-1025.283) [-1029.154] (-1030.234) -- 0:00:30
532500 -- (-1025.816) (-1023.862) (-1029.626) [-1025.087] * [-1023.643] (-1023.246) (-1033.716) (-1026.267) -- 0:00:30
533000 -- [-1025.042] (-1028.472) (-1023.570) (-1025.786) * (-1027.317) [-1024.938] (-1024.741) (-1026.412) -- 0:00:30
533500 -- (-1026.264) [-1025.336] (-1023.179) (-1025.046) * (-1032.962) [-1022.198] (-1025.413) (-1027.291) -- 0:00:30
534000 -- (-1025.926) [-1026.671] (-1024.397) (-1027.522) * [-1032.219] (-1025.068) (-1024.535) (-1026.352) -- 0:00:30
534500 -- (-1026.239) [-1023.468] (-1031.654) (-1026.916) * (-1027.911) (-1025.104) (-1028.314) [-1025.270] -- 0:00:30
535000 -- [-1022.896] (-1023.738) (-1031.601) (-1024.427) * (-1024.730) (-1024.347) [-1022.952] (-1026.569) -- 0:00:30
Average standard deviation of split frequencies: 0.011175
535500 -- (-1024.612) (-1023.885) [-1027.129] (-1027.284) * [-1023.085] (-1021.786) (-1023.464) (-1028.783) -- 0:00:30
536000 -- [-1027.366] (-1022.943) (-1025.671) (-1025.451) * (-1024.494) [-1022.416] (-1022.719) (-1025.538) -- 0:00:30
536500 -- (-1025.598) (-1024.146) [-1023.182] (-1025.917) * (-1023.979) [-1023.504] (-1028.338) (-1025.279) -- 0:00:30
537000 -- (-1029.003) [-1024.356] (-1024.201) (-1025.771) * (-1029.111) (-1031.139) [-1026.896] (-1025.750) -- 0:00:30
537500 -- (-1026.052) (-1026.581) (-1024.613) [-1026.189] * (-1026.381) (-1024.663) (-1025.250) [-1023.942] -- 0:00:30
538000 -- [-1025.439] (-1026.275) (-1024.563) (-1025.333) * (-1023.447) (-1025.321) [-1026.367] (-1028.281) -- 0:00:30
538500 -- [-1023.614] (-1024.334) (-1024.585) (-1031.371) * (-1027.254) (-1023.211) [-1025.005] (-1026.455) -- 0:00:29
539000 -- (-1028.126) (-1024.565) (-1026.413) [-1026.345] * [-1023.958] (-1026.936) (-1022.697) (-1024.813) -- 0:00:29
539500 -- (-1024.825) (-1025.129) (-1025.288) [-1025.658] * [-1024.241] (-1025.956) (-1026.286) (-1025.128) -- 0:00:29
540000 -- (-1024.558) [-1025.117] (-1022.842) (-1029.899) * (-1025.676) (-1026.367) [-1022.641] (-1025.440) -- 0:00:29
Average standard deviation of split frequencies: 0.010719
540500 -- (-1025.955) (-1024.102) [-1027.569] (-1030.446) * (-1028.162) (-1023.855) [-1024.681] (-1022.975) -- 0:00:29
541000 -- [-1024.769] (-1023.868) (-1027.980) (-1025.446) * (-1025.261) [-1024.142] (-1025.739) (-1024.584) -- 0:00:29
541500 -- [-1024.660] (-1028.342) (-1024.185) (-1025.342) * (-1023.330) [-1027.993] (-1023.838) (-1024.436) -- 0:00:30
542000 -- [-1025.490] (-1025.599) (-1024.438) (-1025.820) * [-1025.145] (-1026.709) (-1024.621) (-1025.403) -- 0:00:30
542500 -- [-1025.410] (-1026.469) (-1024.697) (-1024.841) * (-1026.889) (-1026.057) (-1025.337) [-1026.853] -- 0:00:30
543000 -- (-1025.710) (-1027.462) (-1024.544) [-1022.380] * (-1025.793) (-1023.634) (-1028.155) [-1024.860] -- 0:00:30
543500 -- [-1027.225] (-1024.715) (-1027.554) (-1026.488) * (-1025.026) (-1024.966) [-1023.836] (-1028.787) -- 0:00:30
544000 -- (-1027.885) [-1026.803] (-1024.866) (-1024.323) * [-1025.748] (-1027.928) (-1023.872) (-1026.237) -- 0:00:30
544500 -- (-1026.210) (-1029.204) [-1025.330] (-1025.658) * (-1026.878) (-1026.985) [-1024.556] (-1027.787) -- 0:00:30
545000 -- (-1026.332) (-1026.153) (-1023.563) [-1023.975] * (-1025.439) (-1026.931) (-1024.623) [-1024.527] -- 0:00:30
Average standard deviation of split frequencies: 0.011752
545500 -- (-1025.121) (-1026.627) (-1024.689) [-1023.981] * (-1027.464) (-1025.373) [-1025.997] (-1024.221) -- 0:00:29
546000 -- (-1025.388) (-1024.565) [-1026.218] (-1024.893) * (-1025.022) [-1027.000] (-1025.375) (-1024.784) -- 0:00:29
546500 -- [-1024.854] (-1026.819) (-1030.025) (-1026.177) * (-1027.810) (-1027.345) (-1026.580) [-1025.097] -- 0:00:29
547000 -- [-1024.779] (-1024.763) (-1026.394) (-1025.488) * (-1023.938) [-1024.861] (-1024.178) (-1024.163) -- 0:00:29
547500 -- (-1026.415) (-1023.483) (-1024.890) [-1025.249] * (-1025.367) [-1025.040] (-1025.048) (-1024.989) -- 0:00:29
548000 -- (-1026.194) (-1027.196) (-1025.580) [-1026.496] * (-1030.627) [-1026.350] (-1026.909) (-1024.839) -- 0:00:29
548500 -- (-1027.467) (-1022.550) [-1025.056] (-1024.699) * (-1025.813) (-1028.443) [-1024.763] (-1025.411) -- 0:00:29
549000 -- (-1025.178) (-1026.850) [-1028.521] (-1022.971) * (-1027.671) (-1027.129) [-1023.587] (-1024.488) -- 0:00:29
549500 -- [-1022.331] (-1026.054) (-1029.304) (-1026.520) * [-1026.835] (-1025.188) (-1024.095) (-1024.583) -- 0:00:29
550000 -- (-1025.217) (-1023.747) (-1025.834) [-1025.126] * [-1021.475] (-1023.743) (-1023.355) (-1024.789) -- 0:00:29
Average standard deviation of split frequencies: 0.011509
550500 -- [-1025.135] (-1024.346) (-1022.635) (-1024.446) * (-1025.612) [-1024.163] (-1025.645) (-1028.770) -- 0:00:29
551000 -- [-1024.408] (-1022.085) (-1024.987) (-1024.052) * (-1022.986) (-1024.604) [-1024.608] (-1025.976) -- 0:00:29
551500 -- (-1023.120) (-1024.979) [-1024.103] (-1025.116) * (-1024.581) (-1026.444) [-1023.938] (-1027.913) -- 0:00:29
552000 -- (-1024.692) [-1024.607] (-1024.778) (-1025.958) * (-1025.528) (-1030.009) (-1024.258) [-1025.549] -- 0:00:29
552500 -- (-1025.372) (-1023.406) [-1024.852] (-1026.404) * (-1024.002) (-1027.792) (-1029.364) [-1023.405] -- 0:00:29
553000 -- (-1027.277) [-1026.670] (-1026.203) (-1023.052) * (-1022.708) (-1027.932) (-1027.333) [-1027.523] -- 0:00:29
553500 -- (-1026.666) (-1026.216) [-1023.937] (-1023.699) * [-1025.083] (-1025.203) (-1025.746) (-1027.918) -- 0:00:29
554000 -- [-1025.773] (-1025.275) (-1024.092) (-1024.636) * (-1026.090) [-1025.555] (-1025.127) (-1025.913) -- 0:00:28
554500 -- (-1025.310) (-1027.076) (-1028.541) [-1026.344] * (-1025.723) [-1024.663] (-1024.713) (-1026.167) -- 0:00:28
555000 -- (-1025.631) [-1025.454] (-1027.038) (-1024.479) * (-1022.987) [-1026.467] (-1025.873) (-1026.455) -- 0:00:28
Average standard deviation of split frequencies: 0.011776
555500 -- [-1027.379] (-1023.700) (-1028.196) (-1023.245) * [-1024.890] (-1026.411) (-1027.272) (-1023.209) -- 0:00:28
556000 -- [-1028.084] (-1023.731) (-1023.472) (-1022.515) * (-1023.887) (-1024.795) (-1027.053) [-1024.256] -- 0:00:28
556500 -- (-1026.037) [-1024.295] (-1025.366) (-1024.360) * (-1027.749) [-1024.933] (-1027.670) (-1025.344) -- 0:00:29
557000 -- (-1024.572) (-1028.630) [-1023.188] (-1026.253) * (-1025.752) (-1025.366) [-1027.882] (-1024.147) -- 0:00:29
557500 -- (-1024.152) (-1024.691) (-1022.512) [-1025.560] * [-1026.756] (-1026.185) (-1027.857) (-1024.156) -- 0:00:29
558000 -- (-1024.446) (-1024.586) (-1025.473) [-1026.151] * (-1026.948) [-1026.127] (-1023.764) (-1025.375) -- 0:00:29
558500 -- [-1024.322] (-1026.835) (-1022.465) (-1022.065) * (-1022.043) (-1025.201) [-1026.160] (-1027.333) -- 0:00:29
559000 -- (-1026.671) (-1023.928) (-1024.090) [-1021.585] * (-1025.503) (-1026.499) [-1025.707] (-1027.602) -- 0:00:29
559500 -- (-1026.155) [-1023.913] (-1024.778) (-1024.001) * (-1025.894) (-1036.292) (-1024.923) [-1024.237] -- 0:00:29
560000 -- (-1026.970) (-1029.405) (-1030.033) [-1022.654] * [-1025.729] (-1026.801) (-1027.135) (-1025.718) -- 0:00:29
Average standard deviation of split frequencies: 0.011865
560500 -- [-1026.532] (-1027.339) (-1026.685) (-1022.505) * (-1024.351) (-1023.750) [-1026.667] (-1024.317) -- 0:00:29
561000 -- (-1026.652) [-1024.511] (-1026.809) (-1025.568) * [-1023.887] (-1026.049) (-1027.133) (-1024.358) -- 0:00:28
561500 -- [-1024.205] (-1027.032) (-1025.882) (-1026.518) * (-1025.520) (-1024.734) (-1023.689) [-1025.035] -- 0:00:28
562000 -- (-1027.717) (-1029.139) (-1027.065) [-1027.380] * (-1028.505) [-1024.223] (-1023.894) (-1029.893) -- 0:00:28
562500 -- [-1023.976] (-1024.574) (-1023.368) (-1026.639) * (-1025.736) (-1025.084) (-1025.559) [-1031.560] -- 0:00:28
563000 -- [-1024.650] (-1025.347) (-1024.512) (-1025.910) * [-1026.058] (-1025.338) (-1023.397) (-1026.395) -- 0:00:28
563500 -- (-1023.524) (-1025.430) [-1025.433] (-1022.892) * (-1027.335) (-1024.157) (-1030.249) [-1022.971] -- 0:00:28
564000 -- [-1024.325] (-1026.384) (-1026.314) (-1028.233) * (-1024.330) (-1024.384) (-1025.444) [-1025.430] -- 0:00:28
564500 -- [-1027.164] (-1024.450) (-1025.124) (-1026.494) * (-1025.142) (-1025.079) (-1025.060) [-1025.585] -- 0:00:28
565000 -- (-1027.549) (-1024.635) [-1027.272] (-1024.511) * (-1026.314) (-1027.228) (-1025.108) [-1024.845] -- 0:00:28
Average standard deviation of split frequencies: 0.011938
565500 -- [-1024.164] (-1026.176) (-1027.305) (-1024.930) * (-1028.854) (-1027.676) [-1024.857] (-1024.130) -- 0:00:28
566000 -- (-1029.785) [-1026.721] (-1028.177) (-1025.539) * (-1025.383) (-1024.446) (-1027.362) [-1023.118] -- 0:00:28
566500 -- (-1027.309) (-1027.343) (-1028.995) [-1025.742] * [-1025.570] (-1024.489) (-1028.690) (-1023.071) -- 0:00:28
567000 -- (-1023.296) (-1024.463) [-1025.098] (-1025.867) * (-1027.541) [-1025.584] (-1026.009) (-1024.143) -- 0:00:28
567500 -- (-1027.300) (-1024.684) (-1028.752) [-1025.982] * [-1028.311] (-1024.595) (-1027.421) (-1026.872) -- 0:00:28
568000 -- [-1026.434] (-1022.146) (-1027.671) (-1027.130) * (-1026.218) [-1029.997] (-1027.086) (-1024.038) -- 0:00:28
568500 -- (-1025.578) [-1024.133] (-1021.798) (-1027.724) * (-1023.883) [-1022.321] (-1023.389) (-1026.317) -- 0:00:28
569000 -- (-1028.068) [-1023.014] (-1025.614) (-1026.189) * (-1029.664) [-1023.476] (-1027.796) (-1026.643) -- 0:00:28
569500 -- (-1026.736) [-1026.891] (-1024.888) (-1027.082) * (-1028.801) (-1023.979) (-1024.479) [-1024.540] -- 0:00:27
570000 -- [-1027.137] (-1027.561) (-1023.522) (-1030.550) * [-1027.195] (-1029.306) (-1025.179) (-1025.250) -- 0:00:27
Average standard deviation of split frequencies: 0.011886
570500 -- (-1029.393) (-1030.861) (-1025.072) [-1026.437] * (-1029.104) (-1023.041) (-1025.791) [-1025.176] -- 0:00:27
571000 -- [-1022.518] (-1027.509) (-1024.280) (-1023.353) * (-1026.430) [-1024.448] (-1025.165) (-1026.192) -- 0:00:27
571500 -- [-1024.371] (-1031.373) (-1023.331) (-1025.412) * [-1026.524] (-1024.118) (-1026.467) (-1025.758) -- 0:00:28
572000 -- [-1024.820] (-1029.232) (-1020.944) (-1024.651) * (-1029.259) (-1026.558) [-1027.248] (-1024.905) -- 0:00:28
572500 -- [-1027.591] (-1026.349) (-1022.415) (-1031.638) * [-1025.990] (-1027.159) (-1030.191) (-1024.166) -- 0:00:28
573000 -- [-1026.390] (-1023.417) (-1024.010) (-1025.900) * (-1028.101) [-1024.891] (-1030.555) (-1024.033) -- 0:00:28
573500 -- [-1024.636] (-1023.787) (-1022.041) (-1024.699) * (-1024.952) [-1023.809] (-1026.502) (-1026.033) -- 0:00:28
574000 -- (-1026.032) (-1028.106) [-1028.447] (-1024.535) * [-1026.337] (-1025.231) (-1025.465) (-1033.229) -- 0:00:28
574500 -- [-1024.742] (-1029.121) (-1025.976) (-1026.040) * (-1030.621) [-1024.844] (-1028.148) (-1032.335) -- 0:00:28
575000 -- (-1023.659) (-1028.897) (-1025.881) [-1026.219] * [-1024.582] (-1027.003) (-1024.106) (-1024.748) -- 0:00:28
Average standard deviation of split frequencies: 0.011361
575500 -- (-1025.103) [-1033.000] (-1030.910) (-1028.298) * (-1025.237) (-1028.891) [-1024.868] (-1024.561) -- 0:00:28
576000 -- (-1027.314) [-1022.735] (-1023.600) (-1030.631) * (-1024.257) (-1025.962) [-1025.008] (-1024.392) -- 0:00:27
576500 -- [-1027.747] (-1025.420) (-1024.792) (-1025.354) * (-1027.951) (-1028.597) [-1027.266] (-1027.488) -- 0:00:27
577000 -- (-1025.941) [-1024.637] (-1023.607) (-1026.195) * (-1025.125) (-1026.770) [-1022.689] (-1023.524) -- 0:00:27
577500 -- (-1024.830) (-1024.752) (-1024.927) [-1023.759] * (-1025.643) (-1024.118) (-1026.513) [-1026.257] -- 0:00:27
578000 -- [-1026.808] (-1030.983) (-1025.169) (-1024.607) * (-1026.032) [-1023.843] (-1025.985) (-1024.642) -- 0:00:27
578500 -- [-1027.955] (-1029.504) (-1024.862) (-1023.580) * (-1027.483) (-1031.326) [-1023.852] (-1022.574) -- 0:00:27
579000 -- [-1024.867] (-1026.878) (-1024.194) (-1024.796) * (-1025.644) [-1030.645] (-1028.179) (-1022.353) -- 0:00:27
579500 -- (-1024.388) (-1024.013) (-1023.898) [-1025.149] * (-1024.272) (-1026.486) [-1023.824] (-1024.168) -- 0:00:27
580000 -- (-1024.047) (-1025.860) [-1023.248] (-1024.813) * (-1023.954) (-1036.603) (-1025.387) [-1022.013] -- 0:00:27
Average standard deviation of split frequencies: 0.010655
580500 -- [-1023.129] (-1026.726) (-1023.750) (-1025.944) * (-1023.715) [-1022.513] (-1025.912) (-1024.543) -- 0:00:27
581000 -- (-1025.617) (-1025.761) [-1026.791] (-1026.313) * [-1024.292] (-1025.883) (-1028.644) (-1032.221) -- 0:00:27
581500 -- (-1026.259) (-1022.544) [-1026.388] (-1024.070) * (-1026.032) (-1026.199) [-1027.391] (-1029.965) -- 0:00:27
582000 -- (-1025.241) [-1023.563] (-1024.701) (-1025.505) * (-1027.775) [-1023.826] (-1024.317) (-1024.340) -- 0:00:27
582500 -- (-1026.260) [-1024.851] (-1023.463) (-1025.026) * (-1027.220) (-1025.031) [-1026.686] (-1026.421) -- 0:00:27
583000 -- (-1025.405) (-1025.560) (-1029.730) [-1023.639] * (-1027.427) (-1024.632) (-1024.448) [-1024.307] -- 0:00:27
583500 -- (-1028.786) (-1023.397) (-1025.232) [-1023.109] * (-1023.877) [-1026.549] (-1024.091) (-1022.462) -- 0:00:27
584000 -- (-1025.784) [-1024.592] (-1029.972) (-1024.231) * (-1025.705) (-1025.861) [-1024.316] (-1023.011) -- 0:00:27
584500 -- [-1025.860] (-1022.739) (-1026.892) (-1026.284) * (-1027.515) (-1024.144) (-1022.629) [-1023.124] -- 0:00:27
585000 -- (-1025.251) (-1025.647) [-1024.631] (-1024.057) * [-1025.847] (-1024.679) (-1025.516) (-1027.792) -- 0:00:26
Average standard deviation of split frequencies: 0.010609
585500 -- (-1023.434) [-1023.172] (-1023.539) (-1024.405) * [-1026.522] (-1023.642) (-1025.250) (-1027.308) -- 0:00:26
586000 -- (-1023.751) (-1024.917) (-1023.738) [-1022.892] * (-1026.085) [-1024.627] (-1026.430) (-1026.152) -- 0:00:26
586500 -- (-1025.589) [-1025.197] (-1028.754) (-1027.778) * (-1026.080) (-1026.988) (-1026.244) [-1024.396] -- 0:00:26
587000 -- (-1026.534) [-1024.898] (-1026.155) (-1024.623) * (-1027.850) (-1025.820) [-1024.155] (-1022.892) -- 0:00:27
587500 -- [-1023.271] (-1022.588) (-1028.909) (-1022.891) * (-1022.794) (-1025.727) (-1025.537) [-1028.111] -- 0:00:27
588000 -- (-1024.365) [-1024.455] (-1023.085) (-1024.441) * (-1024.948) (-1025.764) (-1024.608) [-1022.916] -- 0:00:27
588500 -- (-1027.904) (-1023.833) (-1024.470) [-1025.078] * (-1025.095) (-1023.571) [-1023.409] (-1022.995) -- 0:00:27
589000 -- (-1031.149) (-1023.193) (-1031.452) [-1021.881] * (-1026.071) (-1024.329) [-1026.765] (-1025.640) -- 0:00:27
589500 -- (-1024.709) [-1025.343] (-1027.125) (-1023.826) * [-1027.597] (-1024.991) (-1024.084) (-1024.382) -- 0:00:27
590000 -- (-1029.129) (-1024.865) (-1025.901) [-1025.970] * (-1024.042) (-1026.912) [-1025.393] (-1026.104) -- 0:00:27
Average standard deviation of split frequencies: 0.010924
590500 -- (-1027.326) (-1023.915) [-1025.506] (-1024.653) * (-1026.414) (-1027.573) (-1023.565) [-1023.396] -- 0:00:27
591000 -- [-1026.036] (-1026.942) (-1024.760) (-1024.701) * (-1029.664) (-1025.178) (-1025.815) [-1024.414] -- 0:00:26
591500 -- (-1024.606) [-1026.757] (-1026.382) (-1025.431) * (-1024.939) (-1025.950) (-1025.061) [-1022.857] -- 0:00:26
592000 -- (-1026.975) [-1023.821] (-1024.899) (-1024.232) * (-1022.849) [-1027.713] (-1024.299) (-1027.374) -- 0:00:26
592500 -- (-1032.128) (-1028.054) (-1028.641) [-1024.365] * (-1027.300) (-1029.318) [-1024.003] (-1029.152) -- 0:00:26
593000 -- (-1025.348) (-1027.647) (-1023.158) [-1024.896] * (-1024.066) (-1027.998) [-1024.915] (-1024.562) -- 0:00:26
593500 -- (-1027.093) [-1021.605] (-1023.418) (-1025.115) * (-1028.203) [-1024.669] (-1026.338) (-1027.192) -- 0:00:26
594000 -- [-1025.370] (-1025.018) (-1024.886) (-1024.496) * (-1025.853) [-1023.218] (-1025.375) (-1025.793) -- 0:00:26
594500 -- [-1024.493] (-1024.573) (-1024.390) (-1024.621) * [-1025.787] (-1027.095) (-1024.315) (-1024.480) -- 0:00:26
595000 -- (-1024.075) [-1023.508] (-1027.064) (-1024.337) * [-1025.439] (-1027.848) (-1023.963) (-1025.054) -- 0:00:26
Average standard deviation of split frequencies: 0.010332
595500 -- (-1024.835) (-1024.550) [-1023.087] (-1026.470) * (-1026.881) [-1026.272] (-1022.638) (-1026.693) -- 0:00:26
596000 -- [-1027.808] (-1028.275) (-1025.654) (-1025.256) * (-1027.402) [-1029.052] (-1025.799) (-1025.411) -- 0:00:26
596500 -- (-1025.689) (-1028.557) [-1025.174] (-1022.621) * (-1025.844) (-1028.810) [-1025.323] (-1026.273) -- 0:00:26
597000 -- [-1025.435] (-1028.618) (-1026.335) (-1026.311) * [-1026.036] (-1027.011) (-1028.070) (-1025.368) -- 0:00:26
597500 -- [-1024.011] (-1025.346) (-1027.451) (-1026.280) * (-1025.952) [-1024.976] (-1023.272) (-1026.425) -- 0:00:26
598000 -- [-1024.472] (-1026.980) (-1027.306) (-1025.123) * (-1028.481) (-1024.446) [-1024.288] (-1030.025) -- 0:00:26
598500 -- [-1024.888] (-1023.136) (-1025.860) (-1027.027) * (-1025.410) (-1026.322) [-1023.287] (-1027.405) -- 0:00:26
599000 -- [-1022.480] (-1024.654) (-1022.626) (-1024.315) * (-1024.736) (-1025.801) [-1025.371] (-1025.391) -- 0:00:26
599500 -- (-1021.465) (-1031.540) (-1023.671) [-1023.693] * (-1024.621) (-1029.414) [-1024.184] (-1027.434) -- 0:00:26
600000 -- (-1026.561) (-1032.916) (-1022.822) [-1023.987] * (-1028.240) [-1024.644] (-1026.760) (-1023.779) -- 0:00:25
Average standard deviation of split frequencies: 0.010301
600500 -- [-1029.352] (-1025.525) (-1025.698) (-1024.932) * (-1030.474) [-1024.589] (-1027.445) (-1027.660) -- 0:00:25
601000 -- (-1026.843) (-1024.474) (-1025.249) [-1025.836] * (-1024.509) [-1025.745] (-1024.183) (-1029.127) -- 0:00:25
601500 -- (-1024.165) (-1024.669) (-1028.736) [-1025.325] * (-1024.246) [-1026.547] (-1022.881) (-1023.584) -- 0:00:25
602000 -- (-1026.387) [-1023.456] (-1028.346) (-1023.640) * (-1024.965) (-1026.753) (-1024.408) [-1022.375] -- 0:00:26
602500 -- (-1026.524) (-1025.435) (-1026.945) [-1023.780] * (-1024.341) (-1024.862) (-1023.588) [-1027.200] -- 0:00:26
603000 -- (-1024.249) (-1027.357) (-1024.315) [-1022.932] * (-1022.729) (-1028.635) [-1024.337] (-1024.127) -- 0:00:26
603500 -- (-1025.388) (-1026.965) [-1025.984] (-1023.442) * (-1025.570) (-1027.469) (-1026.255) [-1023.783] -- 0:00:26
604000 -- (-1023.201) (-1025.034) (-1027.059) [-1024.353] * (-1024.969) (-1024.182) (-1025.224) [-1025.469] -- 0:00:26
604500 -- (-1022.388) (-1027.908) (-1023.703) [-1024.440] * [-1025.298] (-1022.767) (-1028.010) (-1026.273) -- 0:00:26
605000 -- (-1027.028) (-1026.940) [-1026.778] (-1025.066) * [-1023.440] (-1023.584) (-1025.131) (-1027.145) -- 0:00:26
Average standard deviation of split frequencies: 0.010210
605500 -- [-1024.615] (-1027.857) (-1025.840) (-1027.849) * (-1036.831) [-1023.032] (-1025.839) (-1025.228) -- 0:00:26
606000 -- (-1026.319) (-1024.669) [-1028.538] (-1023.590) * (-1030.166) (-1025.821) (-1024.861) [-1029.361] -- 0:00:26
606500 -- (-1024.395) (-1023.960) (-1028.412) [-1026.422] * [-1028.727] (-1025.468) (-1024.331) (-1025.405) -- 0:00:25
607000 -- (-1024.924) (-1026.867) (-1025.050) [-1024.240] * (-1028.881) (-1024.189) [-1023.726] (-1026.931) -- 0:00:25
607500 -- (-1023.899) (-1028.186) (-1026.766) [-1026.885] * (-1028.940) (-1024.133) [-1023.783] (-1025.277) -- 0:00:25
608000 -- (-1023.630) [-1025.237] (-1025.215) (-1028.719) * [-1024.534] (-1024.063) (-1024.840) (-1025.471) -- 0:00:25
608500 -- (-1025.448) (-1026.320) (-1024.831) [-1024.642] * (-1026.287) (-1025.458) [-1025.678] (-1024.341) -- 0:00:25
609000 -- (-1026.047) (-1022.856) (-1024.355) [-1024.186] * (-1024.378) (-1023.952) [-1022.626] (-1023.335) -- 0:00:25
609500 -- (-1024.873) [-1024.459] (-1027.218) (-1025.188) * [-1027.998] (-1024.755) (-1023.185) (-1029.371) -- 0:00:25
610000 -- [-1024.408] (-1025.600) (-1027.271) (-1024.473) * (-1024.270) (-1025.407) (-1023.159) [-1027.822] -- 0:00:25
Average standard deviation of split frequencies: 0.010470
610500 -- (-1025.475) (-1029.670) (-1026.849) [-1024.462] * (-1023.324) [-1023.592] (-1024.550) (-1025.035) -- 0:00:25
611000 -- (-1027.819) (-1027.174) (-1025.818) [-1024.019] * (-1022.207) [-1026.931] (-1027.601) (-1027.516) -- 0:00:25
611500 -- (-1026.721) [-1026.100] (-1025.869) (-1024.144) * [-1023.433] (-1033.607) (-1024.697) (-1026.396) -- 0:00:25
612000 -- (-1025.169) (-1022.811) (-1028.063) [-1026.184] * (-1023.478) (-1024.851) [-1023.911] (-1025.239) -- 0:00:25
612500 -- [-1026.096] (-1028.847) (-1030.394) (-1026.810) * (-1023.688) (-1025.763) [-1025.901] (-1024.761) -- 0:00:25
613000 -- (-1023.481) (-1025.395) (-1026.506) [-1024.616] * (-1026.783) [-1023.804] (-1024.179) (-1026.496) -- 0:00:25
613500 -- (-1026.445) (-1021.992) (-1028.830) [-1026.415] * [-1022.798] (-1026.032) (-1027.465) (-1027.134) -- 0:00:25
614000 -- (-1025.659) [-1023.832] (-1026.873) (-1027.336) * (-1024.909) (-1030.842) [-1024.183] (-1025.289) -- 0:00:25
614500 -- (-1022.688) (-1022.641) [-1025.977] (-1026.970) * (-1023.491) [-1025.017] (-1025.291) (-1024.092) -- 0:00:25
615000 -- (-1025.071) (-1026.370) [-1025.482] (-1026.842) * [-1026.458] (-1024.808) (-1029.060) (-1026.544) -- 0:00:25
Average standard deviation of split frequencies: 0.010618
615500 -- [-1023.926] (-1025.967) (-1027.212) (-1027.204) * [-1022.645] (-1026.166) (-1026.130) (-1023.248) -- 0:00:24
616000 -- [-1023.054] (-1027.030) (-1024.428) (-1028.003) * (-1025.384) (-1025.905) (-1027.772) [-1024.531] -- 0:00:24
616500 -- [-1021.671] (-1024.064) (-1025.000) (-1027.600) * (-1026.345) [-1026.504] (-1028.734) (-1027.106) -- 0:00:24
617000 -- (-1023.236) [-1023.755] (-1023.673) (-1023.408) * (-1028.186) (-1025.331) [-1024.180] (-1028.850) -- 0:00:24
617500 -- (-1026.870) (-1024.773) (-1028.295) [-1024.534] * (-1026.177) (-1024.645) (-1026.599) [-1023.523] -- 0:00:25
618000 -- (-1023.817) [-1022.316] (-1025.722) (-1024.568) * (-1025.627) (-1025.489) (-1028.389) [-1023.902] -- 0:00:25
618500 -- [-1026.492] (-1024.363) (-1024.833) (-1026.024) * (-1030.754) (-1027.617) (-1026.432) [-1024.564] -- 0:00:25
619000 -- (-1024.253) [-1024.027] (-1031.116) (-1025.481) * (-1029.710) [-1027.564] (-1022.777) (-1025.194) -- 0:00:25
619500 -- (-1024.055) [-1023.031] (-1024.029) (-1027.759) * (-1029.888) [-1026.425] (-1029.502) (-1025.993) -- 0:00:25
620000 -- [-1024.660] (-1027.855) (-1026.741) (-1026.146) * (-1023.080) (-1023.845) [-1024.840] (-1028.493) -- 0:00:25
Average standard deviation of split frequencies: 0.010491
620500 -- (-1033.510) (-1026.161) (-1025.915) [-1025.753] * (-1026.279) [-1024.133] (-1027.290) (-1029.239) -- 0:00:25
621000 -- (-1026.408) [-1022.239] (-1024.913) (-1025.018) * (-1026.089) (-1025.320) [-1027.543] (-1028.646) -- 0:00:25
621500 -- (-1024.450) (-1025.312) (-1026.147) [-1025.977] * (-1028.056) [-1024.533] (-1024.463) (-1026.843) -- 0:00:24
622000 -- (-1024.920) (-1027.600) (-1030.003) [-1024.892] * (-1024.879) (-1029.530) [-1026.479] (-1024.982) -- 0:00:24
622500 -- (-1022.777) [-1027.456] (-1025.529) (-1025.823) * (-1023.421) [-1025.929] (-1026.354) (-1024.978) -- 0:00:24
623000 -- (-1024.874) (-1026.065) [-1026.355] (-1026.417) * (-1022.853) (-1022.596) [-1023.755] (-1024.719) -- 0:00:24
623500 -- (-1025.358) (-1023.571) (-1028.298) [-1023.446] * (-1026.240) (-1023.824) (-1025.791) [-1024.560] -- 0:00:24
624000 -- (-1024.920) (-1028.114) (-1023.779) [-1025.754] * (-1027.151) (-1024.663) (-1026.063) [-1024.908] -- 0:00:24
624500 -- [-1026.252] (-1025.232) (-1032.781) (-1026.013) * (-1029.140) [-1026.988] (-1025.194) (-1027.555) -- 0:00:24
625000 -- [-1023.325] (-1025.715) (-1025.982) (-1026.686) * [-1027.321] (-1024.872) (-1024.087) (-1027.938) -- 0:00:24
Average standard deviation of split frequencies: 0.010986
625500 -- [-1024.720] (-1032.741) (-1029.904) (-1026.912) * (-1024.786) [-1024.786] (-1027.274) (-1027.056) -- 0:00:24
626000 -- (-1026.129) [-1026.432] (-1030.733) (-1025.104) * [-1030.093] (-1024.352) (-1023.096) (-1027.509) -- 0:00:24
626500 -- (-1029.862) (-1023.916) (-1027.175) [-1023.906] * (-1026.903) (-1024.784) (-1024.185) [-1025.020] -- 0:00:24
627000 -- (-1024.081) [-1024.067] (-1025.020) (-1023.192) * (-1026.656) [-1024.958] (-1022.998) (-1024.563) -- 0:00:24
627500 -- (-1025.803) (-1024.726) [-1028.363] (-1026.165) * (-1026.168) (-1025.064) (-1030.479) [-1025.678] -- 0:00:24
628000 -- (-1025.202) [-1026.770] (-1026.283) (-1026.180) * (-1028.385) [-1024.465] (-1025.390) (-1026.240) -- 0:00:24
628500 -- (-1026.953) (-1024.814) (-1026.384) [-1024.311] * (-1024.541) (-1025.106) (-1027.463) [-1025.869] -- 0:00:24
629000 -- (-1024.711) (-1025.475) (-1026.436) [-1023.195] * [-1023.497] (-1025.340) (-1027.006) (-1024.685) -- 0:00:24
629500 -- (-1028.227) [-1025.065] (-1022.558) (-1025.386) * [-1024.780] (-1025.470) (-1025.381) (-1031.278) -- 0:00:24
630000 -- (-1026.805) (-1023.202) (-1026.464) [-1021.824] * (-1025.627) (-1026.553) [-1022.880] (-1027.716) -- 0:00:24
Average standard deviation of split frequencies: 0.011388
630500 -- (-1027.050) (-1023.610) [-1022.779] (-1022.584) * (-1025.076) (-1027.852) [-1023.935] (-1026.769) -- 0:00:24
631000 -- (-1028.737) [-1024.873] (-1023.435) (-1024.092) * (-1026.732) (-1023.597) (-1027.899) [-1024.648] -- 0:00:23
631500 -- (-1030.615) (-1024.955) (-1027.872) [-1023.873] * (-1024.402) [-1026.559] (-1024.316) (-1026.521) -- 0:00:23
632000 -- [-1024.328] (-1028.029) (-1026.605) (-1023.180) * (-1022.681) [-1027.652] (-1026.890) (-1025.517) -- 0:00:23
632500 -- [-1024.418] (-1033.956) (-1028.355) (-1024.814) * [-1027.280] (-1027.846) (-1027.569) (-1024.724) -- 0:00:23
633000 -- [-1024.252] (-1025.569) (-1025.587) (-1023.413) * (-1026.958) (-1024.098) [-1025.252] (-1026.276) -- 0:00:24
633500 -- (-1026.534) (-1025.922) [-1025.530] (-1032.838) * (-1023.250) [-1023.102] (-1025.324) (-1025.767) -- 0:00:24
634000 -- (-1027.843) [-1025.483] (-1024.622) (-1024.711) * [-1025.908] (-1025.184) (-1024.416) (-1025.391) -- 0:00:24
634500 -- [-1025.127] (-1025.014) (-1023.167) (-1024.549) * (-1026.239) [-1022.447] (-1024.934) (-1029.018) -- 0:00:24
635000 -- [-1027.507] (-1026.616) (-1024.506) (-1028.596) * (-1025.767) [-1024.002] (-1025.502) (-1024.894) -- 0:00:24
Average standard deviation of split frequencies: 0.011510
635500 -- (-1024.214) (-1026.348) [-1027.219] (-1027.633) * (-1026.160) (-1023.450) [-1027.780] (-1025.259) -- 0:00:24
636000 -- [-1024.801] (-1027.313) (-1024.583) (-1025.258) * (-1025.630) (-1025.303) [-1023.208] (-1023.654) -- 0:00:24
636500 -- [-1026.093] (-1023.456) (-1023.409) (-1028.687) * (-1026.785) (-1024.838) (-1023.732) [-1025.241] -- 0:00:23
637000 -- [-1024.384] (-1024.619) (-1026.425) (-1025.938) * (-1025.899) (-1023.302) (-1025.028) [-1023.456] -- 0:00:23
637500 -- (-1027.319) (-1024.906) (-1024.859) [-1025.166] * (-1029.308) (-1025.052) (-1024.580) [-1024.822] -- 0:00:23
638000 -- (-1025.730) [-1026.489] (-1027.113) (-1028.047) * (-1027.154) (-1025.166) [-1031.076] (-1024.457) -- 0:00:23
638500 -- (-1025.424) (-1025.769) (-1025.239) [-1027.069] * (-1025.817) (-1027.724) [-1031.659] (-1024.771) -- 0:00:23
639000 -- (-1028.146) [-1023.794] (-1025.102) (-1028.616) * [-1027.957] (-1024.860) (-1031.229) (-1025.489) -- 0:00:23
639500 -- (-1027.376) [-1023.345] (-1026.482) (-1025.611) * (-1027.172) [-1024.475] (-1028.087) (-1025.534) -- 0:00:23
640000 -- (-1025.856) [-1022.671] (-1024.661) (-1028.838) * (-1026.500) (-1029.825) [-1025.505] (-1023.495) -- 0:00:23
Average standard deviation of split frequencies: 0.010945
640500 -- (-1027.564) (-1024.058) (-1030.799) [-1026.175] * (-1027.877) (-1028.557) (-1026.620) [-1022.696] -- 0:00:23
641000 -- (-1023.585) (-1026.377) (-1025.370) [-1025.647] * (-1025.120) (-1025.018) [-1026.189] (-1025.583) -- 0:00:23
641500 -- (-1029.276) (-1022.524) [-1025.978] (-1027.082) * [-1024.220] (-1024.406) (-1025.130) (-1028.412) -- 0:00:23
642000 -- (-1024.881) [-1023.610] (-1023.208) (-1027.194) * [-1024.895] (-1027.446) (-1027.440) (-1025.742) -- 0:00:23
642500 -- (-1025.102) (-1026.039) (-1023.408) [-1026.201] * (-1024.556) (-1027.987) (-1025.722) [-1023.240] -- 0:00:23
643000 -- (-1026.961) [-1023.755] (-1027.332) (-1026.644) * (-1025.342) (-1025.765) (-1025.879) [-1026.659] -- 0:00:23
643500 -- (-1026.953) (-1025.887) (-1032.874) [-1025.126] * (-1023.185) [-1026.614] (-1026.849) (-1025.846) -- 0:00:23
644000 -- [-1024.281] (-1024.196) (-1028.324) (-1024.329) * (-1025.359) (-1028.305) (-1026.835) [-1026.176] -- 0:00:23
644500 -- [-1025.060] (-1022.557) (-1030.283) (-1024.973) * (-1024.817) (-1026.829) (-1024.281) [-1026.346] -- 0:00:23
645000 -- [-1025.888] (-1025.147) (-1026.745) (-1026.044) * [-1025.589] (-1025.371) (-1023.596) (-1027.405) -- 0:00:23
Average standard deviation of split frequencies: 0.011203
645500 -- [-1024.661] (-1026.708) (-1025.028) (-1023.225) * (-1025.383) [-1026.204] (-1021.675) (-1030.760) -- 0:00:23
646000 -- (-1023.709) (-1027.562) (-1025.805) [-1027.978] * (-1026.365) [-1025.450] (-1026.526) (-1034.191) -- 0:00:23
646500 -- [-1023.677] (-1028.965) (-1025.391) (-1024.240) * [-1022.992] (-1028.741) (-1025.449) (-1027.459) -- 0:00:22
647000 -- [-1025.588] (-1026.007) (-1025.502) (-1023.894) * (-1024.853) (-1028.603) [-1023.221] (-1024.783) -- 0:00:22
647500 -- (-1024.638) (-1026.909) [-1025.023] (-1028.996) * [-1028.723] (-1026.660) (-1026.935) (-1024.239) -- 0:00:22
648000 -- (-1025.491) (-1026.320) [-1025.098] (-1027.252) * [-1025.954] (-1025.207) (-1027.058) (-1025.922) -- 0:00:22
648500 -- (-1024.999) [-1026.005] (-1024.958) (-1026.911) * [-1026.193] (-1026.050) (-1025.117) (-1027.369) -- 0:00:23
649000 -- (-1024.936) (-1024.835) (-1024.413) [-1025.642] * (-1029.958) (-1030.030) (-1028.317) [-1027.598] -- 0:00:23
649500 -- (-1024.737) (-1025.746) (-1033.157) [-1024.714] * [-1026.492] (-1030.030) (-1027.600) (-1023.428) -- 0:00:23
650000 -- (-1026.239) (-1026.189) (-1027.508) [-1023.429] * (-1027.663) [-1027.644] (-1027.597) (-1022.858) -- 0:00:23
Average standard deviation of split frequencies: 0.010686
650500 -- (-1026.144) (-1027.805) [-1026.777] (-1025.027) * (-1026.187) (-1028.819) (-1026.623) [-1025.163] -- 0:00:23
651000 -- (-1025.378) (-1028.482) (-1026.724) [-1025.056] * (-1025.393) (-1024.837) [-1024.981] (-1026.277) -- 0:00:23
651500 -- (-1025.629) [-1024.708] (-1028.339) (-1024.599) * [-1024.587] (-1031.817) (-1026.596) (-1027.622) -- 0:00:23
652000 -- [-1025.710] (-1023.977) (-1023.942) (-1025.868) * (-1028.879) [-1024.324] (-1025.278) (-1030.521) -- 0:00:22
652500 -- (-1024.633) [-1024.886] (-1027.359) (-1023.474) * (-1025.222) [-1022.333] (-1028.681) (-1026.242) -- 0:00:22
653000 -- (-1028.250) (-1028.992) (-1031.039) [-1025.054] * [-1024.623] (-1025.984) (-1029.187) (-1023.559) -- 0:00:22
653500 -- (-1026.014) (-1023.880) [-1025.996] (-1028.025) * (-1026.893) [-1026.746] (-1025.103) (-1022.820) -- 0:00:22
654000 -- [-1024.478] (-1024.644) (-1026.894) (-1025.818) * [-1023.653] (-1025.161) (-1026.674) (-1027.722) -- 0:00:22
654500 -- [-1024.976] (-1024.585) (-1026.322) (-1025.990) * [-1024.609] (-1024.301) (-1027.175) (-1025.994) -- 0:00:22
655000 -- (-1031.557) (-1025.877) (-1025.452) [-1023.929] * (-1030.174) (-1027.434) (-1025.115) [-1024.533] -- 0:00:22
Average standard deviation of split frequencies: 0.011117
655500 -- (-1025.841) (-1023.526) (-1024.862) [-1025.552] * [-1024.506] (-1027.630) (-1023.448) (-1027.714) -- 0:00:22
656000 -- [-1023.853] (-1026.506) (-1025.890) (-1024.195) * [-1024.049] (-1024.448) (-1025.673) (-1024.335) -- 0:00:22
656500 -- [-1027.741] (-1026.213) (-1025.576) (-1028.255) * [-1026.164] (-1025.532) (-1024.518) (-1024.557) -- 0:00:22
657000 -- (-1023.758) [-1025.815] (-1025.517) (-1024.557) * (-1024.097) (-1024.795) (-1024.620) [-1024.699] -- 0:00:22
657500 -- (-1024.794) [-1026.343] (-1027.385) (-1025.721) * (-1031.828) (-1025.946) (-1025.656) [-1024.492] -- 0:00:22
658000 -- [-1023.031] (-1023.625) (-1029.033) (-1025.400) * (-1030.161) [-1025.453] (-1026.188) (-1025.554) -- 0:00:22
658500 -- (-1025.592) (-1024.837) (-1025.548) [-1024.712] * (-1024.652) (-1025.245) (-1030.364) [-1025.363] -- 0:00:22
659000 -- (-1025.720) (-1025.831) [-1025.282] (-1027.524) * [-1023.681] (-1026.190) (-1030.636) (-1026.055) -- 0:00:22
659500 -- (-1023.665) (-1026.639) (-1025.094) [-1026.480] * (-1025.713) (-1025.604) [-1026.017] (-1027.356) -- 0:00:22
660000 -- (-1027.087) (-1025.445) (-1026.549) [-1024.545] * [-1025.303] (-1029.124) (-1024.792) (-1026.356) -- 0:00:22
Average standard deviation of split frequencies: 0.011506
660500 -- (-1024.803) (-1032.873) [-1025.522] (-1027.312) * (-1025.091) [-1025.990] (-1027.089) (-1028.704) -- 0:00:22
661000 -- [-1025.895] (-1026.365) (-1025.218) (-1025.268) * [-1024.079] (-1024.147) (-1025.345) (-1025.476) -- 0:00:22
661500 -- (-1025.267) [-1025.517] (-1024.868) (-1024.910) * (-1027.215) (-1025.989) [-1025.491] (-1022.399) -- 0:00:22
662000 -- (-1028.221) [-1024.382] (-1024.628) (-1028.350) * (-1023.328) (-1026.070) (-1025.298) [-1024.908] -- 0:00:21
662500 -- (-1026.813) (-1031.455) [-1023.708] (-1023.861) * (-1026.953) (-1027.285) (-1025.611) [-1025.631] -- 0:00:21
663000 -- (-1026.529) (-1025.216) (-1026.056) [-1025.483] * (-1023.534) (-1027.445) [-1026.452] (-1023.847) -- 0:00:21
663500 -- (-1027.003) [-1022.661] (-1037.081) (-1028.513) * (-1025.082) (-1023.469) [-1026.226] (-1027.431) -- 0:00:22
664000 -- (-1026.297) (-1025.328) (-1024.874) [-1030.036] * [-1026.562] (-1024.131) (-1025.935) (-1023.253) -- 0:00:22
664500 -- (-1025.342) (-1023.690) [-1026.903] (-1028.401) * (-1028.540) (-1026.829) (-1025.603) [-1023.820] -- 0:00:22
665000 -- [-1024.832] (-1024.712) (-1025.601) (-1031.294) * [-1026.134] (-1025.225) (-1028.135) (-1024.321) -- 0:00:22
Average standard deviation of split frequencies: 0.011723
665500 -- [-1026.688] (-1023.471) (-1025.729) (-1025.151) * (-1024.574) (-1022.464) (-1024.318) [-1023.676] -- 0:00:22
666000 -- [-1022.588] (-1028.723) (-1026.297) (-1025.408) * [-1024.056] (-1022.511) (-1026.494) (-1026.577) -- 0:00:22
666500 -- (-1025.982) (-1022.441) (-1026.239) [-1025.028] * (-1025.427) [-1025.160] (-1024.843) (-1026.170) -- 0:00:22
667000 -- (-1024.893) (-1024.041) (-1024.915) [-1024.583] * (-1024.790) (-1025.491) (-1024.599) [-1024.086] -- 0:00:21
667500 -- [-1024.776] (-1026.156) (-1032.133) (-1024.370) * (-1024.378) (-1024.758) (-1026.856) [-1022.674] -- 0:00:21
668000 -- (-1026.180) (-1023.215) (-1026.136) [-1024.823] * [-1026.592] (-1022.715) (-1026.137) (-1023.213) -- 0:00:21
668500 -- (-1023.975) (-1024.609) [-1026.172] (-1027.355) * (-1025.299) [-1026.945] (-1022.829) (-1025.729) -- 0:00:21
669000 -- (-1026.673) (-1026.323) (-1024.523) [-1027.151] * [-1024.461] (-1026.836) (-1023.215) (-1026.997) -- 0:00:21
669500 -- (-1025.537) (-1023.470) (-1024.743) [-1024.421] * (-1021.985) (-1025.835) (-1026.851) [-1027.707] -- 0:00:21
670000 -- (-1024.179) (-1026.430) (-1026.237) [-1024.467] * (-1023.523) (-1024.168) [-1026.957] (-1026.622) -- 0:00:21
Average standard deviation of split frequencies: 0.011686
670500 -- [-1024.453] (-1029.291) (-1025.644) (-1023.118) * (-1023.164) [-1024.879] (-1027.895) (-1023.430) -- 0:00:21
671000 -- [-1023.613] (-1025.876) (-1022.187) (-1026.927) * [-1026.046] (-1024.941) (-1024.004) (-1024.034) -- 0:00:21
671500 -- (-1026.545) (-1025.181) [-1023.026] (-1022.864) * (-1025.615) (-1027.420) [-1025.932] (-1025.022) -- 0:00:21
672000 -- (-1027.347) [-1023.271] (-1024.763) (-1023.815) * (-1023.532) (-1024.894) (-1025.502) [-1022.454] -- 0:00:21
672500 -- [-1022.662] (-1027.505) (-1023.911) (-1024.310) * (-1025.283) (-1025.757) [-1026.202] (-1024.010) -- 0:00:21
673000 -- (-1024.082) (-1023.061) [-1027.817] (-1025.038) * (-1028.201) [-1023.972] (-1027.889) (-1025.304) -- 0:00:21
673500 -- (-1025.362) (-1026.082) (-1025.075) [-1025.885] * [-1025.864] (-1025.010) (-1028.020) (-1026.386) -- 0:00:21
674000 -- [-1027.924] (-1022.932) (-1024.525) (-1022.542) * (-1028.127) (-1025.753) [-1023.048] (-1025.413) -- 0:00:21
674500 -- (-1026.340) (-1026.498) [-1024.788] (-1023.068) * (-1024.585) [-1026.151] (-1024.445) (-1027.000) -- 0:00:21
675000 -- (-1027.102) [-1024.276] (-1023.558) (-1027.106) * (-1025.114) (-1030.120) [-1023.988] (-1024.464) -- 0:00:21
Average standard deviation of split frequencies: 0.012347
675500 -- (-1024.753) (-1026.182) (-1023.554) [-1027.313] * [-1024.617] (-1027.230) (-1025.832) (-1024.997) -- 0:00:21
676000 -- [-1024.128] (-1024.463) (-1026.701) (-1026.461) * (-1024.437) (-1023.511) [-1030.250] (-1024.690) -- 0:00:21
676500 -- (-1023.220) (-1025.336) [-1025.641] (-1025.945) * (-1024.270) [-1026.929] (-1027.710) (-1026.155) -- 0:00:21
677000 -- (-1027.268) [-1027.265] (-1027.367) (-1032.071) * [-1024.517] (-1027.521) (-1027.788) (-1026.261) -- 0:00:20
677500 -- [-1024.584] (-1028.669) (-1026.780) (-1026.121) * (-1026.173) [-1026.917] (-1026.513) (-1027.911) -- 0:00:20
678000 -- (-1029.672) [-1027.227] (-1026.363) (-1025.435) * (-1025.879) (-1026.729) [-1025.743] (-1025.573) -- 0:00:20
678500 -- (-1025.606) [-1023.516] (-1026.608) (-1028.529) * (-1023.803) [-1025.019] (-1028.329) (-1028.828) -- 0:00:20
679000 -- (-1026.800) (-1026.972) (-1027.059) [-1027.166] * (-1027.891) [-1026.587] (-1026.103) (-1025.242) -- 0:00:21
679500 -- (-1024.994) [-1023.662] (-1025.112) (-1025.242) * (-1026.748) (-1023.298) [-1027.566] (-1029.709) -- 0:00:21
680000 -- (-1025.763) [-1023.896] (-1025.733) (-1025.039) * (-1027.141) (-1027.118) [-1028.203] (-1028.976) -- 0:00:21
Average standard deviation of split frequencies: 0.011514
680500 -- (-1026.896) (-1028.096) (-1024.827) [-1024.609] * (-1025.342) (-1027.819) [-1025.278] (-1027.882) -- 0:00:21
681000 -- (-1025.941) [-1025.987] (-1025.930) (-1026.051) * [-1023.668] (-1026.165) (-1024.874) (-1024.128) -- 0:00:21
681500 -- [-1026.452] (-1028.265) (-1028.912) (-1024.748) * (-1023.532) (-1025.040) (-1026.313) [-1023.365] -- 0:00:21
682000 -- [-1023.272] (-1025.033) (-1026.436) (-1026.615) * (-1026.149) (-1025.033) (-1027.350) [-1023.383] -- 0:00:20
682500 -- (-1027.981) (-1023.178) (-1026.433) [-1024.133] * [-1026.476] (-1025.329) (-1024.967) (-1025.680) -- 0:00:20
683000 -- (-1026.413) (-1026.608) [-1025.601] (-1024.389) * (-1025.146) (-1024.315) (-1022.673) [-1022.391] -- 0:00:20
683500 -- [-1022.901] (-1024.533) (-1029.365) (-1024.307) * (-1024.023) [-1024.309] (-1025.591) (-1023.439) -- 0:00:20
684000 -- [-1023.981] (-1025.350) (-1026.882) (-1026.155) * [-1024.271] (-1027.455) (-1030.384) (-1023.133) -- 0:00:20
684500 -- (-1026.110) (-1024.730) [-1025.181] (-1025.187) * (-1026.270) (-1024.851) (-1023.169) [-1028.455] -- 0:00:20
685000 -- (-1026.095) (-1025.686) (-1026.592) [-1026.645] * (-1026.040) (-1025.367) (-1024.895) [-1028.309] -- 0:00:20
Average standard deviation of split frequencies: 0.012127
685500 -- [-1027.710] (-1028.419) (-1027.593) (-1024.668) * (-1026.084) [-1023.989] (-1024.755) (-1026.992) -- 0:00:20
686000 -- (-1027.448) (-1027.985) [-1027.192] (-1024.990) * (-1030.059) [-1023.864] (-1028.914) (-1027.492) -- 0:00:20
686500 -- (-1025.742) (-1026.509) [-1027.530] (-1025.066) * [-1025.515] (-1022.893) (-1029.641) (-1030.614) -- 0:00:20
687000 -- (-1025.271) (-1026.631) [-1026.494] (-1026.714) * (-1023.802) (-1023.242) (-1022.481) [-1026.295] -- 0:00:20
687500 -- (-1025.726) [-1026.806] (-1026.100) (-1024.501) * (-1028.232) (-1022.678) [-1024.813] (-1024.464) -- 0:00:20
688000 -- (-1025.365) (-1025.821) (-1025.773) [-1024.559] * (-1026.767) [-1023.952] (-1024.105) (-1030.173) -- 0:00:20
688500 -- (-1027.722) [-1025.342] (-1024.605) (-1029.297) * (-1030.182) [-1024.519] (-1023.694) (-1028.632) -- 0:00:20
689000 -- (-1024.548) (-1024.813) (-1025.028) [-1024.336] * (-1025.133) (-1027.570) [-1024.190] (-1029.372) -- 0:00:20
689500 -- (-1025.088) (-1027.657) (-1029.359) [-1025.097] * (-1028.130) (-1024.664) [-1026.235] (-1024.498) -- 0:00:20
690000 -- [-1026.423] (-1025.477) (-1024.124) (-1025.215) * (-1025.098) (-1024.979) [-1024.771] (-1024.803) -- 0:00:20
Average standard deviation of split frequencies: 0.011731
690500 -- (-1026.799) (-1023.428) (-1026.554) [-1025.878] * (-1026.604) (-1026.502) [-1024.495] (-1023.543) -- 0:00:20
691000 -- (-1026.184) [-1025.188] (-1025.030) (-1027.535) * [-1027.331] (-1025.468) (-1026.667) (-1025.761) -- 0:00:20
691500 -- (-1024.238) [-1024.690] (-1025.990) (-1026.313) * (-1025.645) (-1025.493) [-1027.447] (-1025.649) -- 0:00:20
692000 -- [-1028.244] (-1024.352) (-1024.163) (-1026.599) * (-1023.962) (-1025.335) [-1025.945] (-1029.401) -- 0:00:20
692500 -- (-1030.155) (-1027.076) [-1021.677] (-1024.920) * (-1022.669) (-1025.185) (-1024.401) [-1027.942] -- 0:00:19
693000 -- (-1029.986) (-1027.824) (-1023.713) [-1024.600] * (-1023.177) (-1025.531) [-1024.150] (-1029.410) -- 0:00:19
693500 -- (-1027.585) [-1027.554] (-1023.200) (-1022.903) * (-1025.220) (-1027.483) (-1026.259) [-1027.809] -- 0:00:19
694000 -- (-1025.532) (-1025.532) [-1023.790] (-1024.067) * (-1026.241) (-1024.606) (-1025.906) [-1028.179] -- 0:00:20
694500 -- (-1025.888) [-1026.214] (-1024.583) (-1027.168) * (-1023.479) (-1024.583) (-1025.508) [-1029.194] -- 0:00:20
695000 -- (-1026.685) [-1024.797] (-1025.956) (-1025.522) * (-1024.525) (-1024.209) (-1023.696) [-1028.055] -- 0:00:20
Average standard deviation of split frequencies: 0.011472
695500 -- (-1023.974) [-1027.553] (-1026.410) (-1031.679) * [-1026.979] (-1028.451) (-1025.196) (-1029.146) -- 0:00:20
696000 -- (-1029.870) (-1028.333) (-1026.534) [-1022.673] * (-1024.355) (-1027.774) (-1026.290) [-1026.319] -- 0:00:20
696500 -- (-1027.875) (-1024.884) [-1024.649] (-1023.140) * (-1025.989) (-1026.665) [-1024.329] (-1024.417) -- 0:00:20
697000 -- (-1028.729) (-1025.672) (-1023.807) [-1022.886] * (-1027.258) (-1029.106) (-1024.030) [-1023.986] -- 0:00:19
697500 -- [-1030.571] (-1026.116) (-1025.676) (-1026.895) * [-1031.400] (-1026.456) (-1024.436) (-1024.217) -- 0:00:19
698000 -- [-1023.245] (-1024.655) (-1025.369) (-1023.153) * (-1027.320) (-1023.755) (-1024.227) [-1023.299] -- 0:00:19
698500 -- (-1027.541) (-1025.815) [-1027.562] (-1028.550) * (-1028.238) (-1024.623) (-1024.583) [-1026.429] -- 0:00:19
699000 -- (-1027.402) (-1024.849) (-1024.964) [-1025.007] * (-1022.865) [-1023.614] (-1023.616) (-1026.537) -- 0:00:19
699500 -- [-1024.512] (-1027.576) (-1025.119) (-1024.502) * (-1023.185) (-1027.376) (-1024.506) [-1024.599] -- 0:00:19
700000 -- (-1023.952) (-1026.411) [-1024.085] (-1024.440) * (-1023.791) (-1028.971) [-1023.497] (-1026.539) -- 0:00:19
Average standard deviation of split frequencies: 0.011059
700500 -- (-1025.512) [-1024.101] (-1025.535) (-1024.593) * (-1025.332) (-1024.847) [-1024.036] (-1024.311) -- 0:00:19
701000 -- (-1023.571) (-1025.882) (-1025.533) [-1025.992] * (-1024.228) [-1023.251] (-1029.252) (-1030.898) -- 0:00:19
701500 -- (-1026.993) [-1025.593] (-1023.337) (-1028.805) * (-1027.316) [-1027.990] (-1027.247) (-1026.148) -- 0:00:19
702000 -- (-1025.881) [-1026.735] (-1025.057) (-1028.537) * (-1023.448) [-1026.907] (-1025.885) (-1026.537) -- 0:00:19
702500 -- (-1027.955) [-1027.427] (-1024.308) (-1029.220) * [-1024.751] (-1025.401) (-1023.510) (-1025.651) -- 0:00:19
703000 -- [-1026.643] (-1025.224) (-1024.045) (-1023.411) * [-1024.723] (-1025.038) (-1024.600) (-1024.491) -- 0:00:19
703500 -- [-1027.915] (-1023.171) (-1027.266) (-1026.344) * [-1024.581] (-1026.292) (-1025.223) (-1028.052) -- 0:00:19
704000 -- (-1025.043) (-1025.774) (-1027.892) [-1024.280] * [-1023.336] (-1025.307) (-1025.546) (-1024.792) -- 0:00:19
704500 -- (-1025.260) (-1026.386) [-1024.132] (-1024.164) * [-1023.260] (-1025.321) (-1025.603) (-1023.836) -- 0:00:19
705000 -- [-1025.101] (-1027.136) (-1026.457) (-1026.015) * [-1025.273] (-1024.768) (-1025.970) (-1024.879) -- 0:00:19
Average standard deviation of split frequencies: 0.011017
705500 -- [-1026.126] (-1027.907) (-1024.913) (-1026.587) * (-1025.772) [-1022.982] (-1028.191) (-1024.633) -- 0:00:19
706000 -- (-1024.582) [-1026.840] (-1025.507) (-1026.343) * [-1026.684] (-1024.757) (-1023.808) (-1025.096) -- 0:00:19
706500 -- (-1026.262) (-1025.102) (-1024.708) [-1026.317] * [-1024.443] (-1024.003) (-1022.080) (-1024.792) -- 0:00:19
707000 -- (-1025.423) (-1028.095) (-1025.627) [-1026.723] * (-1026.580) (-1024.834) (-1028.646) [-1025.417] -- 0:00:19
707500 -- (-1027.975) (-1027.443) (-1023.808) [-1028.015] * [-1025.231] (-1025.708) (-1023.673) (-1025.364) -- 0:00:19
708000 -- [-1025.802] (-1027.496) (-1023.757) (-1025.889) * [-1024.644] (-1025.839) (-1023.072) (-1025.241) -- 0:00:18
708500 -- (-1025.494) (-1027.328) (-1024.070) [-1023.777] * (-1024.527) (-1026.273) (-1025.826) [-1025.672] -- 0:00:18
709000 -- (-1025.687) [-1024.872] (-1022.832) (-1026.241) * (-1027.720) (-1028.344) [-1024.844] (-1031.346) -- 0:00:18
709500 -- (-1027.646) [-1024.113] (-1022.672) (-1023.554) * (-1031.695) (-1025.731) (-1025.683) [-1025.720] -- 0:00:19
710000 -- (-1026.442) (-1023.897) [-1025.545] (-1024.543) * (-1030.268) (-1025.742) [-1026.306] (-1025.934) -- 0:00:19
Average standard deviation of split frequencies: 0.011318
710500 -- (-1025.864) (-1023.494) [-1023.242] (-1028.693) * (-1025.440) (-1030.125) (-1027.828) [-1026.162] -- 0:00:19
711000 -- (-1027.400) (-1027.708) (-1026.227) [-1023.802] * (-1023.827) (-1023.199) [-1028.988] (-1025.869) -- 0:00:19
711500 -- (-1026.501) (-1028.450) (-1027.382) [-1025.019] * (-1028.579) (-1024.194) (-1024.545) [-1025.631] -- 0:00:19
712000 -- (-1029.732) (-1027.600) [-1026.271] (-1024.245) * (-1028.347) (-1030.295) (-1025.183) [-1025.263] -- 0:00:19
712500 -- (-1031.459) (-1026.562) (-1027.397) [-1024.749] * (-1024.143) (-1025.980) [-1023.782] (-1025.205) -- 0:00:18
713000 -- (-1027.012) (-1026.330) (-1027.399) [-1023.464] * [-1024.254] (-1029.597) (-1025.200) (-1026.368) -- 0:00:18
713500 -- (-1033.022) (-1027.036) (-1027.452) [-1024.453] * [-1025.207] (-1025.580) (-1026.383) (-1027.127) -- 0:00:18
714000 -- (-1028.916) (-1026.284) (-1028.741) [-1024.197] * [-1024.776] (-1024.715) (-1024.639) (-1025.883) -- 0:00:18
714500 -- (-1023.617) [-1023.994] (-1026.955) (-1026.129) * [-1025.435] (-1025.642) (-1023.667) (-1025.153) -- 0:00:18
715000 -- (-1023.138) (-1025.990) (-1030.468) [-1023.895] * (-1025.048) (-1025.299) (-1024.702) [-1024.243] -- 0:00:18
Average standard deviation of split frequencies: 0.011110
715500 -- (-1024.600) (-1024.519) (-1029.978) [-1025.646] * [-1024.391] (-1025.764) (-1022.905) (-1023.329) -- 0:00:18
716000 -- (-1026.091) (-1028.423) [-1026.235] (-1024.402) * (-1027.345) (-1027.303) (-1025.210) [-1025.425] -- 0:00:18
716500 -- (-1028.116) (-1026.562) (-1024.471) [-1028.188] * [-1025.304] (-1024.795) (-1025.039) (-1025.539) -- 0:00:18
717000 -- (-1027.734) [-1027.774] (-1026.567) (-1028.094) * (-1025.198) (-1025.699) (-1024.711) [-1030.790] -- 0:00:18
717500 -- [-1024.718] (-1025.279) (-1027.472) (-1027.324) * (-1024.444) (-1027.465) [-1023.120] (-1027.235) -- 0:00:18
718000 -- (-1024.873) [-1025.657] (-1025.021) (-1027.821) * (-1023.860) (-1031.442) [-1025.441] (-1023.755) -- 0:00:18
718500 -- (-1025.608) (-1030.834) [-1026.087] (-1028.273) * (-1028.677) (-1027.718) [-1023.010] (-1025.504) -- 0:00:18
719000 -- (-1025.895) (-1025.531) [-1026.579] (-1029.796) * [-1023.764] (-1028.475) (-1023.970) (-1025.575) -- 0:00:18
719500 -- (-1024.902) (-1028.587) [-1023.744] (-1025.167) * [-1025.643] (-1028.295) (-1026.297) (-1028.872) -- 0:00:18
720000 -- (-1025.623) (-1025.425) [-1023.236] (-1025.421) * (-1025.291) (-1025.753) [-1023.510] (-1027.132) -- 0:00:18
Average standard deviation of split frequencies: 0.010957
720500 -- [-1025.331] (-1025.294) (-1022.114) (-1025.539) * (-1024.975) [-1025.565] (-1025.706) (-1026.519) -- 0:00:18
721000 -- [-1023.143] (-1024.090) (-1022.288) (-1024.057) * (-1024.811) [-1025.760] (-1026.397) (-1023.628) -- 0:00:18
721500 -- (-1024.384) [-1024.593] (-1025.214) (-1026.411) * (-1028.075) (-1027.914) (-1026.806) [-1024.385] -- 0:00:18
722000 -- (-1025.140) [-1024.908] (-1024.621) (-1027.255) * (-1027.693) (-1027.841) [-1025.125] (-1021.906) -- 0:00:18
722500 -- (-1028.632) [-1022.409] (-1025.351) (-1024.556) * (-1025.410) (-1025.368) [-1023.598] (-1025.025) -- 0:00:18
723000 -- [-1025.718] (-1026.512) (-1025.287) (-1025.728) * (-1025.614) [-1025.153] (-1032.179) (-1026.886) -- 0:00:18
723500 -- (-1024.198) [-1023.209] (-1024.249) (-1024.034) * [-1025.355] (-1028.299) (-1027.107) (-1028.552) -- 0:00:17
724000 -- [-1025.174] (-1023.048) (-1024.267) (-1024.365) * (-1026.047) (-1023.416) [-1024.200] (-1026.448) -- 0:00:17
724500 -- (-1028.033) [-1025.974] (-1028.310) (-1022.850) * [-1025.758] (-1023.959) (-1024.028) (-1027.952) -- 0:00:18
725000 -- (-1024.303) (-1029.071) [-1025.827] (-1024.786) * (-1027.875) (-1026.221) (-1025.484) [-1025.361] -- 0:00:18
Average standard deviation of split frequencies: 0.010470
725500 -- (-1025.438) (-1027.751) (-1026.181) [-1024.517] * [-1026.598] (-1026.411) (-1027.557) (-1027.700) -- 0:00:18
726000 -- (-1024.740) (-1023.770) (-1025.644) [-1028.980] * (-1027.422) (-1023.714) [-1024.210] (-1025.818) -- 0:00:18
726500 -- (-1025.772) [-1024.702] (-1025.485) (-1027.642) * (-1027.006) (-1025.703) (-1026.624) [-1023.909] -- 0:00:18
727000 -- (-1024.966) [-1024.597] (-1023.324) (-1026.612) * (-1025.227) (-1026.301) [-1024.381] (-1028.489) -- 0:00:18
727500 -- [-1024.326] (-1024.340) (-1025.011) (-1024.129) * [-1026.601] (-1024.707) (-1026.356) (-1026.864) -- 0:00:17
728000 -- [-1022.314] (-1024.586) (-1024.771) (-1024.702) * (-1026.975) [-1024.235] (-1026.304) (-1028.394) -- 0:00:17
728500 -- (-1029.120) (-1026.775) [-1027.177] (-1026.348) * (-1026.673) (-1025.877) [-1026.243] (-1029.280) -- 0:00:17
729000 -- [-1026.909] (-1026.227) (-1025.548) (-1025.309) * (-1025.253) (-1026.614) (-1024.924) [-1023.194] -- 0:00:17
729500 -- (-1026.256) [-1026.957] (-1029.367) (-1024.277) * (-1024.715) (-1026.673) (-1022.950) [-1023.472] -- 0:00:17
730000 -- (-1024.038) (-1026.585) [-1024.759] (-1025.886) * (-1025.066) [-1028.944] (-1026.476) (-1026.884) -- 0:00:17
Average standard deviation of split frequencies: 0.010242
730500 -- (-1030.885) (-1024.989) [-1028.339] (-1027.617) * (-1024.869) (-1023.407) (-1025.400) [-1025.499] -- 0:00:17
731000 -- (-1026.183) (-1025.073) [-1025.219] (-1023.811) * (-1027.117) (-1026.205) (-1026.008) [-1026.394] -- 0:00:17
731500 -- (-1025.155) (-1029.322) (-1027.918) [-1022.665] * (-1026.048) [-1025.552] (-1024.442) (-1026.187) -- 0:00:17
732000 -- (-1026.106) (-1025.464) (-1024.514) [-1023.325] * (-1023.506) [-1023.913] (-1023.512) (-1025.994) -- 0:00:17
732500 -- (-1025.932) (-1026.573) (-1025.691) [-1024.626] * [-1025.667] (-1023.602) (-1025.100) (-1024.101) -- 0:00:17
733000 -- [-1025.869] (-1028.260) (-1027.071) (-1026.079) * (-1023.853) (-1026.903) [-1023.555] (-1026.424) -- 0:00:17
733500 -- (-1028.021) [-1026.781] (-1023.791) (-1027.885) * [-1026.169] (-1026.786) (-1024.368) (-1026.777) -- 0:00:17
734000 -- (-1026.054) (-1025.546) (-1025.785) [-1025.198] * (-1025.696) [-1024.034] (-1025.198) (-1025.291) -- 0:00:17
734500 -- (-1027.236) [-1024.160] (-1026.987) (-1031.246) * [-1026.833] (-1023.845) (-1026.004) (-1025.228) -- 0:00:17
735000 -- (-1025.874) (-1027.127) (-1025.181) [-1025.497] * (-1028.399) [-1024.759] (-1028.900) (-1023.854) -- 0:00:17
Average standard deviation of split frequencies: 0.009968
735500 -- (-1027.617) (-1028.109) [-1026.366] (-1023.596) * (-1025.303) (-1024.858) (-1025.642) [-1027.403] -- 0:00:17
736000 -- (-1024.188) (-1026.607) (-1026.732) [-1026.486] * [-1025.032] (-1026.905) (-1027.487) (-1026.550) -- 0:00:17
736500 -- (-1024.218) [-1026.209] (-1025.322) (-1026.415) * (-1024.181) (-1024.672) [-1026.648] (-1028.071) -- 0:00:17
737000 -- [-1024.609] (-1023.988) (-1023.753) (-1027.756) * (-1024.018) [-1024.920] (-1022.960) (-1026.450) -- 0:00:17
737500 -- (-1022.884) (-1025.414) [-1023.057] (-1027.301) * (-1025.008) (-1025.229) (-1024.908) [-1028.242] -- 0:00:17
738000 -- (-1022.051) (-1025.410) [-1023.225] (-1025.393) * (-1025.590) (-1031.177) (-1025.535) [-1026.048] -- 0:00:17
738500 -- (-1023.347) (-1024.585) [-1023.149] (-1025.159) * [-1023.572] (-1024.617) (-1033.744) (-1025.578) -- 0:00:16
739000 -- [-1025.155] (-1024.813) (-1024.267) (-1024.675) * [-1025.198] (-1024.847) (-1034.038) (-1023.988) -- 0:00:16
739500 -- [-1024.084] (-1023.815) (-1024.267) (-1027.816) * (-1024.712) [-1027.899] (-1029.432) (-1027.747) -- 0:00:17
740000 -- (-1026.822) (-1025.426) (-1026.205) [-1029.349] * (-1026.753) [-1022.056] (-1023.255) (-1026.455) -- 0:00:17
Average standard deviation of split frequencies: 0.009945
740500 -- (-1023.821) [-1025.976] (-1024.857) (-1026.597) * (-1028.002) (-1024.791) (-1025.376) [-1023.999] -- 0:00:17
741000 -- [-1022.999] (-1031.074) (-1027.152) (-1025.441) * (-1026.863) (-1023.702) [-1023.280] (-1025.785) -- 0:00:17
741500 -- (-1025.090) (-1025.674) (-1025.394) [-1029.649] * (-1023.267) (-1025.763) [-1028.775] (-1025.552) -- 0:00:17
742000 -- (-1025.119) (-1026.301) [-1029.760] (-1031.957) * (-1024.321) [-1026.017] (-1023.178) (-1023.683) -- 0:00:17
742500 -- [-1025.791] (-1023.950) (-1024.834) (-1026.971) * (-1026.433) (-1028.591) [-1024.412] (-1029.605) -- 0:00:16
743000 -- (-1027.978) (-1022.844) (-1027.095) [-1025.975] * (-1024.676) [-1026.463] (-1024.067) (-1028.240) -- 0:00:16
743500 -- (-1022.986) (-1027.459) [-1024.636] (-1024.766) * (-1024.272) [-1027.018] (-1026.718) (-1026.061) -- 0:00:16
744000 -- (-1023.381) (-1028.951) (-1024.355) [-1024.572] * (-1025.500) [-1027.459] (-1023.827) (-1023.883) -- 0:00:16
744500 -- (-1025.633) (-1024.344) [-1027.327] (-1026.741) * [-1024.974] (-1027.112) (-1025.628) (-1024.807) -- 0:00:16
745000 -- (-1025.449) (-1025.653) [-1027.855] (-1027.655) * (-1023.251) [-1023.402] (-1025.298) (-1023.379) -- 0:00:16
Average standard deviation of split frequencies: 0.009716
745500 -- (-1022.569) [-1023.820] (-1027.851) (-1028.997) * (-1026.831) (-1025.403) [-1027.075] (-1026.279) -- 0:00:16
746000 -- [-1025.699] (-1026.485) (-1022.455) (-1028.580) * (-1023.794) (-1026.539) [-1027.483] (-1026.172) -- 0:00:16
746500 -- (-1022.431) (-1022.830) [-1024.673] (-1025.056) * (-1025.857) (-1029.540) [-1025.823] (-1026.542) -- 0:00:16
747000 -- (-1023.695) (-1026.581) [-1024.316] (-1029.021) * (-1023.993) (-1025.484) [-1025.377] (-1027.000) -- 0:00:16
747500 -- (-1023.411) (-1025.279) (-1029.424) [-1023.427] * (-1026.006) (-1024.572) (-1024.652) [-1027.607] -- 0:00:16
748000 -- (-1028.082) (-1025.141) [-1022.579] (-1024.799) * (-1024.231) [-1025.029] (-1023.875) (-1025.908) -- 0:00:16
748500 -- (-1031.205) (-1027.956) (-1022.553) [-1029.874] * (-1026.117) [-1025.448] (-1025.134) (-1026.274) -- 0:00:16
749000 -- [-1026.099] (-1025.214) (-1025.186) (-1024.814) * (-1024.565) (-1025.796) (-1022.915) [-1026.373] -- 0:00:16
749500 -- (-1027.166) [-1028.135] (-1024.612) (-1027.582) * (-1026.478) (-1026.357) (-1023.536) [-1024.990] -- 0:00:16
750000 -- [-1024.735] (-1025.935) (-1027.274) (-1024.959) * (-1026.886) (-1024.848) [-1023.084] (-1029.836) -- 0:00:16
Average standard deviation of split frequencies: 0.009145
750500 -- (-1025.595) [-1027.943] (-1025.960) (-1025.541) * [-1025.271] (-1024.175) (-1023.830) (-1027.344) -- 0:00:16
751000 -- [-1029.198] (-1024.630) (-1026.710) (-1027.692) * (-1024.310) (-1024.795) (-1030.612) [-1023.802] -- 0:00:16
751500 -- (-1030.682) (-1026.295) [-1026.657] (-1027.462) * (-1023.500) (-1024.505) (-1025.828) [-1023.923] -- 0:00:16
752000 -- (-1025.818) (-1026.925) [-1026.687] (-1027.566) * (-1025.513) (-1032.991) [-1025.841] (-1025.375) -- 0:00:16
752500 -- [-1026.965] (-1024.518) (-1026.743) (-1028.530) * (-1026.509) (-1024.159) (-1025.513) [-1023.575] -- 0:00:16
753000 -- [-1028.423] (-1024.142) (-1026.985) (-1027.101) * (-1024.676) (-1026.229) [-1024.277] (-1025.027) -- 0:00:16
753500 -- (-1027.676) (-1024.871) (-1028.594) [-1027.665] * (-1028.051) (-1025.518) [-1026.339] (-1024.695) -- 0:00:16
754000 -- [-1024.267] (-1027.722) (-1026.774) (-1024.195) * [-1025.059] (-1025.990) (-1027.017) (-1023.666) -- 0:00:15
754500 -- [-1027.006] (-1032.349) (-1028.915) (-1025.701) * [-1025.194] (-1025.453) (-1024.760) (-1027.601) -- 0:00:16
755000 -- [-1025.083] (-1027.005) (-1031.063) (-1028.141) * (-1028.321) [-1028.052] (-1025.124) (-1026.670) -- 0:00:16
Average standard deviation of split frequencies: 0.008847
755500 -- (-1023.761) (-1025.878) (-1025.897) [-1026.372] * (-1025.142) (-1026.670) [-1023.019] (-1026.266) -- 0:00:16
756000 -- (-1027.027) (-1025.326) (-1024.378) [-1021.629] * (-1025.167) (-1025.094) [-1026.682] (-1025.540) -- 0:00:16
756500 -- (-1025.987) (-1026.142) [-1024.335] (-1023.282) * (-1024.479) (-1026.841) [-1023.036] (-1029.208) -- 0:00:16
757000 -- [-1027.482] (-1026.812) (-1027.061) (-1024.980) * [-1023.813] (-1023.839) (-1027.295) (-1024.405) -- 0:00:16
757500 -- (-1028.133) [-1023.868] (-1024.597) (-1024.240) * [-1023.447] (-1023.840) (-1026.746) (-1024.132) -- 0:00:16
758000 -- (-1028.658) [-1023.142] (-1024.847) (-1025.216) * (-1024.642) (-1024.724) (-1023.180) [-1026.964] -- 0:00:15
758500 -- [-1033.285] (-1026.287) (-1023.599) (-1024.830) * [-1027.936] (-1025.051) (-1026.137) (-1024.913) -- 0:00:15
759000 -- (-1027.850) (-1025.165) [-1023.323] (-1026.554) * [-1025.085] (-1025.930) (-1022.909) (-1023.877) -- 0:00:15
759500 -- (-1024.060) (-1026.158) (-1025.778) [-1023.013] * (-1023.551) (-1024.745) (-1025.293) [-1024.591] -- 0:00:15
760000 -- (-1025.915) (-1029.538) (-1027.425) [-1022.186] * (-1027.513) [-1023.350] (-1025.294) (-1025.381) -- 0:00:15
Average standard deviation of split frequencies: 0.008909
760500 -- [-1025.934] (-1027.221) (-1024.259) (-1024.310) * (-1028.863) (-1025.289) (-1024.751) [-1023.673] -- 0:00:15
761000 -- (-1024.301) (-1024.805) [-1025.085] (-1028.689) * (-1025.169) (-1027.569) (-1026.067) [-1023.464] -- 0:00:15
761500 -- [-1026.938] (-1023.061) (-1026.011) (-1026.792) * (-1025.105) (-1034.320) (-1025.453) [-1024.293] -- 0:00:15
762000 -- (-1028.313) (-1023.522) (-1026.300) [-1027.808] * (-1027.061) (-1024.606) (-1028.107) [-1024.891] -- 0:00:15
762500 -- (-1025.295) (-1024.920) (-1026.139) [-1023.529] * (-1026.570) (-1023.598) (-1029.226) [-1023.632] -- 0:00:15
763000 -- (-1027.362) (-1024.275) [-1025.504] (-1029.592) * (-1025.157) (-1026.329) (-1023.986) [-1025.404] -- 0:00:15
763500 -- [-1025.011] (-1028.819) (-1025.042) (-1024.775) * (-1025.485) (-1024.036) (-1023.175) [-1022.717] -- 0:00:15
764000 -- [-1025.864] (-1024.488) (-1023.271) (-1024.970) * [-1024.983] (-1028.206) (-1025.378) (-1029.303) -- 0:00:15
764500 -- (-1023.599) [-1026.529] (-1025.320) (-1026.045) * (-1024.816) [-1025.503] (-1024.040) (-1029.424) -- 0:00:15
765000 -- [-1025.437] (-1029.961) (-1028.639) (-1024.136) * (-1024.847) (-1024.268) [-1025.094] (-1024.951) -- 0:00:15
Average standard deviation of split frequencies: 0.008654
765500 -- (-1030.114) (-1022.211) (-1027.983) [-1024.742] * (-1026.435) (-1025.148) (-1023.127) [-1026.133] -- 0:00:15
766000 -- (-1026.040) (-1025.044) [-1027.305] (-1026.765) * (-1025.160) (-1024.271) [-1024.762] (-1027.332) -- 0:00:15
766500 -- (-1025.010) (-1026.574) [-1027.987] (-1024.902) * [-1029.172] (-1024.421) (-1025.450) (-1025.935) -- 0:00:15
767000 -- (-1029.202) (-1024.511) [-1027.367] (-1026.591) * [-1024.296] (-1025.105) (-1024.630) (-1025.193) -- 0:00:15
767500 -- (-1024.426) [-1022.983] (-1024.921) (-1024.217) * (-1025.776) [-1024.828] (-1024.857) (-1024.607) -- 0:00:15
768000 -- [-1024.766] (-1023.423) (-1026.047) (-1025.916) * [-1025.035] (-1025.725) (-1026.813) (-1024.214) -- 0:00:15
768500 -- [-1024.763] (-1026.542) (-1025.006) (-1023.174) * (-1027.357) (-1027.432) (-1024.529) [-1026.090] -- 0:00:15
769000 -- (-1025.380) (-1025.693) [-1023.336] (-1024.694) * (-1026.009) (-1025.371) [-1023.688] (-1025.275) -- 0:00:15
769500 -- (-1025.459) (-1023.037) [-1024.841] (-1024.379) * (-1024.081) [-1025.266] (-1027.647) (-1025.008) -- 0:00:14
770000 -- (-1024.571) [-1024.495] (-1024.127) (-1022.807) * (-1029.082) [-1027.463] (-1027.122) (-1025.774) -- 0:00:15
Average standard deviation of split frequencies: 0.009031
770500 -- (-1029.394) [-1024.730] (-1026.908) (-1026.392) * (-1023.919) [-1021.402] (-1027.661) (-1028.721) -- 0:00:15
771000 -- (-1029.432) (-1023.360) [-1025.175] (-1024.108) * (-1025.062) [-1024.212] (-1028.394) (-1025.347) -- 0:00:15
771500 -- (-1023.969) (-1024.521) (-1026.836) [-1027.294] * (-1024.631) (-1022.705) [-1025.590] (-1025.448) -- 0:00:15
772000 -- (-1025.378) [-1024.573] (-1028.891) (-1022.552) * (-1024.850) (-1028.736) [-1023.681] (-1029.363) -- 0:00:15
772500 -- (-1025.174) [-1023.817] (-1023.029) (-1024.464) * (-1025.810) (-1023.910) [-1023.664] (-1028.110) -- 0:00:15
773000 -- (-1025.330) (-1024.038) (-1027.385) [-1023.254] * (-1024.093) (-1023.954) (-1024.074) [-1027.829] -- 0:00:14
773500 -- (-1029.103) (-1024.870) (-1023.687) [-1023.502] * [-1023.726] (-1026.512) (-1025.030) (-1027.385) -- 0:00:14
774000 -- (-1033.247) (-1024.512) [-1022.465] (-1028.138) * (-1027.365) (-1024.077) [-1025.847] (-1026.397) -- 0:00:14
774500 -- (-1032.340) (-1027.073) [-1022.312] (-1025.606) * [-1025.533] (-1024.462) (-1024.659) (-1026.288) -- 0:00:14
775000 -- (-1029.947) [-1024.752] (-1024.044) (-1026.285) * [-1023.524] (-1024.987) (-1028.233) (-1027.878) -- 0:00:14
Average standard deviation of split frequencies: 0.009005
775500 -- (-1023.687) (-1026.542) (-1023.298) [-1024.599] * (-1024.657) (-1024.888) (-1027.237) [-1024.247] -- 0:00:14
776000 -- (-1024.916) (-1027.241) [-1024.553] (-1025.314) * (-1026.402) [-1025.082] (-1026.137) (-1026.013) -- 0:00:14
776500 -- [-1023.710] (-1026.464) (-1025.876) (-1023.419) * (-1024.867) [-1024.526] (-1027.153) (-1026.484) -- 0:00:14
777000 -- (-1024.104) [-1024.604] (-1023.311) (-1024.851) * (-1024.545) (-1024.234) [-1027.057] (-1029.739) -- 0:00:14
777500 -- [-1027.494] (-1024.928) (-1024.980) (-1026.533) * (-1023.291) (-1025.790) [-1027.804] (-1027.642) -- 0:00:14
778000 -- (-1026.581) (-1025.688) (-1022.408) [-1024.621] * [-1024.862] (-1024.163) (-1025.574) (-1026.272) -- 0:00:14
778500 -- (-1024.588) (-1026.842) [-1023.134] (-1027.222) * (-1024.282) (-1024.030) (-1027.664) [-1028.023] -- 0:00:14
779000 -- (-1026.134) (-1027.204) [-1028.307] (-1023.469) * (-1028.167) (-1022.873) (-1031.358) [-1027.434] -- 0:00:14
779500 -- (-1026.081) (-1029.677) (-1025.222) [-1023.690] * (-1027.056) [-1023.117] (-1027.783) (-1029.791) -- 0:00:14
780000 -- (-1023.550) (-1028.076) [-1025.727] (-1025.738) * (-1025.680) (-1027.892) [-1026.859] (-1029.208) -- 0:00:14
Average standard deviation of split frequencies: 0.008809
780500 -- (-1024.238) (-1028.786) (-1024.670) [-1028.315] * [-1026.313] (-1025.631) (-1028.059) (-1027.847) -- 0:00:14
781000 -- (-1027.882) [-1026.816] (-1026.270) (-1027.311) * (-1026.278) (-1025.173) [-1025.910] (-1024.732) -- 0:00:14
781500 -- [-1026.020] (-1026.671) (-1025.450) (-1024.120) * (-1022.582) [-1020.889] (-1024.183) (-1025.564) -- 0:00:14
782000 -- (-1023.722) (-1026.160) (-1026.524) [-1024.926] * [-1023.521] (-1026.460) (-1026.473) (-1028.713) -- 0:00:14
782500 -- (-1024.157) (-1028.868) (-1030.367) [-1023.392] * (-1026.014) [-1024.423] (-1030.777) (-1028.269) -- 0:00:14
783000 -- (-1028.893) [-1023.487] (-1025.331) (-1024.357) * (-1023.204) (-1028.775) (-1025.548) [-1024.804] -- 0:00:14
783500 -- (-1024.252) [-1024.518] (-1026.537) (-1023.753) * (-1026.436) [-1030.316] (-1026.116) (-1025.307) -- 0:00:14
784000 -- (-1027.021) [-1023.947] (-1028.879) (-1023.964) * (-1027.420) (-1026.876) (-1023.142) [-1026.293] -- 0:00:14
784500 -- (-1024.601) (-1023.955) (-1031.453) [-1026.117] * (-1025.633) [-1025.346] (-1025.676) (-1026.869) -- 0:00:14
785000 -- (-1024.964) [-1024.517] (-1030.004) (-1029.342) * (-1025.787) (-1024.112) [-1025.741] (-1025.538) -- 0:00:14
Average standard deviation of split frequencies: 0.008679
785500 -- (-1024.565) (-1024.489) (-1025.640) [-1026.935] * (-1023.139) (-1023.982) [-1025.789] (-1033.409) -- 0:00:14
786000 -- [-1024.869] (-1024.771) (-1026.301) (-1023.879) * (-1025.523) (-1026.812) [-1024.423] (-1027.732) -- 0:00:14
786500 -- (-1025.964) [-1021.996] (-1024.536) (-1024.400) * [-1026.283] (-1024.519) (-1023.817) (-1026.717) -- 0:00:14
787000 -- [-1026.276] (-1026.200) (-1025.024) (-1024.932) * (-1029.474) (-1024.849) [-1025.799] (-1026.560) -- 0:00:14
787500 -- (-1024.630) [-1023.677] (-1031.297) (-1026.773) * (-1029.332) (-1025.137) (-1026.316) [-1025.736] -- 0:00:14
788000 -- (-1027.055) (-1024.252) [-1024.668] (-1022.699) * (-1026.859) [-1027.016] (-1025.752) (-1027.016) -- 0:00:13
788500 -- (-1026.179) (-1025.449) (-1023.668) [-1024.623] * (-1027.667) (-1023.763) [-1025.640] (-1027.469) -- 0:00:13
789000 -- (-1024.879) [-1023.255] (-1025.024) (-1026.892) * (-1026.489) (-1022.109) (-1026.922) [-1025.215] -- 0:00:13
789500 -- (-1027.993) [-1025.025] (-1030.178) (-1025.954) * (-1028.156) [-1022.761] (-1025.052) (-1025.148) -- 0:00:13
790000 -- (-1024.481) (-1023.222) (-1024.947) [-1025.470] * (-1024.896) (-1022.584) [-1024.227] (-1024.053) -- 0:00:13
Average standard deviation of split frequencies: 0.008417
790500 -- (-1022.758) (-1028.333) [-1025.612] (-1024.575) * (-1023.629) [-1023.715] (-1024.542) (-1023.385) -- 0:00:13
791000 -- (-1024.445) [-1027.543] (-1029.785) (-1024.561) * (-1024.132) (-1024.904) [-1026.285] (-1024.131) -- 0:00:13
791500 -- (-1024.406) [-1026.312] (-1026.724) (-1025.381) * (-1028.415) (-1027.531) [-1027.474] (-1026.274) -- 0:00:13
792000 -- (-1031.347) [-1025.342] (-1024.989) (-1024.477) * [-1030.881] (-1026.248) (-1028.585) (-1029.002) -- 0:00:13
792500 -- [-1030.945] (-1030.903) (-1024.186) (-1023.251) * (-1024.491) [-1024.557] (-1026.542) (-1027.334) -- 0:00:13
793000 -- (-1027.743) [-1023.272] (-1025.971) (-1024.637) * (-1024.054) (-1026.284) (-1026.877) [-1030.735] -- 0:00:13
793500 -- (-1027.378) [-1023.754] (-1028.696) (-1023.560) * (-1024.708) [-1025.495] (-1026.349) (-1028.178) -- 0:00:13
794000 -- (-1025.331) [-1025.329] (-1033.084) (-1025.096) * (-1023.703) [-1022.856] (-1026.278) (-1024.469) -- 0:00:13
794500 -- [-1028.316] (-1024.360) (-1025.601) (-1025.548) * (-1027.641) (-1023.833) [-1025.380] (-1024.702) -- 0:00:13
795000 -- (-1029.788) (-1028.254) (-1024.993) [-1027.996] * [-1024.891] (-1023.738) (-1026.133) (-1027.473) -- 0:00:13
Average standard deviation of split frequencies: 0.008217
795500 -- [-1027.770] (-1026.942) (-1032.048) (-1023.589) * (-1024.435) [-1027.755] (-1026.988) (-1023.615) -- 0:00:13
796000 -- [-1022.289] (-1025.773) (-1029.568) (-1028.085) * (-1027.439) (-1026.185) (-1028.661) [-1025.340] -- 0:00:13
796500 -- (-1027.828) (-1024.220) [-1026.241] (-1024.104) * (-1029.049) [-1024.107] (-1025.595) (-1026.706) -- 0:00:13
797000 -- (-1026.568) [-1028.451] (-1029.355) (-1027.131) * (-1024.112) (-1023.633) (-1024.954) [-1024.363] -- 0:00:13
797500 -- (-1025.038) (-1027.184) [-1025.357] (-1024.196) * (-1024.549) (-1028.246) (-1025.381) [-1023.072] -- 0:00:13
798000 -- (-1030.922) (-1027.408) [-1025.226] (-1024.432) * (-1025.492) (-1027.306) (-1025.888) [-1027.330] -- 0:00:13
798500 -- (-1029.096) (-1027.066) (-1029.847) [-1026.351] * (-1024.685) (-1024.330) (-1025.788) [-1027.196] -- 0:00:13
799000 -- (-1024.113) (-1030.414) [-1024.939] (-1024.492) * (-1028.048) (-1025.546) (-1031.380) [-1025.554] -- 0:00:13
799500 -- (-1023.233) (-1029.760) (-1023.948) [-1025.684] * [-1025.415] (-1028.032) (-1025.656) (-1025.835) -- 0:00:13
800000 -- [-1023.793] (-1028.272) (-1024.405) (-1029.097) * (-1024.475) (-1026.863) (-1023.483) [-1023.542] -- 0:00:13
Average standard deviation of split frequencies: 0.008353
800500 -- (-1023.914) (-1028.042) (-1024.749) [-1025.012] * (-1025.859) (-1026.732) (-1028.818) [-1025.329] -- 0:00:13
801000 -- (-1024.488) (-1027.081) [-1025.081] (-1025.823) * (-1026.496) (-1025.456) (-1027.364) [-1028.874] -- 0:00:13
801500 -- (-1023.842) [-1023.122] (-1024.302) (-1022.768) * (-1027.685) (-1024.744) [-1026.244] (-1024.994) -- 0:00:13
802000 -- (-1023.511) (-1023.371) [-1023.822] (-1029.410) * [-1024.232] (-1022.842) (-1030.727) (-1025.699) -- 0:00:13
802500 -- (-1022.139) (-1026.440) [-1028.696] (-1026.550) * (-1024.821) [-1023.719] (-1035.549) (-1025.347) -- 0:00:13
803000 -- [-1023.902] (-1022.833) (-1024.669) (-1025.478) * (-1030.899) [-1026.416] (-1033.499) (-1024.045) -- 0:00:13
803500 -- (-1027.676) (-1022.956) (-1024.786) [-1027.429] * [-1027.309] (-1024.151) (-1031.614) (-1024.408) -- 0:00:12
804000 -- [-1027.292] (-1023.709) (-1030.573) (-1028.815) * (-1025.108) (-1025.259) (-1031.101) [-1024.691] -- 0:00:12
804500 -- (-1023.747) (-1026.767) (-1027.359) [-1024.113] * [-1024.178] (-1027.293) (-1029.251) (-1026.211) -- 0:00:12
805000 -- (-1023.880) [-1025.493] (-1026.536) (-1026.304) * (-1026.651) [-1027.307] (-1024.560) (-1026.502) -- 0:00:12
Average standard deviation of split frequencies: 0.008444
805500 -- (-1023.689) (-1026.103) (-1033.735) [-1025.224] * (-1025.557) (-1022.701) [-1028.833] (-1026.181) -- 0:00:12
806000 -- (-1023.727) (-1030.823) [-1028.262] (-1023.655) * [-1024.319] (-1025.327) (-1026.136) (-1025.037) -- 0:00:12
806500 -- (-1022.673) [-1023.955] (-1030.364) (-1022.770) * (-1031.218) (-1024.311) (-1025.069) [-1023.689] -- 0:00:12
807000 -- (-1024.015) [-1024.767] (-1026.922) (-1023.879) * (-1030.001) [-1027.666] (-1026.266) (-1026.072) -- 0:00:12
807500 -- [-1024.651] (-1024.835) (-1025.077) (-1023.676) * (-1025.585) (-1026.780) [-1024.254] (-1030.473) -- 0:00:12
808000 -- [-1026.165] (-1024.091) (-1030.271) (-1023.391) * (-1025.697) (-1026.825) (-1025.911) [-1028.392] -- 0:00:12
808500 -- (-1029.024) (-1027.928) [-1028.404] (-1023.224) * [-1027.016] (-1025.586) (-1026.378) (-1024.678) -- 0:00:12
809000 -- (-1027.406) (-1025.096) [-1024.778] (-1026.002) * (-1027.266) (-1027.385) [-1026.021] (-1027.431) -- 0:00:12
809500 -- (-1024.974) (-1023.910) [-1024.406] (-1026.957) * [-1025.097] (-1026.142) (-1024.877) (-1026.383) -- 0:00:12
810000 -- (-1027.702) (-1032.417) (-1024.547) [-1024.243] * (-1023.375) (-1026.689) [-1027.030] (-1026.175) -- 0:00:12
Average standard deviation of split frequencies: 0.008686
810500 -- (-1026.630) [-1027.045] (-1031.347) (-1025.378) * [-1023.715] (-1023.924) (-1026.167) (-1028.246) -- 0:00:12
811000 -- [-1024.680] (-1024.194) (-1026.021) (-1026.763) * (-1028.241) (-1025.635) (-1025.417) [-1026.656] -- 0:00:12
811500 -- (-1027.743) [-1027.286] (-1025.565) (-1025.810) * (-1026.961) (-1026.214) (-1030.125) [-1027.798] -- 0:00:12
812000 -- (-1024.059) (-1024.061) (-1026.133) [-1023.825] * [-1023.029] (-1025.179) (-1027.370) (-1024.162) -- 0:00:12
812500 -- (-1024.877) (-1025.353) [-1024.883] (-1026.322) * (-1026.771) (-1022.229) (-1027.433) [-1024.501] -- 0:00:12
813000 -- (-1026.090) (-1027.352) [-1026.847] (-1025.653) * (-1025.838) (-1026.047) (-1026.408) [-1024.711] -- 0:00:12
813500 -- [-1027.449] (-1029.523) (-1027.719) (-1027.430) * (-1024.932) [-1024.782] (-1024.626) (-1026.380) -- 0:00:12
814000 -- (-1024.789) (-1028.341) [-1024.527] (-1027.355) * (-1024.706) (-1023.109) (-1025.745) [-1024.990] -- 0:00:12
814500 -- (-1025.672) (-1025.949) [-1025.532] (-1027.079) * (-1024.195) [-1027.938] (-1028.698) (-1026.486) -- 0:00:12
815000 -- (-1025.897) (-1024.120) [-1027.351] (-1024.710) * (-1030.964) (-1028.264) (-1024.192) [-1027.273] -- 0:00:12
Average standard deviation of split frequencies: 0.008196
815500 -- [-1023.376] (-1026.507) (-1023.061) (-1023.900) * (-1024.921) (-1028.744) (-1027.499) [-1024.117] -- 0:00:12
816000 -- (-1026.328) [-1026.296] (-1025.277) (-1028.211) * (-1025.632) (-1023.064) (-1026.380) [-1027.123] -- 0:00:12
816500 -- (-1028.277) [-1027.026] (-1026.122) (-1023.487) * (-1023.059) [-1029.370] (-1024.622) (-1024.930) -- 0:00:12
817000 -- (-1031.878) (-1025.411) (-1026.253) [-1024.006] * (-1026.726) (-1024.497) (-1024.329) [-1024.516] -- 0:00:12
817500 -- (-1027.373) (-1025.458) (-1024.702) [-1023.627] * [-1025.025] (-1025.798) (-1024.846) (-1024.602) -- 0:00:12
818000 -- (-1032.991) (-1028.250) (-1026.119) [-1023.861] * [-1022.320] (-1026.992) (-1025.389) (-1023.119) -- 0:00:12
818500 -- [-1024.609] (-1026.089) (-1024.485) (-1027.140) * (-1027.655) [-1022.372] (-1023.161) (-1025.996) -- 0:00:11
819000 -- (-1026.254) (-1028.437) [-1025.299] (-1025.082) * (-1024.568) (-1025.334) [-1026.028] (-1027.331) -- 0:00:11
819500 -- (-1026.966) (-1025.040) (-1026.383) [-1027.078] * (-1026.393) (-1032.071) (-1031.480) [-1024.602] -- 0:00:11
820000 -- [-1024.982] (-1027.236) (-1025.151) (-1025.695) * (-1022.985) [-1024.814] (-1024.802) (-1027.614) -- 0:00:11
Average standard deviation of split frequencies: 0.008380
820500 -- (-1024.719) (-1029.020) [-1022.385] (-1029.111) * (-1023.226) (-1025.569) (-1028.211) [-1026.513] -- 0:00:11
821000 -- [-1022.745] (-1024.982) (-1026.810) (-1026.534) * (-1023.522) (-1026.986) [-1027.771] (-1027.183) -- 0:00:11
821500 -- [-1024.956] (-1023.717) (-1026.516) (-1024.816) * (-1025.631) (-1025.733) (-1030.528) [-1025.101] -- 0:00:11
822000 -- (-1023.124) (-1025.653) (-1024.854) [-1025.681] * (-1027.307) [-1025.147] (-1027.609) (-1025.708) -- 0:00:11
822500 -- [-1026.894] (-1023.989) (-1026.086) (-1026.304) * [-1024.548] (-1025.437) (-1028.629) (-1023.573) -- 0:00:11
823000 -- (-1023.955) (-1024.640) [-1026.535] (-1026.320) * (-1024.882) (-1027.555) [-1026.737] (-1024.878) -- 0:00:11
823500 -- (-1024.558) (-1025.968) [-1025.268] (-1026.378) * (-1025.648) [-1025.785] (-1024.014) (-1024.269) -- 0:00:11
824000 -- (-1025.801) (-1026.283) [-1025.408] (-1025.411) * [-1025.245] (-1025.847) (-1024.958) (-1025.120) -- 0:00:11
824500 -- (-1025.834) [-1025.773] (-1024.105) (-1026.747) * (-1028.696) (-1026.471) (-1024.469) [-1026.296] -- 0:00:11
825000 -- (-1030.263) [-1027.407] (-1023.248) (-1024.890) * (-1026.281) [-1025.379] (-1025.134) (-1028.212) -- 0:00:11
Average standard deviation of split frequencies: 0.008762
825500 -- (-1025.670) [-1026.788] (-1025.311) (-1025.466) * (-1024.980) (-1024.790) (-1024.005) [-1024.427] -- 0:00:11
826000 -- [-1025.173] (-1026.361) (-1026.811) (-1025.507) * (-1023.685) (-1024.651) (-1025.660) [-1022.788] -- 0:00:11
826500 -- [-1025.478] (-1023.506) (-1024.324) (-1025.557) * (-1022.244) [-1025.397] (-1025.366) (-1025.951) -- 0:00:11
827000 -- (-1023.735) [-1024.579] (-1026.022) (-1026.176) * (-1023.816) (-1024.908) (-1026.973) [-1029.795] -- 0:00:11
827500 -- (-1027.738) (-1025.411) (-1025.059) [-1027.374] * (-1028.416) (-1025.911) [-1023.391] (-1025.034) -- 0:00:11
828000 -- (-1027.564) (-1027.822) [-1025.509] (-1027.668) * (-1032.164) (-1027.016) (-1025.075) [-1024.958] -- 0:00:11
828500 -- (-1028.245) (-1025.967) (-1023.468) [-1024.718] * (-1027.671) (-1026.229) (-1028.260) [-1024.314] -- 0:00:11
829000 -- (-1027.058) [-1027.766] (-1025.000) (-1026.793) * (-1024.452) (-1025.247) [-1024.879] (-1024.661) -- 0:00:11
829500 -- (-1027.565) (-1022.821) (-1025.628) [-1026.909] * (-1022.421) (-1025.887) [-1023.044] (-1023.334) -- 0:00:11
830000 -- (-1029.210) (-1026.326) (-1027.488) [-1024.003] * [-1023.389] (-1024.859) (-1023.440) (-1025.389) -- 0:00:11
Average standard deviation of split frequencies: 0.008579
830500 -- (-1023.894) [-1025.307] (-1024.307) (-1023.575) * (-1025.429) [-1022.506] (-1026.662) (-1029.538) -- 0:00:11
831000 -- [-1023.048] (-1026.197) (-1024.289) (-1027.498) * (-1027.409) (-1022.623) (-1022.984) [-1025.045] -- 0:00:11
831500 -- (-1023.551) (-1025.167) [-1025.735] (-1024.861) * (-1025.968) [-1025.230] (-1025.475) (-1029.805) -- 0:00:11
832000 -- (-1029.512) (-1023.256) [-1025.516] (-1024.709) * (-1025.274) [-1025.194] (-1025.197) (-1028.986) -- 0:00:11
832500 -- (-1031.128) [-1021.785] (-1025.544) (-1026.477) * (-1026.504) (-1026.633) [-1024.384] (-1027.594) -- 0:00:11
833000 -- (-1022.537) (-1028.225) (-1026.092) [-1026.214] * [-1026.244] (-1024.924) (-1028.526) (-1026.603) -- 0:00:11
833500 -- (-1027.284) [-1025.336] (-1023.664) (-1029.404) * (-1024.994) [-1024.304] (-1027.074) (-1027.472) -- 0:00:10
834000 -- (-1028.155) (-1025.424) [-1027.918] (-1023.624) * (-1030.068) (-1028.040) [-1024.967] (-1023.404) -- 0:00:10
834500 -- (-1023.291) (-1024.960) [-1024.861] (-1025.418) * (-1027.763) (-1027.981) (-1025.679) [-1034.396] -- 0:00:10
835000 -- (-1022.118) [-1026.196] (-1023.836) (-1029.525) * (-1027.061) (-1026.187) [-1026.365] (-1036.099) -- 0:00:10
Average standard deviation of split frequencies: 0.008670
835500 -- (-1024.516) (-1026.958) [-1025.870] (-1027.195) * (-1026.783) (-1025.173) (-1023.772) [-1028.996] -- 0:00:10
836000 -- [-1024.569] (-1024.388) (-1025.816) (-1026.393) * (-1025.765) (-1025.985) [-1025.890] (-1025.240) -- 0:00:10
836500 -- (-1023.849) (-1021.967) [-1024.314] (-1025.571) * (-1025.144) (-1023.810) (-1024.371) [-1026.082] -- 0:00:10
837000 -- (-1028.104) (-1023.499) (-1026.014) [-1026.936] * (-1029.454) (-1026.932) (-1026.365) [-1028.556] -- 0:00:10
837500 -- (-1025.753) (-1026.706) (-1024.159) [-1024.929] * (-1026.471) (-1022.925) (-1024.419) [-1027.058] -- 0:00:10
838000 -- (-1029.514) [-1022.476] (-1025.949) (-1025.462) * (-1025.198) [-1025.970] (-1023.737) (-1025.224) -- 0:00:10
838500 -- (-1024.825) [-1024.177] (-1022.245) (-1029.139) * (-1029.031) [-1028.348] (-1027.848) (-1022.690) -- 0:00:10
839000 -- [-1025.807] (-1023.513) (-1022.885) (-1026.140) * (-1026.502) (-1024.943) (-1023.342) [-1022.577] -- 0:00:10
839500 -- (-1025.374) [-1023.169] (-1025.661) (-1024.654) * (-1025.748) (-1023.626) [-1024.353] (-1025.495) -- 0:00:10
840000 -- (-1028.300) [-1022.231] (-1025.187) (-1024.402) * (-1022.699) [-1025.964] (-1025.107) (-1025.881) -- 0:00:10
Average standard deviation of split frequencies: 0.008586
840500 -- (-1026.047) (-1028.061) [-1023.773] (-1025.118) * (-1024.501) (-1025.815) (-1024.676) [-1023.827] -- 0:00:10
841000 -- (-1023.389) (-1031.432) [-1022.579] (-1024.362) * (-1027.102) (-1023.834) [-1024.775] (-1024.899) -- 0:00:10
841500 -- [-1024.561] (-1027.225) (-1026.827) (-1025.872) * (-1029.909) (-1025.311) [-1022.920] (-1025.868) -- 0:00:10
842000 -- (-1024.376) (-1027.416) (-1029.668) [-1025.561] * (-1023.507) (-1026.025) (-1023.854) [-1029.291] -- 0:00:10
842500 -- (-1022.104) (-1030.175) [-1031.231] (-1024.063) * (-1025.343) (-1025.917) (-1025.131) [-1027.895] -- 0:00:10
843000 -- (-1027.281) (-1027.087) [-1024.665] (-1024.727) * (-1027.367) (-1027.113) [-1022.734] (-1029.959) -- 0:00:10
843500 -- (-1027.198) [-1025.749] (-1026.439) (-1024.876) * (-1025.099) (-1025.492) [-1023.552] (-1025.047) -- 0:00:10
844000 -- (-1023.253) [-1024.797] (-1028.401) (-1025.325) * (-1023.669) (-1026.188) (-1023.844) [-1025.937] -- 0:00:10
844500 -- (-1024.803) (-1022.944) (-1032.209) [-1031.823] * (-1026.531) [-1025.525] (-1028.208) (-1024.839) -- 0:00:10
845000 -- (-1024.428) (-1026.411) [-1024.543] (-1025.980) * (-1027.406) (-1031.362) [-1023.449] (-1027.465) -- 0:00:10
Average standard deviation of split frequencies: 0.008567
845500 -- (-1025.017) [-1030.217] (-1023.768) (-1026.597) * [-1025.315] (-1026.788) (-1023.465) (-1027.921) -- 0:00:10
846000 -- (-1027.098) (-1029.935) (-1026.671) [-1024.794] * [-1026.387] (-1026.008) (-1022.946) (-1025.256) -- 0:00:10
846500 -- (-1025.191) (-1025.031) (-1024.641) [-1027.089] * (-1024.405) (-1027.782) [-1024.405] (-1024.862) -- 0:00:10
847000 -- (-1024.683) (-1026.802) (-1027.065) [-1026.586] * (-1026.245) [-1025.822] (-1024.678) (-1024.376) -- 0:00:10
847500 -- (-1025.409) [-1025.796] (-1028.512) (-1024.056) * (-1026.644) (-1028.078) [-1024.266] (-1024.266) -- 0:00:10
848000 -- (-1022.644) [-1025.774] (-1030.506) (-1027.237) * [-1027.646] (-1029.161) (-1024.538) (-1025.164) -- 0:00:10
848500 -- [-1024.776] (-1023.686) (-1026.909) (-1025.715) * (-1025.143) (-1024.514) (-1022.869) [-1025.300] -- 0:00:09
849000 -- (-1028.000) (-1024.566) [-1026.478] (-1026.170) * (-1025.687) (-1026.049) [-1023.813] (-1026.445) -- 0:00:09
849500 -- [-1027.015] (-1025.282) (-1026.285) (-1028.293) * (-1024.870) (-1027.079) (-1026.496) [-1026.499] -- 0:00:09
850000 -- (-1024.469) (-1026.789) (-1023.065) [-1027.297] * (-1027.602) [-1026.270] (-1025.506) (-1024.288) -- 0:00:09
Average standard deviation of split frequencies: 0.008659
850500 -- (-1022.565) (-1027.603) [-1022.845] (-1023.840) * (-1024.068) (-1025.268) (-1024.120) [-1027.327] -- 0:00:09
851000 -- [-1026.984] (-1028.006) (-1025.637) (-1027.193) * (-1028.040) [-1023.539] (-1026.255) (-1024.610) -- 0:00:09
851500 -- (-1025.694) (-1024.323) [-1025.757] (-1024.147) * (-1028.827) [-1026.268] (-1027.505) (-1027.446) -- 0:00:09
852000 -- (-1024.058) [-1025.024] (-1028.117) (-1025.576) * (-1027.110) (-1024.987) (-1025.847) [-1028.276] -- 0:00:09
852500 -- (-1026.656) (-1029.624) [-1029.247] (-1024.853) * (-1027.846) (-1027.022) (-1023.908) [-1025.591] -- 0:00:09
853000 -- (-1024.422) (-1024.187) [-1026.202] (-1026.966) * (-1024.476) (-1026.726) [-1026.855] (-1026.042) -- 0:00:09
853500 -- (-1024.875) (-1026.979) [-1021.217] (-1025.983) * (-1026.182) [-1025.168] (-1024.924) (-1027.212) -- 0:00:09
854000 -- (-1026.440) (-1026.327) (-1024.416) [-1027.038] * [-1024.958] (-1028.801) (-1023.401) (-1026.635) -- 0:00:09
854500 -- [-1030.709] (-1026.693) (-1025.116) (-1024.803) * (-1026.603) (-1027.672) (-1025.763) [-1025.610] -- 0:00:09
855000 -- [-1023.159] (-1028.845) (-1021.217) (-1027.282) * (-1022.936) [-1025.462] (-1026.182) (-1028.736) -- 0:00:09
Average standard deviation of split frequencies: 0.008708
855500 -- (-1025.198) [-1024.113] (-1024.533) (-1027.462) * [-1025.398] (-1034.655) (-1025.116) (-1026.343) -- 0:00:09
856000 -- [-1024.449] (-1025.391) (-1026.358) (-1023.915) * (-1024.218) [-1023.492] (-1024.755) (-1025.073) -- 0:00:09
856500 -- (-1024.500) (-1030.682) (-1027.820) [-1023.850] * (-1023.149) [-1025.033] (-1024.137) (-1028.453) -- 0:00:09
857000 -- [-1024.038] (-1027.241) (-1025.086) (-1023.364) * [-1022.403] (-1023.889) (-1025.434) (-1029.058) -- 0:00:09
857500 -- (-1026.062) (-1026.557) (-1023.901) [-1026.904] * (-1024.451) (-1026.704) [-1027.721] (-1022.476) -- 0:00:09
858000 -- [-1023.403] (-1023.937) (-1024.675) (-1024.844) * [-1024.871] (-1026.334) (-1024.503) (-1025.103) -- 0:00:09
858500 -- (-1023.494) [-1023.891] (-1028.545) (-1024.704) * (-1026.531) (-1026.050) [-1024.353] (-1024.503) -- 0:00:09
859000 -- (-1026.722) [-1023.878] (-1023.232) (-1025.776) * (-1025.554) (-1025.773) [-1026.177] (-1028.624) -- 0:00:09
859500 -- [-1027.305] (-1026.137) (-1024.911) (-1029.223) * (-1026.262) (-1027.743) [-1026.640] (-1027.985) -- 0:00:09
860000 -- (-1024.881) [-1026.999] (-1025.293) (-1024.466) * [-1025.263] (-1024.784) (-1024.518) (-1028.255) -- 0:00:09
Average standard deviation of split frequencies: 0.009343
860500 -- (-1026.067) (-1023.991) (-1023.906) [-1027.238] * (-1025.160) [-1027.080] (-1024.387) (-1027.781) -- 0:00:09
861000 -- [-1026.884] (-1029.526) (-1022.983) (-1024.054) * [-1026.163] (-1024.476) (-1023.625) (-1024.066) -- 0:00:09
861500 -- [-1026.531] (-1025.718) (-1023.718) (-1022.677) * (-1026.173) (-1025.482) (-1025.269) [-1025.205] -- 0:00:09
862000 -- (-1026.663) [-1025.450] (-1024.866) (-1024.236) * (-1026.946) (-1024.551) (-1025.569) [-1022.538] -- 0:00:09
862500 -- [-1028.703] (-1026.792) (-1026.976) (-1022.461) * (-1026.202) (-1024.036) (-1024.525) [-1024.498] -- 0:00:09
863000 -- (-1027.907) [-1026.504] (-1025.159) (-1024.415) * (-1025.816) [-1025.266] (-1027.137) (-1025.211) -- 0:00:09
863500 -- (-1025.245) [-1022.828] (-1025.183) (-1026.031) * (-1023.508) [-1029.357] (-1023.326) (-1026.080) -- 0:00:09
864000 -- (-1026.436) [-1023.968] (-1025.133) (-1027.582) * (-1030.992) [-1024.899] (-1022.487) (-1024.260) -- 0:00:08
864500 -- (-1023.665) [-1025.418] (-1030.866) (-1025.618) * (-1024.787) (-1027.899) (-1023.154) [-1023.675] -- 0:00:08
865000 -- (-1024.629) (-1024.122) (-1024.375) [-1033.219] * (-1025.228) (-1026.389) (-1023.580) [-1026.101] -- 0:00:08
Average standard deviation of split frequencies: 0.009062
865500 -- (-1024.656) (-1024.604) (-1024.128) [-1030.135] * (-1025.066) (-1024.683) [-1022.743] (-1024.479) -- 0:00:08
866000 -- [-1025.402] (-1025.323) (-1027.828) (-1024.089) * (-1024.327) (-1024.105) [-1025.405] (-1028.350) -- 0:00:08
866500 -- (-1027.260) (-1025.429) [-1026.379] (-1023.637) * (-1024.679) (-1028.500) [-1024.513] (-1025.847) -- 0:00:08
867000 -- (-1026.604) (-1025.223) (-1023.939) [-1023.959] * (-1024.387) (-1024.116) (-1025.790) [-1025.027] -- 0:00:08
867500 -- (-1025.630) [-1023.344] (-1026.627) (-1024.279) * (-1026.215) (-1023.682) [-1022.429] (-1024.439) -- 0:00:08
868000 -- (-1024.923) (-1024.282) (-1024.980) [-1022.939] * [-1024.917] (-1024.641) (-1022.635) (-1025.474) -- 0:00:08
868500 -- (-1025.188) (-1027.660) [-1025.229] (-1023.722) * (-1024.719) (-1024.009) (-1023.191) [-1028.335] -- 0:00:08
869000 -- (-1023.462) (-1027.607) (-1026.818) [-1028.101] * (-1026.905) (-1025.284) (-1027.474) [-1024.997] -- 0:00:08
869500 -- (-1024.687) (-1024.456) (-1024.685) [-1028.397] * (-1027.217) (-1026.389) (-1025.743) [-1024.115] -- 0:00:08
870000 -- (-1024.506) (-1022.578) [-1022.462] (-1025.121) * (-1026.718) [-1024.830] (-1024.257) (-1023.820) -- 0:00:08
Average standard deviation of split frequencies: 0.008886
870500 -- (-1023.651) (-1023.532) (-1024.255) [-1024.000] * (-1024.680) [-1024.972] (-1026.193) (-1026.554) -- 0:00:08
871000 -- (-1022.424) [-1026.298] (-1029.010) (-1025.767) * (-1024.686) (-1025.559) (-1024.862) [-1023.556] -- 0:00:08
871500 -- (-1029.182) (-1031.447) [-1028.129] (-1026.692) * (-1024.000) (-1029.178) [-1024.936] (-1026.007) -- 0:00:08
872000 -- (-1024.790) [-1022.895] (-1027.268) (-1027.880) * (-1024.363) (-1027.231) [-1026.305] (-1027.268) -- 0:00:08
872500 -- (-1025.262) (-1027.197) [-1027.138] (-1029.599) * [-1024.744] (-1026.002) (-1023.910) (-1024.870) -- 0:00:08
873000 -- [-1026.361] (-1025.045) (-1026.920) (-1026.651) * (-1022.987) [-1025.599] (-1024.108) (-1030.619) -- 0:00:08
873500 -- (-1028.559) (-1025.876) (-1024.105) [-1025.084] * (-1025.285) (-1027.940) [-1024.850] (-1023.089) -- 0:00:08
874000 -- (-1023.425) [-1024.518] (-1022.696) (-1027.207) * (-1022.993) (-1023.634) (-1023.611) [-1024.033] -- 0:00:08
874500 -- [-1026.587] (-1028.607) (-1028.158) (-1026.265) * (-1025.805) [-1023.544] (-1024.364) (-1026.395) -- 0:00:08
875000 -- [-1027.224] (-1026.580) (-1027.131) (-1029.251) * (-1025.339) [-1028.255] (-1027.462) (-1023.952) -- 0:00:08
Average standard deviation of split frequencies: 0.008969
875500 -- (-1022.492) (-1026.153) (-1027.668) [-1022.206] * (-1026.129) (-1024.753) [-1022.926] (-1024.462) -- 0:00:08
876000 -- (-1024.792) (-1024.715) (-1026.156) [-1024.707] * (-1023.470) (-1026.142) (-1026.056) [-1022.714] -- 0:00:08
876500 -- [-1030.274] (-1024.650) (-1027.495) (-1025.613) * (-1025.308) [-1028.010] (-1028.348) (-1022.730) -- 0:00:08
877000 -- (-1026.984) (-1024.460) [-1026.156] (-1026.179) * (-1023.652) (-1026.907) (-1025.150) [-1023.919] -- 0:00:08
877500 -- [-1028.512] (-1023.766) (-1030.258) (-1028.657) * (-1027.448) [-1026.692] (-1024.129) (-1026.084) -- 0:00:08
878000 -- [-1024.953] (-1023.403) (-1025.699) (-1024.922) * (-1024.066) (-1025.710) [-1025.723] (-1024.089) -- 0:00:08
878500 -- (-1030.696) (-1024.114) (-1024.077) [-1023.611] * (-1026.582) (-1024.570) [-1024.953] (-1021.608) -- 0:00:08
879000 -- (-1024.824) [-1022.384] (-1025.473) (-1026.703) * [-1022.071] (-1024.420) (-1026.256) (-1025.076) -- 0:00:07
879500 -- [-1022.709] (-1029.659) (-1023.572) (-1029.579) * (-1024.659) (-1029.955) (-1028.407) [-1026.016] -- 0:00:07
880000 -- [-1023.904] (-1026.601) (-1025.644) (-1024.528) * (-1025.389) (-1025.972) (-1029.824) [-1024.426] -- 0:00:07
Average standard deviation of split frequencies: 0.009040
880500 -- (-1022.586) [-1027.075] (-1025.584) (-1024.649) * (-1028.502) [-1026.101] (-1025.236) (-1024.415) -- 0:00:07
881000 -- (-1029.935) [-1026.858] (-1027.088) (-1023.909) * (-1026.764) (-1027.351) (-1025.270) [-1024.600] -- 0:00:07
881500 -- (-1024.319) (-1024.248) (-1024.973) [-1022.922] * (-1030.000) (-1027.923) (-1029.170) [-1023.465] -- 0:00:07
882000 -- (-1025.016) [-1025.025] (-1023.931) (-1023.062) * (-1026.059) (-1027.447) (-1027.513) [-1026.452] -- 0:00:07
882500 -- (-1023.373) (-1026.376) [-1026.832] (-1026.056) * (-1026.223) [-1023.738] (-1024.241) (-1030.049) -- 0:00:07
883000 -- [-1025.474] (-1025.058) (-1025.445) (-1026.762) * (-1029.671) [-1025.521] (-1024.882) (-1028.998) -- 0:00:07
883500 -- [-1025.345] (-1029.480) (-1023.450) (-1024.846) * [-1023.334] (-1025.514) (-1027.327) (-1023.673) -- 0:00:07
884000 -- (-1029.382) [-1023.974] (-1027.757) (-1025.094) * (-1027.464) (-1027.191) [-1023.498] (-1026.435) -- 0:00:07
884500 -- (-1025.172) (-1024.366) (-1028.055) [-1023.567] * (-1022.449) (-1028.017) [-1024.128] (-1027.620) -- 0:00:07
885000 -- (-1025.030) (-1026.782) [-1024.362] (-1022.950) * [-1024.242] (-1025.959) (-1023.655) (-1022.737) -- 0:00:07
Average standard deviation of split frequencies: 0.008454
885500 -- (-1025.206) (-1026.763) [-1029.381] (-1023.964) * (-1025.763) (-1024.003) (-1026.845) [-1024.833] -- 0:00:07
886000 -- (-1025.479) (-1026.193) [-1024.585] (-1024.027) * (-1028.539) (-1027.987) [-1024.400] (-1025.500) -- 0:00:07
886500 -- [-1022.955] (-1025.532) (-1025.397) (-1024.172) * (-1025.482) (-1028.335) (-1024.947) [-1023.683] -- 0:00:07
887000 -- (-1025.828) [-1024.664] (-1028.267) (-1024.446) * [-1025.669] (-1025.881) (-1025.055) (-1026.678) -- 0:00:07
887500 -- (-1026.314) (-1026.400) (-1028.349) [-1024.114] * (-1024.981) (-1029.709) (-1023.463) [-1024.993] -- 0:00:07
888000 -- (-1025.015) (-1026.223) (-1025.457) [-1023.901] * (-1025.209) (-1027.972) [-1024.613] (-1029.380) -- 0:00:07
888500 -- [-1025.997] (-1025.420) (-1024.078) (-1030.620) * (-1025.147) (-1023.560) (-1022.781) [-1026.990] -- 0:00:07
889000 -- [-1024.814] (-1027.169) (-1027.782) (-1026.447) * (-1023.409) (-1028.265) [-1022.654] (-1025.159) -- 0:00:07
889500 -- (-1025.765) [-1024.124] (-1025.268) (-1024.837) * (-1023.767) (-1029.539) (-1024.737) [-1027.052] -- 0:00:07
890000 -- (-1026.203) [-1025.750] (-1025.294) (-1028.462) * (-1024.388) (-1026.646) [-1023.645] (-1025.296) -- 0:00:07
Average standard deviation of split frequencies: 0.008188
890500 -- (-1026.656) (-1036.552) (-1025.049) [-1024.887] * (-1023.885) [-1023.603] (-1024.078) (-1026.518) -- 0:00:07
891000 -- (-1025.510) [-1023.896] (-1024.524) (-1028.593) * (-1025.612) (-1024.966) (-1026.322) [-1025.481] -- 0:00:07
891500 -- (-1029.798) [-1025.294] (-1025.874) (-1027.668) * [-1024.679] (-1032.050) (-1024.744) (-1022.369) -- 0:00:07
892000 -- (-1026.003) [-1026.848] (-1028.532) (-1027.409) * [-1022.566] (-1026.976) (-1024.214) (-1026.546) -- 0:00:07
892500 -- (-1024.675) [-1026.771] (-1025.299) (-1023.111) * [-1023.726] (-1024.604) (-1026.995) (-1026.569) -- 0:00:07
893000 -- (-1026.160) (-1025.005) [-1028.062] (-1025.147) * (-1023.905) [-1025.437] (-1025.151) (-1027.808) -- 0:00:07
893500 -- [-1026.400] (-1025.647) (-1026.248) (-1024.058) * (-1031.264) (-1025.789) (-1023.689) [-1024.844] -- 0:00:07
894000 -- (-1025.675) [-1026.231] (-1030.720) (-1023.335) * (-1027.629) (-1025.096) (-1027.212) [-1023.660] -- 0:00:06
894500 -- (-1026.614) (-1027.339) (-1029.701) [-1028.310] * (-1024.862) (-1025.028) [-1026.154] (-1025.943) -- 0:00:06
895000 -- [-1026.896] (-1026.589) (-1031.066) (-1031.215) * [-1024.724] (-1030.173) (-1027.969) (-1024.390) -- 0:00:06
Average standard deviation of split frequencies: 0.008139
895500 -- (-1024.658) (-1024.513) (-1032.255) [-1025.177] * (-1024.961) [-1024.860] (-1024.600) (-1023.488) -- 0:00:06
896000 -- [-1024.655] (-1026.064) (-1029.914) (-1024.814) * (-1028.226) [-1024.233] (-1023.505) (-1026.275) -- 0:00:06
896500 -- (-1026.235) (-1024.743) [-1030.584] (-1025.260) * [-1024.527] (-1025.599) (-1027.752) (-1028.608) -- 0:00:06
897000 -- [-1026.444] (-1027.796) (-1026.847) (-1029.210) * (-1024.565) (-1024.346) [-1026.487] (-1029.423) -- 0:00:06
897500 -- (-1025.033) (-1027.531) (-1024.320) [-1023.221] * (-1025.134) [-1026.698] (-1024.485) (-1030.945) -- 0:00:06
898000 -- (-1026.970) [-1025.360] (-1025.717) (-1024.987) * (-1026.172) (-1026.406) [-1024.348] (-1024.097) -- 0:00:06
898500 -- (-1026.486) (-1025.514) [-1028.651] (-1022.163) * [-1027.118] (-1026.753) (-1027.841) (-1026.607) -- 0:00:06
899000 -- (-1025.635) (-1027.443) (-1026.272) [-1027.712] * (-1024.972) (-1026.915) (-1025.815) [-1022.268] -- 0:00:06
899500 -- (-1025.426) [-1026.697] (-1027.677) (-1026.371) * (-1023.629) (-1024.463) [-1023.332] (-1023.503) -- 0:00:06
900000 -- [-1025.142] (-1027.143) (-1024.946) (-1025.174) * [-1022.717] (-1025.242) (-1025.556) (-1028.546) -- 0:00:06
Average standard deviation of split frequencies: 0.008066
900500 -- (-1022.292) [-1026.052] (-1026.261) (-1030.110) * [-1023.404] (-1026.191) (-1025.316) (-1029.760) -- 0:00:06
901000 -- (-1024.623) [-1025.903] (-1025.654) (-1025.071) * (-1027.680) [-1022.266] (-1026.570) (-1024.382) -- 0:00:06
901500 -- (-1025.058) (-1024.993) [-1027.070] (-1025.659) * [-1024.983] (-1024.880) (-1027.755) (-1026.332) -- 0:00:06
902000 -- (-1025.576) [-1022.266] (-1026.259) (-1025.029) * (-1026.944) (-1024.771) [-1028.943] (-1024.389) -- 0:00:06
902500 -- (-1026.690) [-1026.470] (-1025.543) (-1022.498) * (-1028.057) [-1025.242] (-1026.372) (-1024.544) -- 0:00:06
903000 -- (-1030.328) [-1024.068] (-1026.966) (-1026.198) * (-1026.305) [-1025.923] (-1022.730) (-1026.406) -- 0:00:06
903500 -- [-1025.262] (-1023.908) (-1025.376) (-1024.782) * (-1025.789) (-1024.278) [-1024.687] (-1025.039) -- 0:00:06
904000 -- (-1027.090) (-1024.452) [-1025.488] (-1025.783) * [-1026.246] (-1024.522) (-1024.604) (-1026.445) -- 0:00:06
904500 -- (-1027.902) (-1023.720) [-1025.318] (-1024.090) * (-1025.088) (-1024.595) [-1027.684] (-1023.690) -- 0:00:06
905000 -- (-1038.029) (-1025.665) [-1024.892] (-1025.014) * (-1025.604) (-1025.399) (-1024.853) [-1025.955] -- 0:00:06
Average standard deviation of split frequencies: 0.007743
905500 -- (-1028.300) (-1026.235) [-1022.783] (-1028.981) * (-1029.397) [-1029.428] (-1022.643) (-1025.170) -- 0:00:06
906000 -- (-1025.702) (-1027.753) [-1022.846] (-1028.476) * (-1026.434) (-1026.463) (-1025.552) [-1025.686] -- 0:00:06
906500 -- (-1025.667) (-1024.836) (-1025.406) [-1024.613] * (-1027.238) (-1025.703) (-1028.953) [-1024.727] -- 0:00:06
907000 -- (-1024.337) (-1022.909) (-1024.535) [-1027.659] * (-1028.932) [-1023.361] (-1029.624) (-1027.260) -- 0:00:06
907500 -- (-1025.895) (-1025.798) (-1027.966) [-1023.407] * (-1026.189) (-1023.661) [-1024.805] (-1025.281) -- 0:00:06
908000 -- (-1026.345) (-1029.518) [-1023.299] (-1029.380) * [-1026.139] (-1023.870) (-1024.928) (-1025.048) -- 0:00:06
908500 -- (-1025.534) (-1027.004) (-1025.843) [-1027.818] * (-1027.436) (-1028.489) (-1024.595) [-1024.655] -- 0:00:06
909000 -- (-1024.237) (-1026.584) [-1027.989] (-1026.618) * (-1027.727) (-1023.945) (-1026.464) [-1023.907] -- 0:00:06
909500 -- [-1022.596] (-1028.475) (-1025.810) (-1026.117) * (-1030.227) [-1023.801] (-1025.090) (-1026.467) -- 0:00:05
910000 -- (-1023.896) [-1024.655] (-1033.727) (-1024.870) * [-1025.844] (-1024.398) (-1026.087) (-1025.344) -- 0:00:05
Average standard deviation of split frequencies: 0.007826
910500 -- (-1023.638) [-1023.121] (-1027.379) (-1025.993) * (-1024.849) (-1024.537) (-1024.469) [-1025.696] -- 0:00:05
911000 -- (-1023.135) (-1025.201) [-1023.187] (-1026.779) * [-1025.235] (-1030.937) (-1025.331) (-1031.218) -- 0:00:05
911500 -- (-1024.666) (-1028.218) (-1023.837) [-1023.904] * (-1024.958) (-1029.775) (-1029.695) [-1023.226] -- 0:00:05
912000 -- [-1027.010] (-1025.132) (-1025.761) (-1026.238) * (-1028.079) (-1026.427) [-1027.072] (-1028.672) -- 0:00:05
912500 -- (-1025.925) (-1027.060) (-1027.057) [-1027.165] * (-1024.967) (-1025.940) (-1025.557) [-1025.305] -- 0:00:05
913000 -- (-1023.893) (-1027.133) (-1025.473) [-1025.219] * (-1024.400) [-1024.239] (-1026.604) (-1024.075) -- 0:00:05
913500 -- (-1023.968) (-1026.381) (-1025.689) [-1025.274] * (-1026.605) (-1024.956) [-1023.895] (-1025.904) -- 0:00:05
914000 -- (-1025.052) (-1027.247) (-1024.465) [-1023.560] * (-1024.984) [-1022.479] (-1026.311) (-1022.313) -- 0:00:05
914500 -- (-1025.012) (-1025.261) (-1023.806) [-1027.316] * (-1024.790) [-1025.776] (-1026.870) (-1022.340) -- 0:00:05
915000 -- (-1025.990) [-1027.160] (-1025.467) (-1030.153) * (-1024.845) (-1026.250) [-1024.997] (-1025.055) -- 0:00:05
Average standard deviation of split frequencies: 0.008177
915500 -- [-1022.661] (-1024.822) (-1029.807) (-1032.260) * (-1027.363) [-1026.590] (-1028.139) (-1027.207) -- 0:00:05
916000 -- (-1024.642) (-1028.226) [-1026.901] (-1025.906) * (-1025.094) (-1025.784) [-1025.589] (-1022.416) -- 0:00:05
916500 -- (-1030.242) [-1026.102] (-1026.964) (-1025.390) * [-1024.946] (-1024.127) (-1029.813) (-1027.588) -- 0:00:05
917000 -- [-1024.706] (-1029.595) (-1023.665) (-1024.483) * (-1025.426) (-1023.972) (-1025.345) [-1025.987] -- 0:00:05
917500 -- (-1024.711) (-1028.947) (-1022.862) [-1023.883] * (-1026.744) (-1024.084) [-1023.631] (-1023.455) -- 0:00:05
918000 -- (-1025.674) (-1025.851) [-1023.825] (-1028.153) * (-1029.399) [-1025.302] (-1033.864) (-1025.207) -- 0:00:05
918500 -- (-1025.077) (-1026.150) [-1023.678] (-1026.522) * (-1026.515) (-1023.049) (-1027.769) [-1023.870] -- 0:00:05
919000 -- [-1028.231] (-1023.861) (-1022.653) (-1021.481) * (-1025.713) (-1024.259) (-1025.727) [-1025.068] -- 0:00:05
919500 -- [-1023.630] (-1024.823) (-1026.971) (-1024.871) * (-1025.752) [-1026.547] (-1031.825) (-1026.857) -- 0:00:05
920000 -- (-1028.355) [-1023.808] (-1024.061) (-1023.491) * [-1026.662] (-1025.508) (-1029.632) (-1025.818) -- 0:00:05
Average standard deviation of split frequencies: 0.007982
920500 -- (-1027.162) (-1024.815) (-1027.142) [-1025.433] * (-1025.167) [-1025.019] (-1028.260) (-1023.030) -- 0:00:05
921000 -- [-1023.347] (-1024.229) (-1023.866) (-1025.653) * (-1025.909) (-1025.481) (-1035.232) [-1025.309] -- 0:00:05
921500 -- (-1025.850) [-1022.592] (-1025.441) (-1023.987) * [-1024.965] (-1025.987) (-1025.571) (-1023.126) -- 0:00:05
922000 -- [-1026.774] (-1023.523) (-1022.619) (-1025.852) * [-1026.936] (-1026.637) (-1028.144) (-1023.782) -- 0:00:05
922500 -- (-1024.864) (-1022.387) (-1024.633) [-1026.861] * (-1028.627) (-1027.814) [-1030.378] (-1024.310) -- 0:00:05
923000 -- (-1026.197) (-1024.554) (-1025.597) [-1027.740] * (-1027.763) [-1022.340] (-1029.211) (-1022.551) -- 0:00:05
923500 -- (-1025.791) [-1026.598] (-1029.115) (-1025.778) * [-1025.204] (-1028.503) (-1024.544) (-1027.746) -- 0:00:05
924000 -- (-1025.865) (-1029.954) (-1024.266) [-1024.001] * (-1024.053) [-1024.338] (-1029.523) (-1024.486) -- 0:00:05
924500 -- (-1027.960) (-1026.042) (-1025.538) [-1023.383] * (-1028.253) (-1023.658) [-1023.587] (-1023.777) -- 0:00:04
925000 -- [-1025.842] (-1025.375) (-1025.900) (-1026.643) * (-1029.630) (-1025.498) [-1022.755] (-1031.995) -- 0:00:04
Average standard deviation of split frequencies: 0.008315
925500 -- (-1026.367) [-1025.662] (-1024.600) (-1027.965) * [-1022.745] (-1024.439) (-1024.993) (-1025.567) -- 0:00:04
926000 -- (-1025.904) (-1023.687) [-1025.735] (-1030.867) * [-1024.127] (-1027.974) (-1027.348) (-1026.033) -- 0:00:04
926500 -- [-1024.400] (-1025.316) (-1024.982) (-1026.776) * (-1026.187) [-1024.332] (-1030.168) (-1022.880) -- 0:00:04
927000 -- [-1026.364] (-1025.893) (-1022.315) (-1025.591) * (-1027.279) (-1028.059) (-1028.702) [-1025.094] -- 0:00:04
927500 -- (-1023.698) [-1025.481] (-1023.259) (-1026.033) * [-1022.739] (-1023.574) (-1026.810) (-1026.430) -- 0:00:04
928000 -- (-1027.017) (-1031.534) [-1023.346] (-1026.869) * (-1029.190) (-1026.354) [-1023.164] (-1026.050) -- 0:00:04
928500 -- [-1023.906] (-1023.608) (-1024.379) (-1027.199) * (-1022.107) [-1025.883] (-1025.562) (-1028.353) -- 0:00:04
929000 -- (-1025.195) (-1025.321) (-1027.625) [-1024.810] * [-1023.668] (-1024.125) (-1026.264) (-1027.312) -- 0:00:04
929500 -- (-1023.669) (-1027.409) (-1024.321) [-1024.292] * [-1025.519] (-1026.800) (-1023.980) (-1025.776) -- 0:00:04
930000 -- (-1024.484) [-1025.375] (-1027.693) (-1025.219) * (-1024.664) (-1022.967) (-1024.668) [-1025.658] -- 0:00:04
Average standard deviation of split frequencies: 0.008723
930500 -- (-1022.380) (-1025.546) (-1028.832) [-1023.605] * (-1027.370) (-1025.176) [-1024.184] (-1025.609) -- 0:00:04
931000 -- (-1026.063) (-1022.855) (-1029.193) [-1027.169] * (-1026.460) (-1027.214) (-1024.834) [-1024.263] -- 0:00:04
931500 -- (-1028.030) (-1023.491) [-1028.819] (-1027.434) * (-1026.126) [-1028.354] (-1027.834) (-1024.886) -- 0:00:04
932000 -- (-1032.646) [-1021.936] (-1027.153) (-1025.958) * (-1026.382) [-1027.205] (-1024.408) (-1022.308) -- 0:00:04
932500 -- [-1026.451] (-1024.657) (-1030.142) (-1025.921) * [-1025.040] (-1025.253) (-1026.072) (-1026.473) -- 0:00:04
933000 -- (-1027.796) (-1026.736) [-1025.497] (-1031.992) * [-1023.623] (-1024.815) (-1028.999) (-1025.514) -- 0:00:04
933500 -- (-1022.524) (-1025.679) [-1024.651] (-1039.517) * (-1025.507) (-1026.164) [-1029.197] (-1025.466) -- 0:00:04
934000 -- [-1024.092] (-1026.003) (-1025.265) (-1023.471) * (-1025.996) [-1025.014] (-1028.723) (-1026.017) -- 0:00:04
934500 -- [-1024.087] (-1026.671) (-1028.326) (-1024.018) * (-1026.122) [-1027.146] (-1027.402) (-1026.491) -- 0:00:04
935000 -- (-1025.755) (-1022.259) (-1028.857) [-1024.959] * (-1025.646) (-1028.333) (-1022.971) [-1025.340] -- 0:00:04
Average standard deviation of split frequencies: 0.008534
935500 -- (-1023.918) [-1027.794] (-1032.554) (-1027.572) * [-1024.642] (-1027.285) (-1024.027) (-1028.619) -- 0:00:04
936000 -- (-1031.082) [-1025.245] (-1026.378) (-1024.379) * (-1026.124) (-1024.393) (-1023.942) [-1025.975] -- 0:00:04
936500 -- (-1027.124) (-1024.062) (-1023.913) [-1023.243] * (-1025.403) (-1023.682) (-1025.983) [-1025.774] -- 0:00:04
937000 -- (-1026.403) (-1027.896) (-1025.631) [-1025.533] * (-1024.731) [-1022.344] (-1024.384) (-1029.000) -- 0:00:04
937500 -- (-1022.890) (-1025.188) (-1024.456) [-1026.870] * [-1024.686] (-1026.160) (-1022.648) (-1024.891) -- 0:00:04
938000 -- [-1026.842] (-1026.057) (-1025.509) (-1027.517) * (-1026.342) (-1024.227) [-1021.802] (-1024.993) -- 0:00:04
938500 -- [-1025.861] (-1023.252) (-1025.246) (-1027.923) * (-1029.476) [-1023.788] (-1024.063) (-1026.289) -- 0:00:04
939000 -- (-1025.008) (-1027.039) (-1024.231) [-1023.546] * (-1027.755) (-1025.614) (-1027.017) [-1026.338] -- 0:00:04
939500 -- [-1023.768] (-1026.147) (-1024.524) (-1025.468) * (-1029.036) (-1025.034) [-1025.424] (-1025.845) -- 0:00:03
940000 -- (-1024.420) (-1025.649) [-1023.476] (-1024.537) * (-1028.636) (-1023.553) (-1025.428) [-1024.321] -- 0:00:03
Average standard deviation of split frequencies: 0.008686
940500 -- (-1026.188) (-1027.328) (-1026.050) [-1025.377] * (-1025.519) (-1023.088) (-1026.539) [-1026.251] -- 0:00:03
941000 -- (-1026.464) (-1026.310) (-1027.425) [-1026.098] * (-1028.344) (-1026.348) (-1024.977) [-1022.994] -- 0:00:03
941500 -- (-1023.863) (-1027.001) [-1028.989] (-1025.520) * (-1024.348) (-1029.817) [-1026.408] (-1025.174) -- 0:00:03
942000 -- (-1026.682) [-1026.056] (-1025.559) (-1027.863) * (-1028.474) (-1022.625) [-1029.522] (-1027.967) -- 0:00:03
942500 -- (-1026.814) (-1026.667) [-1024.710] (-1028.679) * [-1025.895] (-1026.754) (-1028.826) (-1022.822) -- 0:00:03
943000 -- [-1024.133] (-1028.068) (-1025.125) (-1026.011) * (-1023.762) [-1022.915] (-1030.473) (-1027.932) -- 0:00:03
943500 -- [-1026.277] (-1029.204) (-1026.237) (-1025.162) * (-1028.086) (-1029.097) [-1027.291] (-1025.975) -- 0:00:03
944000 -- (-1025.696) [-1024.145] (-1025.154) (-1024.944) * [-1026.635] (-1029.746) (-1025.602) (-1024.762) -- 0:00:03
944500 -- (-1024.380) (-1025.987) (-1023.764) [-1026.707] * (-1024.474) (-1029.285) (-1022.814) [-1025.821] -- 0:00:03
945000 -- [-1026.272] (-1024.151) (-1025.148) (-1026.465) * (-1025.519) [-1022.718] (-1024.920) (-1029.174) -- 0:00:03
Average standard deviation of split frequencies: 0.008610
945500 -- [-1026.149] (-1027.196) (-1024.774) (-1024.562) * (-1026.040) (-1023.718) [-1025.274] (-1023.714) -- 0:00:03
946000 -- (-1027.244) [-1025.637] (-1029.527) (-1027.795) * (-1027.678) (-1027.656) (-1025.071) [-1027.699] -- 0:00:03
946500 -- (-1025.656) (-1025.325) [-1026.265] (-1024.579) * (-1025.913) [-1022.833] (-1026.453) (-1025.601) -- 0:00:03
947000 -- (-1025.579) [-1026.088] (-1023.219) (-1030.942) * (-1028.177) [-1023.065] (-1024.082) (-1025.234) -- 0:00:03
947500 -- [-1027.659] (-1026.749) (-1027.091) (-1029.351) * (-1025.999) [-1023.843] (-1027.824) (-1025.904) -- 0:00:03
948000 -- [-1024.619] (-1026.588) (-1024.828) (-1023.700) * (-1025.368) (-1023.545) (-1026.350) [-1023.627] -- 0:00:03
948500 -- [-1024.156] (-1025.302) (-1027.470) (-1023.812) * [-1025.266] (-1025.512) (-1028.203) (-1026.983) -- 0:00:03
949000 -- [-1025.549] (-1026.342) (-1025.236) (-1022.018) * (-1028.963) (-1032.122) [-1024.852] (-1025.564) -- 0:00:03
949500 -- (-1030.516) (-1026.668) [-1023.028] (-1024.746) * (-1024.979) (-1027.298) [-1024.316] (-1024.488) -- 0:00:03
950000 -- (-1031.164) (-1024.389) [-1025.617] (-1025.857) * (-1025.643) (-1025.639) (-1025.657) [-1024.280] -- 0:00:03
Average standard deviation of split frequencies: 0.008788
950500 -- (-1032.227) (-1026.440) (-1027.668) [-1024.820] * [-1023.839] (-1023.733) (-1025.739) (-1025.766) -- 0:00:03
951000 -- [-1023.262] (-1030.041) (-1025.705) (-1024.867) * (-1027.970) (-1028.569) (-1024.353) [-1028.529] -- 0:00:03
951500 -- (-1024.460) (-1027.055) (-1023.501) [-1024.437] * (-1024.721) (-1026.834) (-1026.166) [-1025.765] -- 0:00:03
952000 -- [-1025.002] (-1030.497) (-1025.575) (-1025.454) * [-1024.177] (-1025.692) (-1023.068) (-1024.517) -- 0:00:03
952500 -- (-1025.503) (-1028.914) (-1025.459) [-1023.154] * (-1024.466) (-1022.712) (-1026.211) [-1026.510] -- 0:00:03
953000 -- (-1027.803) [-1024.685] (-1024.173) (-1022.679) * (-1024.977) (-1026.803) [-1026.252] (-1027.592) -- 0:00:03
953500 -- (-1026.623) [-1026.376] (-1026.067) (-1026.910) * (-1023.268) [-1024.236] (-1026.688) (-1025.991) -- 0:00:03
954000 -- (-1025.902) (-1025.159) [-1021.872] (-1024.987) * (-1027.456) (-1028.392) [-1025.166] (-1026.594) -- 0:00:03
954500 -- (-1026.058) (-1025.681) (-1025.586) [-1024.575] * (-1025.303) (-1034.842) [-1027.742] (-1027.930) -- 0:00:03
955000 -- (-1024.833) (-1023.722) (-1023.220) [-1025.439] * (-1024.007) (-1028.874) (-1027.860) [-1024.614] -- 0:00:02
Average standard deviation of split frequencies: 0.008958
955500 -- (-1026.691) (-1024.321) (-1028.102) [-1027.503] * (-1026.465) (-1027.305) (-1025.733) [-1027.429] -- 0:00:02
956000 -- [-1028.591] (-1026.447) (-1026.378) (-1027.505) * (-1025.724) [-1023.251] (-1026.332) (-1028.171) -- 0:00:02
956500 -- (-1033.365) (-1026.222) (-1023.527) [-1024.936] * (-1023.720) (-1023.686) [-1026.900] (-1028.379) -- 0:00:02
957000 -- (-1024.441) (-1033.705) [-1025.804] (-1026.089) * (-1025.802) (-1025.258) [-1024.818] (-1026.195) -- 0:00:02
957500 -- (-1024.618) (-1030.262) [-1025.523] (-1026.570) * [-1023.813] (-1024.750) (-1027.113) (-1026.582) -- 0:00:02
958000 -- (-1024.067) (-1029.153) (-1023.888) [-1023.463] * [-1026.199] (-1024.200) (-1024.271) (-1025.943) -- 0:00:02
958500 -- (-1023.787) (-1028.662) [-1025.174] (-1026.631) * (-1025.604) [-1024.776] (-1024.106) (-1025.611) -- 0:00:02
959000 -- [-1024.416] (-1025.407) (-1025.092) (-1026.398) * (-1025.962) [-1025.724] (-1024.796) (-1027.898) -- 0:00:02
959500 -- (-1034.577) (-1025.854) (-1023.832) [-1029.083] * [-1024.706] (-1024.752) (-1026.333) (-1029.314) -- 0:00:02
960000 -- (-1026.319) [-1024.846] (-1022.215) (-1025.383) * (-1025.060) [-1025.918] (-1024.633) (-1028.284) -- 0:00:02
Average standard deviation of split frequencies: 0.008919
960500 -- (-1023.789) (-1025.133) (-1024.643) [-1025.135] * (-1029.308) (-1024.167) (-1024.856) [-1028.706] -- 0:00:02
961000 -- (-1027.012) (-1028.559) [-1022.747] (-1026.076) * [-1026.327] (-1028.771) (-1025.931) (-1024.944) -- 0:00:02
961500 -- (-1027.932) (-1025.724) [-1023.335] (-1025.565) * [-1024.458] (-1024.879) (-1024.254) (-1027.578) -- 0:00:02
962000 -- [-1026.269] (-1022.015) (-1026.425) (-1026.344) * [-1024.619] (-1026.478) (-1025.440) (-1024.856) -- 0:00:02
962500 -- (-1025.534) [-1024.142] (-1025.604) (-1026.069) * (-1023.914) (-1025.842) (-1027.389) [-1024.961] -- 0:00:02
963000 -- (-1027.721) [-1024.980] (-1023.964) (-1026.909) * [-1025.098] (-1025.188) (-1026.304) (-1022.036) -- 0:00:02
963500 -- (-1027.750) (-1025.822) (-1023.312) [-1028.729] * (-1023.536) (-1026.131) [-1025.442] (-1029.192) -- 0:00:02
964000 -- (-1027.165) (-1027.758) [-1024.697] (-1025.755) * [-1024.376] (-1032.044) (-1026.315) (-1025.828) -- 0:00:02
964500 -- (-1029.179) [-1026.249] (-1022.334) (-1029.179) * (-1026.298) [-1023.157] (-1026.853) (-1030.095) -- 0:00:02
965000 -- (-1026.080) (-1027.330) [-1022.273] (-1026.814) * (-1024.774) [-1026.373] (-1026.910) (-1030.349) -- 0:00:02
Average standard deviation of split frequencies: 0.008755
965500 -- (-1025.176) (-1026.490) [-1025.721] (-1026.520) * (-1028.393) (-1026.279) (-1030.464) [-1025.469] -- 0:00:02
966000 -- (-1027.981) (-1031.626) [-1024.713] (-1025.540) * (-1025.381) (-1024.223) (-1027.729) [-1024.059] -- 0:00:02
966500 -- [-1026.190] (-1027.990) (-1023.105) (-1023.593) * (-1026.061) (-1023.127) (-1027.694) [-1025.224] -- 0:00:02
967000 -- (-1024.491) (-1024.912) (-1025.682) [-1026.961] * (-1025.467) (-1024.629) (-1025.673) [-1023.768] -- 0:00:02
967500 -- [-1023.341] (-1023.785) (-1025.745) (-1028.609) * (-1025.205) (-1022.323) [-1025.334] (-1025.078) -- 0:00:02
968000 -- [-1025.348] (-1027.197) (-1024.025) (-1027.253) * (-1029.476) [-1024.728] (-1025.198) (-1024.301) -- 0:00:02
968500 -- [-1025.994] (-1027.433) (-1025.438) (-1028.073) * (-1027.637) (-1025.155) [-1023.535] (-1028.594) -- 0:00:02
969000 -- [-1023.708] (-1030.990) (-1027.368) (-1026.195) * [-1026.266] (-1027.454) (-1027.002) (-1025.929) -- 0:00:02
969500 -- (-1024.883) (-1027.423) [-1025.224] (-1027.396) * (-1025.367) (-1024.760) (-1025.935) [-1022.774] -- 0:00:02
970000 -- (-1024.895) (-1027.278) [-1024.960] (-1025.019) * [-1024.361] (-1023.362) (-1025.696) (-1024.409) -- 0:00:01
Average standard deviation of split frequencies: 0.008999
970500 -- (-1026.976) (-1025.440) [-1023.407] (-1025.014) * [-1025.705] (-1022.989) (-1028.918) (-1022.431) -- 0:00:01
971000 -- (-1026.981) (-1024.907) [-1023.642] (-1023.400) * (-1025.334) (-1025.334) (-1028.896) [-1023.518] -- 0:00:01
971500 -- (-1032.722) [-1025.322] (-1026.255) (-1026.928) * (-1027.384) [-1025.625] (-1026.367) (-1024.573) -- 0:00:01
972000 -- [-1023.614] (-1026.453) (-1024.028) (-1024.676) * [-1025.013] (-1025.725) (-1026.162) (-1025.448) -- 0:00:01
972500 -- [-1026.983] (-1025.688) (-1025.718) (-1025.619) * (-1026.604) (-1028.793) (-1026.866) [-1024.403] -- 0:00:01
973000 -- (-1024.544) (-1026.333) (-1025.338) [-1022.430] * (-1029.792) (-1022.169) (-1025.005) [-1024.510] -- 0:00:01
973500 -- (-1023.675) (-1025.757) [-1025.706] (-1024.707) * (-1029.861) (-1026.189) [-1026.890] (-1024.436) -- 0:00:01
974000 -- (-1024.762) (-1025.335) [-1023.751] (-1026.541) * [-1022.386] (-1024.406) (-1027.237) (-1028.377) -- 0:00:01
974500 -- (-1025.702) [-1027.883] (-1024.455) (-1022.798) * (-1022.767) [-1024.948] (-1025.610) (-1023.605) -- 0:00:01
975000 -- [-1027.816] (-1027.198) (-1026.839) (-1026.240) * (-1024.274) [-1023.077] (-1028.123) (-1024.287) -- 0:00:01
Average standard deviation of split frequencies: 0.008875
975500 -- (-1025.360) (-1028.995) (-1023.529) [-1023.868] * (-1024.500) (-1023.677) (-1025.515) [-1023.191] -- 0:00:01
976000 -- (-1025.335) (-1025.655) [-1022.273] (-1025.479) * (-1026.654) (-1026.511) (-1025.736) [-1023.028] -- 0:00:01
976500 -- (-1029.077) [-1024.498] (-1025.479) (-1027.811) * (-1028.634) (-1030.061) (-1025.667) [-1023.595] -- 0:00:01
977000 -- [-1025.402] (-1025.090) (-1025.467) (-1022.196) * (-1026.628) [-1025.026] (-1026.943) (-1026.192) -- 0:00:01
977500 -- (-1025.086) (-1024.497) (-1026.617) [-1023.933] * (-1029.748) (-1026.397) [-1023.550] (-1028.719) -- 0:00:01
978000 -- (-1025.574) [-1022.587] (-1026.244) (-1026.178) * [-1027.080] (-1025.070) (-1024.537) (-1028.381) -- 0:00:01
978500 -- (-1025.933) (-1026.215) (-1025.234) [-1025.340] * [-1027.577] (-1026.110) (-1029.345) (-1025.055) -- 0:00:01
979000 -- (-1023.036) (-1024.659) (-1027.631) [-1026.482] * (-1026.258) (-1027.345) (-1025.496) [-1026.443] -- 0:00:01
979500 -- (-1023.548) [-1025.379] (-1024.719) (-1025.429) * [-1024.524] (-1027.312) (-1027.971) (-1028.844) -- 0:00:01
980000 -- (-1026.122) [-1025.613] (-1025.660) (-1024.817) * (-1025.753) [-1025.086] (-1023.510) (-1027.431) -- 0:00:01
Average standard deviation of split frequencies: 0.009073
980500 -- (-1030.728) (-1030.994) [-1023.906] (-1025.259) * [-1025.186] (-1024.801) (-1027.830) (-1030.682) -- 0:00:01
981000 -- (-1026.592) (-1022.672) (-1024.493) [-1024.053] * (-1024.542) [-1023.074] (-1026.476) (-1025.207) -- 0:00:01
981500 -- (-1029.104) (-1026.681) [-1025.296] (-1026.623) * (-1025.858) (-1023.630) (-1025.129) [-1022.833] -- 0:00:01
982000 -- [-1026.231] (-1025.823) (-1029.040) (-1027.288) * (-1026.851) (-1026.611) (-1025.731) [-1027.683] -- 0:00:01
982500 -- (-1028.019) [-1029.885] (-1025.566) (-1023.459) * (-1029.057) (-1027.177) (-1025.287) [-1024.279] -- 0:00:01
983000 -- (-1027.182) (-1026.574) [-1024.039] (-1031.961) * (-1026.778) [-1022.914] (-1027.733) (-1026.983) -- 0:00:01
983500 -- [-1023.902] (-1023.655) (-1026.147) (-1024.649) * (-1024.248) (-1025.439) (-1027.681) [-1025.633] -- 0:00:01
984000 -- [-1024.161] (-1026.979) (-1025.133) (-1024.963) * (-1026.337) [-1024.851] (-1026.897) (-1025.778) -- 0:00:01
984500 -- (-1024.422) (-1025.764) [-1027.200] (-1024.457) * (-1026.454) (-1024.172) (-1023.114) [-1023.253] -- 0:00:01
985000 -- [-1025.660] (-1025.334) (-1026.335) (-1022.984) * (-1026.838) (-1025.829) (-1026.975) [-1022.431] -- 0:00:00
Average standard deviation of split frequencies: 0.008725
985500 -- (-1028.618) (-1023.438) [-1024.818] (-1024.382) * [-1023.686] (-1025.409) (-1031.451) (-1026.654) -- 0:00:00
986000 -- (-1027.209) (-1028.680) (-1024.180) [-1025.620] * (-1023.777) (-1028.402) (-1026.398) [-1024.166] -- 0:00:00
986500 -- [-1026.342] (-1027.298) (-1028.323) (-1023.177) * (-1028.424) (-1025.205) (-1025.674) [-1027.015] -- 0:00:00
987000 -- (-1027.806) [-1027.138] (-1027.870) (-1025.735) * (-1025.792) [-1023.970] (-1028.200) (-1023.138) -- 0:00:00
987500 -- (-1024.640) (-1029.108) [-1027.152] (-1030.175) * (-1025.763) (-1021.824) [-1024.832] (-1023.339) -- 0:00:00
988000 -- [-1025.091] (-1023.215) (-1023.893) (-1027.500) * [-1025.672] (-1030.288) (-1027.305) (-1025.140) -- 0:00:00
988500 -- (-1026.599) (-1030.199) [-1024.865] (-1025.468) * (-1026.403) [-1029.081] (-1025.729) (-1026.442) -- 0:00:00
989000 -- [-1024.484] (-1025.980) (-1023.879) (-1029.403) * (-1026.320) (-1029.752) [-1027.572] (-1024.591) -- 0:00:00
989500 -- (-1027.618) (-1028.400) [-1025.190] (-1025.029) * (-1024.785) (-1030.036) (-1030.431) [-1024.022] -- 0:00:00
990000 -- (-1026.322) [-1026.196] (-1024.608) (-1024.159) * (-1028.983) (-1025.645) (-1026.592) [-1027.028] -- 0:00:00
Average standard deviation of split frequencies: 0.008922
990500 -- (-1026.587) (-1027.804) (-1024.084) [-1022.877] * (-1024.146) (-1024.158) [-1026.224] (-1026.508) -- 0:00:00
991000 -- (-1024.663) [-1025.329] (-1027.027) (-1027.758) * (-1025.605) (-1026.268) (-1025.523) [-1023.214] -- 0:00:00
991500 -- (-1023.683) (-1021.600) (-1026.611) [-1023.811] * (-1026.928) (-1028.419) [-1025.606] (-1025.135) -- 0:00:00
992000 -- (-1026.778) (-1024.700) [-1029.807] (-1025.171) * [-1026.609] (-1026.345) (-1023.564) (-1025.426) -- 0:00:00
992500 -- [-1024.575] (-1024.806) (-1027.394) (-1024.282) * (-1023.888) [-1023.613] (-1025.093) (-1022.810) -- 0:00:00
993000 -- (-1027.484) [-1023.665] (-1025.157) (-1025.054) * (-1026.595) (-1025.105) [-1022.337] (-1028.186) -- 0:00:00
993500 -- (-1024.288) (-1026.958) [-1022.964] (-1025.804) * (-1027.095) (-1027.732) (-1022.370) [-1026.894] -- 0:00:00
994000 -- (-1026.073) (-1026.963) (-1028.016) [-1024.440] * (-1023.309) [-1025.686] (-1023.376) (-1029.025) -- 0:00:00
994500 -- (-1027.082) (-1023.977) [-1024.547] (-1025.286) * [-1023.666] (-1029.610) (-1022.946) (-1021.849) -- 0:00:00
995000 -- [-1028.633] (-1023.514) (-1026.998) (-1025.078) * (-1029.353) [-1023.590] (-1027.999) (-1025.234) -- 0:00:00
Average standard deviation of split frequencies: 0.009052
995500 -- (-1026.073) (-1024.686) (-1022.897) [-1024.710] * (-1027.837) (-1023.301) [-1028.046] (-1024.849) -- 0:00:00
996000 -- (-1026.907) (-1027.938) [-1023.542] (-1022.435) * [-1023.475] (-1024.530) (-1027.990) (-1025.134) -- 0:00:00
996500 -- (-1028.324) (-1029.164) (-1025.208) [-1023.328] * (-1027.658) [-1023.636] (-1023.785) (-1025.480) -- 0:00:00
997000 -- (-1033.571) (-1026.117) [-1024.424] (-1024.801) * (-1028.593) (-1024.879) [-1024.825] (-1024.777) -- 0:00:00
997500 -- [-1024.578] (-1027.944) (-1025.623) (-1027.087) * (-1027.762) (-1026.119) (-1025.602) [-1025.117] -- 0:00:00
998000 -- [-1025.051] (-1025.242) (-1025.718) (-1025.611) * (-1023.468) [-1022.285] (-1025.830) (-1025.438) -- 0:00:00
998500 -- (-1025.312) (-1026.229) (-1027.010) [-1024.360] * (-1027.639) [-1024.182] (-1025.759) (-1028.347) -- 0:00:00
999000 -- (-1023.363) (-1024.693) [-1024.662] (-1026.540) * (-1025.179) [-1022.716] (-1026.510) (-1026.482) -- 0:00:00
999500 -- [-1023.397] (-1025.760) (-1025.238) (-1021.855) * (-1026.896) (-1023.548) (-1025.826) [-1023.743] -- 0:00:00
1000000 -- (-1024.879) (-1030.243) [-1029.212] (-1023.672) * (-1025.293) (-1024.324) [-1022.906] (-1023.718) -- 0:00:00
Average standard deviation of split frequencies: 0.008774
Analysis completed in 1 mins 6 seconds
Analysis used 64.96 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1020.46
Likelihood of best state for "cold" chain of run 2 was -1020.56
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.8 % ( 77 %) Dirichlet(Revmat{all})
98.4 % ( 98 %) Slider(Revmat{all})
27.8 % ( 22 %) Dirichlet(Pi{all})
29.2 % ( 20 %) Slider(Pi{all})
67.8 % ( 43 %) Multiplier(Alpha{1,2})
79.2 % ( 56 %) Multiplier(Alpha{3})
25.3 % ( 27 %) Slider(Pinvar{all})
97.3 % ( 98 %) ExtSPR(Tau{all},V{all})
68.9 % ( 75 %) ExtTBR(Tau{all},V{all})
98.2 % (100 %) NNI(Tau{all},V{all})
88.0 % ( 85 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
94.9 % ( 95 %) Nodeslider(V{all})
30.5 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 67 %) Dirichlet(Revmat{all})
98.4 % ( 99 %) Slider(Revmat{all})
27.1 % ( 19 %) Dirichlet(Pi{all})
29.5 % ( 33 %) Slider(Pi{all})
67.1 % ( 39 %) Multiplier(Alpha{1,2})
79.2 % ( 54 %) Multiplier(Alpha{3})
26.2 % ( 14 %) Slider(Pinvar{all})
97.2 % ( 96 %) ExtSPR(Tau{all},V{all})
69.0 % ( 72 %) ExtTBR(Tau{all},V{all})
98.2 % ( 98 %) NNI(Tau{all},V{all})
87.9 % ( 84 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
94.7 % ( 97 %) Nodeslider(V{all})
30.7 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166838 0.82 0.66
3 | 166195 167297 0.83
4 | 166186 166527 166957
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.48
2 | 166568 0.82 0.66
3 | 166536 166181 0.83
4 | 166720 167488 166507
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1024.53
| 1 2 |
| 1 2 |
| 2 2 1 2 22 |
| 2* 2 12 2 2 1 2 * 1 1 2|
|2 1 1 1 2 2 2 2211 1|
| 11 1 2 21 2 1 1 1 1 |
|11 1 2 22 * 2 2 121 2 1 2 1 * |
| 2 * 1 1 2 1 2 1 2 2 1 |
| 2 1 1 1 1 |
| 1 1 1 2 2 2 12 |
| 2 2 2 2 1 *11 |
| 21 1 1 2 1 2 * |
| 2 |
| 2 1 1 1 |
| 2 1 2 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1026.08
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1024.15 -1028.99
2 -1024.16 -1027.88
--------------------------------------
TOTAL -1024.15 -1028.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.874790 0.087177 0.344641 1.433962 0.847467 1501.00 1501.00 1.000
r(A<->C){all} 0.151304 0.017505 0.000054 0.420756 0.115148 167.45 245.08 1.004
r(A<->G){all} 0.169547 0.019921 0.000133 0.454036 0.135127 321.75 335.25 1.000
r(A<->T){all} 0.153898 0.017709 0.000060 0.425084 0.119090 141.77 180.52 1.001
r(C<->G){all} 0.208833 0.026647 0.000412 0.544682 0.166682 152.36 217.47 1.002
r(C<->T){all} 0.143778 0.017416 0.000215 0.435289 0.104400 265.92 284.81 1.000
r(G<->T){all} 0.172639 0.020888 0.000011 0.451814 0.135088 209.71 266.94 1.001
pi(A){all} 0.194627 0.000211 0.166867 0.223565 0.194463 1164.88 1194.64 1.000
pi(C){all} 0.276118 0.000262 0.244572 0.307426 0.275793 1278.40 1348.74 1.000
pi(G){all} 0.324623 0.000295 0.291474 0.358626 0.324028 1231.67 1249.37 1.000
pi(T){all} 0.204632 0.000215 0.176043 0.232981 0.204702 1064.51 1155.74 1.000
alpha{1,2} 0.289203 0.109145 0.000557 0.978628 0.182930 1376.15 1438.57 1.000
alpha{3} 0.404260 0.232958 0.000124 1.384001 0.232148 1169.04 1285.71 1.000
pinvar{all} 0.995225 0.000016 0.987648 0.999902 0.996382 1007.55 1183.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- ..****
9 -- .***.*
10 -- .**...
11 -- .*..*.
12 -- ..*.*.
13 -- .*.***
14 -- ..**..
15 -- .****.
16 -- .*...*
17 -- ..*..*
18 -- .**.**
19 -- .*.*..
20 -- ....**
21 -- ...**.
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 455 0.151566 0.022141 0.135909 0.167222 2
8 448 0.149234 0.003769 0.146569 0.151899 2
9 442 0.147235 0.003769 0.144570 0.149900 2
10 440 0.146569 0.004711 0.143238 0.149900 2
11 439 0.146236 0.002355 0.144570 0.147901 2
12 436 0.145237 0.014133 0.135243 0.155230 2
13 432 0.143904 0.001884 0.142572 0.145237 2
14 430 0.143238 0.016959 0.131246 0.155230 2
15 428 0.142572 0.002827 0.140573 0.144570 2
16 427 0.142239 0.004240 0.139241 0.145237 2
17 423 0.140906 0.008009 0.135243 0.146569 2
18 415 0.138241 0.009893 0.131246 0.145237 2
19 413 0.137575 0.015546 0.126582 0.148568 2
20 401 0.133578 0.008951 0.127249 0.139907 2
21 390 0.129913 0.002827 0.127915 0.131912 2
22 277 0.092272 0.018373 0.079280 0.105263 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.091380 0.008829 0.000024 0.279202 0.063711 1.001 2
length{all}[2] 0.093252 0.009877 0.000032 0.297932 0.061012 1.000 2
length{all}[3] 0.090401 0.008798 0.000007 0.274925 0.061992 1.001 2
length{all}[4] 0.087939 0.007794 0.000008 0.272511 0.059776 1.000 2
length{all}[5] 0.090338 0.008126 0.000031 0.273334 0.062011 1.000 2
length{all}[6] 0.146335 0.015543 0.000051 0.394476 0.113781 1.001 2
length{all}[7] 0.094175 0.008457 0.000286 0.274301 0.065136 1.000 2
length{all}[8] 0.092422 0.008951 0.000160 0.311246 0.065083 1.002 2
length{all}[9] 0.087814 0.007315 0.000238 0.255192 0.061739 0.998 2
length{all}[10] 0.090303 0.007795 0.000010 0.266776 0.065431 0.998 2
length{all}[11] 0.088415 0.007680 0.000077 0.260987 0.060684 0.999 2
length{all}[12] 0.092991 0.009531 0.000289 0.268195 0.063065 0.999 2
length{all}[13] 0.085024 0.009351 0.000102 0.253809 0.055485 1.000 2
length{all}[14] 0.091771 0.008969 0.000356 0.286855 0.057184 1.003 2
length{all}[15] 0.097239 0.009468 0.000257 0.286503 0.060803 1.002 2
length{all}[16] 0.091382 0.007766 0.000000 0.272385 0.064706 0.998 2
length{all}[17] 0.094953 0.009345 0.000489 0.269556 0.066448 0.998 2
length{all}[18] 0.092964 0.008246 0.000058 0.273375 0.062872 0.998 2
length{all}[19] 0.089808 0.008135 0.000114 0.269767 0.059144 0.998 2
length{all}[20] 0.092540 0.008250 0.000095 0.280163 0.063339 0.998 2
length{all}[21] 0.092024 0.010225 0.000072 0.295883 0.062259 0.997 2
length{all}[22] 0.091193 0.006837 0.000012 0.249027 0.066992 1.009 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008774
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.009
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/---------------------------------------- C1 (1)
|
|--------------------------------------- C2 (2)
|
|--------------------------------------- C3 (3)
+
|-------------------------------------- C4 (4)
|
|--------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 741
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 247 / 247 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 247 / 247 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.108960 0.060110 0.033897 0.069996 0.091076 0.045235 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1076.452728
Iterating by ming2
Initial: fx= 1076.452728
x= 0.10896 0.06011 0.03390 0.07000 0.09108 0.04524 0.30000 1.30000
1 h-m-p 0.0000 0.0001 586.0819 ++ 1029.119977 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3921.6929 ++ 1002.886617 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 2442.2051 ++ 995.347044 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0001 275.5727 ++ 984.754927 m 0.0001 46 | 4/8
5 h-m-p 0.0000 0.0000 758429.1266 ++ 980.153096 m 0.0000 57 | 5/8
6 h-m-p 0.0043 0.5621 0.6251 ++++ 979.854826 m 0.5621 70 | 6/8
7 h-m-p 1.6000 8.0000 0.0282 YYCC 979.805428 3 0.6016 88 | 6/8
8 h-m-p 0.1722 8.0000 0.0986 +++ 979.754013 m 8.0000 102 | 6/8
9 h-m-p 1.2201 8.0000 0.6468 ++ 979.682917 m 8.0000 115 | 6/8
10 h-m-p 1.6000 8.0000 0.5656 YC 979.676737 1 3.9351 129 | 6/8
11 h-m-p 1.6000 8.0000 0.9368 +CC 979.666712 1 5.8825 145 | 6/8
12 h-m-p 1.6000 8.0000 2.3426 YCC 979.661310 2 2.7903 161 | 6/8
13 h-m-p 1.6000 8.0000 3.3030 YC 979.656987 1 3.7156 173 | 6/8
14 h-m-p 1.6000 8.0000 4.8713 YC 979.654530 1 2.9464 185 | 6/8
15 h-m-p 1.6000 8.0000 7.0175 YC 979.652652 1 3.6295 197 | 6/8
16 h-m-p 1.6000 8.0000 10.8362 YC 979.651488 1 3.0586 209 | 6/8
17 h-m-p 1.6000 8.0000 15.5743 YC 979.650651 1 3.4432 221 | 6/8
18 h-m-p 1.6000 8.0000 23.5230 YC 979.650109 1 3.1868 233 | 6/8
19 h-m-p 1.6000 8.0000 34.0850 YC 979.649736 1 3.2951 245 | 6/8
20 h-m-p 1.6000 8.0000 50.7986 YC 979.649484 1 3.3211 257 | 6/8
21 h-m-p 1.2758 6.3791 75.6256 +YC 979.649313 1 3.1945 270 | 6/8
22 h-m-p 0.4296 2.1482 112.1081 ++ 979.649209 m 2.1482 281 | 7/8
23 h-m-p 1.6000 8.0000 0.0000 Y 979.649208 0 0.9615 292 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 ----Y 979.649208 0 0.0003 308
Out..
lnL = -979.649208
309 lfun, 309 eigenQcodon, 1854 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.078781 0.031156 0.014704 0.018920 0.081783 0.075891 0.000100 0.692049 0.379239
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.865902
np = 9
lnL0 = -1047.309812
Iterating by ming2
Initial: fx= 1047.309812
x= 0.07878 0.03116 0.01470 0.01892 0.08178 0.07589 0.00011 0.69205 0.37924
1 h-m-p 0.0000 0.0000 560.5919 ++ 1046.414704 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 475.4333 +++ 1020.025433 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0000 564.6238 ++ 1016.278183 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 74844.4404 ++ 1008.214080 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 4332.8773 ++ 986.830009 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 18881.3826 ++ 986.166674 m 0.0000 75 | 6/9
7 h-m-p 0.0009 0.0283 7.5581 ++CYYYYYCCCC 980.345234 10 0.0251 104 | 6/9
8 h-m-p 0.2672 1.3361 0.5041 CCCC 980.160380 3 0.4635 122 | 6/9
9 h-m-p 0.0835 0.4176 1.5499 +YCCC 979.977250 3 0.2132 143 | 6/9
10 h-m-p 0.1101 0.5507 0.3320 ++ 979.926261 m 0.5507 155 | 7/9
11 h-m-p 0.0445 0.2226 0.6762 ++ 979.883866 m 0.2226 170 | 8/9
12 h-m-p 0.2789 6.0559 0.0008 +YCC 979.874157 2 0.7715 188 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 C 979.874157 0 2.2930 201 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 ---Y 979.874157 0 0.0048 217 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 ---------Y 979.874157 0 0.0000 239
Out..
lnL = -979.874157
240 lfun, 720 eigenQcodon, 2880 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.058838 0.106627 0.046020 0.072868 0.043873 0.063897 0.000100 0.912714 0.126572 0.318024 1141.203446
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.052805
np = 11
lnL0 = -1023.669396
Iterating by ming2
Initial: fx= 1023.669396
x= 0.05884 0.10663 0.04602 0.07287 0.04387 0.06390 0.00011 0.91271 0.12657 0.31802 951.42857
1 h-m-p 0.0000 0.0000 118.1055 ++ 1023.636157 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0199 33.7564 +++++ 1004.766949 m 0.0199 33 | 2/11
3 h-m-p 0.0000 0.0001 155.5415 ++ 1004.311243 m 0.0001 47 | 3/11
4 h-m-p 0.0001 0.0010 123.7178 ++ 1001.869514 m 0.0010 61 | 4/11
5 h-m-p 0.0000 0.0000 7925.8875 ++ 1000.105313 m 0.0000 75 | 5/11
6 h-m-p 0.0001 0.0004 297.9219 ++ 997.559564 m 0.0004 89 | 6/11
7 h-m-p 0.0234 0.2660 4.5461 ++ 985.562921 m 0.2660 103 | 6/11
8 h-m-p 0.0670 0.3351 2.4238 YYCYYCYYCC 979.657900 10 0.0197 130 | 6/11
9 h-m-p 1.6000 8.0000 0.0049 ++ 979.657661 m 8.0000 144 | 6/11
10 h-m-p 0.0407 8.0000 0.9680 +++YYC 979.652834 2 2.2395 168 | 6/11
11 h-m-p 1.6000 8.0000 0.0007 ++ 979.652823 m 8.0000 187 | 6/11
12 h-m-p 0.0160 8.0000 0.7624 +++CC 979.651585 1 1.2061 211 | 6/11
13 h-m-p 1.6000 8.0000 0.1798 YC 979.651319 1 3.5370 231 | 6/11
14 h-m-p 1.6000 8.0000 0.0414 Y 979.651316 0 1.0589 250 | 6/11
15 h-m-p 1.6000 8.0000 0.0009 ++ 979.651308 m 8.0000 269 | 6/11
16 h-m-p 0.0627 8.0000 0.1170 ++YC 979.651059 1 1.9421 291 | 6/11
17 h-m-p 1.4590 8.0000 0.1557 ++ 979.649996 m 8.0000 310 | 6/11
18 h-m-p 0.2303 1.1516 0.8643 ++ 979.649609 m 1.1516 329 | 7/11
19 h-m-p 1.0209 8.0000 0.9492 ++ 979.649223 m 8.0000 348 | 7/11
20 h-m-p 1.6000 8.0000 0.0414 Y 979.649223 0 1.1101 366 | 7/11
21 h-m-p 1.3992 8.0000 0.0329 ++ 979.649223 m 8.0000 384 | 7/11
22 h-m-p 0.8424 8.0000 0.3120 ++ 979.649221 m 8.0000 402 | 7/11
23 h-m-p 1.6000 8.0000 0.5267 C 979.649221 0 2.3069 420 | 7/11
24 h-m-p 1.6000 8.0000 0.3034 C 979.649221 0 1.9141 438 | 7/11
25 h-m-p 0.9010 8.0000 0.6447 ++ 979.649221 m 8.0000 456 | 7/11
26 h-m-p 1.6000 8.0000 0.2599 C 979.649221 0 1.9231 474 | 7/11
27 h-m-p 1.6000 8.0000 0.1519 Y 979.649221 0 0.2232 492 | 7/11
28 h-m-p 0.1489 8.0000 0.2278 Y 979.649221 0 0.0736 510 | 7/11
29 h-m-p 0.0506 8.0000 0.3312 ---C 979.649221 0 0.0002 531 | 7/11
30 h-m-p 0.0160 8.0000 0.0056 --------Y 979.649221 0 0.0000 557 | 7/11
31 h-m-p 0.0160 8.0000 0.0105 -------Y 979.649221 0 0.0000 582 | 7/11
32 h-m-p 0.0160 8.0000 0.0114 ----------N 979.649221 0 0.0000 610 | 7/11
33 h-m-p 0.0160 8.0000 0.0000 -----Y 979.649221 0 0.0000 633 | 7/11
34 h-m-p 0.0160 8.0000 0.0001 +Y 979.649221 0 0.1193 652
Out..
lnL = -979.649221
653 lfun, 2612 eigenQcodon, 11754 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -984.589627 S = -983.150751 -2.367443
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:05
did 20 / 56 patterns 0:05
did 30 / 56 patterns 0:05
did 40 / 56 patterns 0:05
did 50 / 56 patterns 0:05
did 56 / 56 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.050738 0.045574 0.053201 0.081782 0.036140 0.057339 0.000100 0.585545 1.188530
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.997774
np = 9
lnL0 = -1050.898782
Iterating by ming2
Initial: fx= 1050.898782
x= 0.05074 0.04557 0.05320 0.08178 0.03614 0.05734 0.00011 0.58554 1.18853
1 h-m-p 0.0000 0.0000 526.8605 ++ 1050.490886 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0004 186.5791 ++YCYYYYYYYC 1042.013767 9 0.0003 39 | 1/9
3 h-m-p 0.0006 0.0053 105.1350 ++ 1011.340933 m 0.0053 51 | 1/9
4 h-m-p 0.1006 8.0000 5.5446 -YCYCCC 1010.709049 5 0.0031 72 | 1/9
5 h-m-p 0.0007 0.0035 2.8429 -----------.. | 1/9
6 h-m-p 0.0000 0.0000 1263.7092 ++ 1002.214524 m 0.0000 105 | 2/9
7 h-m-p 0.0000 0.0000 519.1038 ++ 994.073198 m 0.0000 117 | 3/9
8 h-m-p 0.0000 0.0000 910764.5691 ++ 990.728554 m 0.0000 129 | 4/9
9 h-m-p 0.0000 0.0000 629.8908 ++ 989.646648 m 0.0000 141 | 5/9
10 h-m-p 0.0000 0.0000 1146.4441 ++ 983.523741 m 0.0000 153 | 6/9
11 h-m-p 0.0023 1.1704 1.0612 +++++ 979.925158 m 1.1704 168 | 7/9
12 h-m-p 1.6000 8.0000 0.0001 CC 979.923459 1 2.1086 182 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 Y 979.923459 0 2.7569 196 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ++ 979.923458 m 8.0000 210 | 7/9
15 h-m-p 0.1941 8.0000 0.0001 ++Y 979.923453 0 4.7442 226 | 7/9
16 h-m-p 0.9959 8.0000 0.0003 ++ 979.922404 m 8.0000 240 | 7/9
17 h-m-p 0.9601 8.0000 0.0023 ----------------.. | 7/9
18 h-m-p 0.0000 0.0010 4.6711 YC 979.922188 1 0.0000 283 | 7/9
19 h-m-p 0.0003 0.1612 1.9620 ++YYYYYC 979.896945 5 0.0051 302 | 7/9
20 h-m-p 1.6000 8.0000 0.0002 YC 979.896412 1 1.0111 315 | 7/9
21 h-m-p 1.2466 8.0000 0.0001 ++ 979.896393 m 8.0000 329 | 7/9
22 h-m-p 1.3428 8.0000 0.0009 +Y 979.896380 0 3.5539 344 | 7/9
23 h-m-p 1.6000 8.0000 0.0004 C 979.896377 0 1.4909 358 | 7/9
24 h-m-p 1.3631 8.0000 0.0004 ++ 979.896376 m 8.0000 372 | 7/9
25 h-m-p 1.6000 8.0000 0.0005 C 979.896376 0 1.5431 386 | 7/9
26 h-m-p 1.6000 8.0000 0.0005 +Y 979.896376 0 4.1616 401 | 7/9
27 h-m-p 1.6000 8.0000 0.0011 ++ 979.896372 m 8.0000 415 | 7/9
28 h-m-p 0.9776 5.4788 0.0093 ------------Y 979.896372 0 0.0000 441 | 7/9
29 h-m-p 0.0160 8.0000 0.0001 +++Y 979.896372 0 0.6519 458 | 7/9
30 h-m-p 0.5713 8.0000 0.0001 ++ 979.896370 m 8.0000 472 | 7/9
31 h-m-p 0.4472 8.0000 0.0022 ------------N 979.896370 0 0.0000 498 | 7/9
32 h-m-p 0.0160 8.0000 0.0000 ++Y 979.896370 0 0.5053 514 | 7/9
33 h-m-p 0.4320 8.0000 0.0000 +++ 979.896370 m 8.0000 529 | 7/9
34 h-m-p 0.1047 8.0000 0.0027 ++++ 979.894153 m 8.0000 545 | 7/9
35 h-m-p 0.6718 3.3589 0.0221 ----------------.. | 7/9
36 h-m-p 0.0000 0.0008 5.0334 YC 979.893933 1 0.0000 588 | 7/9
37 h-m-p 0.0160 8.0000 0.3928 ++YC 979.874215 1 0.6137 603 | 7/9
38 h-m-p 1.6000 8.0000 0.0001 YC 979.874165 1 0.9581 618 | 7/9
39 h-m-p 0.8326 8.0000 0.0001 +C 979.874165 0 3.9499 633 | 7/9
40 h-m-p 0.5677 8.0000 0.0005 ++ 979.874165 m 8.0000 647 | 7/9
41 h-m-p 0.7996 8.0000 0.0047 ++ 979.874163 m 8.0000 661 | 7/9
42 h-m-p 1.1960 8.0000 0.0315 +C 979.874158 0 4.7842 676 | 7/9
43 h-m-p 1.6000 8.0000 0.0228 C 979.874157 0 2.3806 690 | 7/9
44 h-m-p 1.3824 8.0000 0.0393 ++ 979.874156 m 8.0000 704 | 7/9
45 h-m-p 1.6000 8.0000 0.0734 C 979.874155 0 1.8037 718 | 7/9
46 h-m-p 1.4812 8.0000 0.0894 ++ 979.874155 m 8.0000 732 | 7/9
47 h-m-p 1.6000 8.0000 0.1857
QuantileBeta(0.85, 2.91658, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
C 979.874155 0 2.2314 746
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14261, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14273, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.14249, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
48 h-m-p 1.5590 8.0000 0.2658
QuantileBeta(0.85, 2.55692, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.79983, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
+ 979.874155 m 8.0000 760
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26884, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26850, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26867, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
49 h-m-p 1.6000 8.0000 0.3681
QuantileBeta(0.85, 4.85765, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.62458, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
C 979.874155 0 1.3462 774
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76441, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76405, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.76423, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
50 h-m-p 0.7081 8.0000 0.6998
QuantileBeta(0.85, 5.25980, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.74649, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.36279, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
Y 979.874155 0 2.3034 789
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37641, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37599, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 6.37620, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
51 h-m-p 1.6000 8.0000 0.8672
QuantileBeta(0.85, 7.76369, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.92615, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 13.31364, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
C 979.874155 0 5.5017 804
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14749, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14690, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.14719, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
52 h-m-p 1.6000 8.0000 0.5769
QuantileBeta(0.85, 12.07026, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.83944, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
Y 979.874155 0 1.0624 818
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76042, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.75980, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
53 h-m-p 0.3502 8.0000 1.7504
QuantileBeta(0.85, 12.37303, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 14.21178, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 21.56680, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
Y 979.874155 0 1.0922 833
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67184, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
54 h-m-p 1.1196 8.0000 1.7075
QuantileBeta(0.85, 11.76011, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.19391, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.55235, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.64197, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.66437, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.66997, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67137, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67165, 0.00500) = 1.000000e+00 2000 rounds
Y 979.874155 0 0.0001 851
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67173, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67172, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
55 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 13.67181, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
C 979.874155 0 0.5373 863
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67209, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67141, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
56 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 13.67177, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
C 979.874155 0 0.0000 886
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -979.874155
887 lfun, 9757 eigenQcodon, 53220 P(t)
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 13.67175, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:19
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.069871 0.073980 0.016405 0.014224 0.053723 0.084476 0.000100 0.900000 1.054615 1.372564 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.113736
np = 11
lnL0 = -1001.668824
Iterating by ming2
Initial: fx= 1001.668824
x= 0.06987 0.07398 0.01641 0.01422 0.05372 0.08448 0.00011 0.90000 1.05461 1.37256 951.42857
1 h-m-p 0.0000 0.0000 185.6292 ++ 1001.569923 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 8124.0775 ++ 988.472799 m 0.0000 30 | 2/11
3 h-m-p 0.0001 0.0003 31.9444 ++ 987.439228 m 0.0003 44 | 3/11
4 h-m-p 0.0004 0.0029 26.1000 ++ 984.376654 m 0.0029 58 | 4/11
5 h-m-p 0.0006 0.0029 14.4536 ++ 982.833461 m 0.0029 72 | 5/11
6 h-m-p 0.0000 0.0000 354.2971 ++ 982.515249 m 0.0000 86 | 6/11
7 h-m-p 0.0006 0.0221 5.7559 ++CYYCYYYYCY 980.178922 10 0.0209 116 | 6/11
8 h-m-p 0.0102 0.0510 0.7345 YCC 980.176037 2 0.0062 133 | 6/11
9 h-m-p 0.0193 2.5393 0.2361 +++YYYC 980.050087 3 1.1194 158 | 6/11
10 h-m-p 0.2740 1.6362 0.9646 CCC 979.987433 2 0.3302 181 | 6/11
11 h-m-p 0.2160 1.1311 1.4744 +
QuantileBeta(0.85, 2.83893, 0.00500) = 1.000000e+00 2000 rounds
CCCC 979.760598 3 0.7894 207 | 6/11
12 h-m-p 0.9002 4.5010 0.1022 +
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
+ 979.725206 m 4.5010 221
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78211, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78184, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.78197, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
13 h-m-p 0.7686 6.7950 0.4467
QuantileBeta(0.85, 3.12533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.15540, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31494, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.73517, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.37588, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.55553, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38813, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 3.47183, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
C 979.702333 3 1.3609 246
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.39010, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38979, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.38994, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
14 h-m-p 1.6000 8.0000 0.2437
QuantileBeta(0.85, 3.77988, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.94968, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.33961, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.50969, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 4.49533, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 4.13760, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
C 979.684094 2 4.4451 268
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47343, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47308, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.47325, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
15 h-m-p 1.6000 8.0000 0.5268
QuantileBeta(0.85, 5.31617, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.84492, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.54971, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 6.69732, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.70616, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 6.20174, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
C 979.672369 2 2.3893 290
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73180, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.73200, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
16 h-m-p 1.6000 8.0000 0.6543
QuantileBeta(0.85, 6.77883, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 9.91930, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.96613, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.73496, 0.00500) = 1.000000e+00 2000 rounds
Y
QuantileBeta(0.85, 8.68177, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 7.73030, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
C 979.663627 2 4.3683 312
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59031, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.58980, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.59005, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
17 h-m-p 1.6000 8.0000 1.3340
QuantileBeta(0.85, 10.72438, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 17.12735, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.37885, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 13.92586, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
Y 979.659258 1 1.5460 332
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65229, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.65228, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
18 h-m-p 1.6000 8.0000 1.1998
QuantileBeta(0.85, 12.57196, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 18.33100, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
+ 979.653843 m 8.0000 346
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25069, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 20.25068, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
19 h-m-p 1.6000 8.0000 3.1605
QuantileBeta(0.85, 25.30745, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 40.47777, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.51999, 0.00500) = 1.000000e+00 2000 rounds
C
QuantileBeta(0.85, 22.38533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
Y 979.652865 1 1.4231 362
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74835, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 24.74834, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
20 h-m-p 1.5504 8.0000 2.9009
QuantileBeta(0.85, 29.24601, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 42.73900, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
+ 979.650949 m 8.0000 376
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95557, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 47.95555, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
21 h-m-p 1.4438 7.2188 7.0711
QuantileBeta(0.85, 58.16444, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
C 979.650368 0 1.4997 390
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.56000, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 58.55997, 0.00500) = 1.000000e+00 2000 rounds
| 7/11
22 h-m-p 1.2039 6.0194 6.7184 ++ 979.649671 m 6.0194 404 | 7/11
23 h-m-p 0.0000 0.0000 20.1909
h-m-p: 0.00000000e+00 0.00000000e+00 2.01908970e+01 979.649671
.. | 7/11
24 h-m-p 0.0160 8.0000 0.4013 ----C 979.649670 0 0.0000 433 | 7/11
25 h-m-p 0.0001 0.0005 0.0018 ++ 979.649670 m 0.0005 451 | 7/11
26 h-m-p 0.0016 0.8078 0.5936 +++++ 979.649222 m 0.8078 472 | 8/11
27 h-m-p 0.2099 1.0494 0.0002 ---------C 979.649222 0 0.0000 499 | 8/11
28 h-m-p 0.0160 8.0000 0.0002 +++C 979.649221 0 1.0975 519 | 8/11
29 h-m-p 1.6000 8.0000 0.0000 ---C 979.649221 0 0.0068 539
Out..
lnL = -979.649221
540 lfun, 6480 eigenQcodon, 35640 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -984.328431 S = -983.150650 -1.981258
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:32
did 20 / 56 patterns 0:33
did 30 / 56 patterns 0:33
did 40 / 56 patterns 0:33
did 50 / 56 patterns 0:33
did 56 / 56 patterns 0:33
Time used: 0:33
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.01 sec, SCORE=100, Nseq=6, Len=247
NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
NC_002677_1_NP_302400_1_1272_echA6 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV
**************************************************
NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
NC_002677_1_NP_302400_1_1272_echA6 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP
**************************************************
NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
NC_002677_1_NP_302400_1_1272_echA6 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR
**************************************************
NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
NC_002677_1_NP_302400_1_1272_echA6 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK
**************************************************
NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
NC_002677_1_NP_302400_1_1272_echA6 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA
NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 RVLNDDGSIEEAWPEHKKLFDKAWSSQDVIEAQVARVEKRPPKFQGA
************************:**********************
>NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA >NC_002677_1_NP_302400_1_1272_echA6 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA >NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA >NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA >NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA GAAGCTCTTTGACAAGGCCTGGACCAGCCAGGATGTCATCGAAGCGCAGG TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA >NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 ATGATAGGTATTACTCAGGCCGAAGGCGTTATGACTATCGAGCTGCAGCG TCCCGAGCGCCGCAATGCCCTGAATTCGCAACTTATCGAGAAGCTGCGGG AGGCTGTGCAGAAAGCTAGTAGCGCCGACAGTGAGGTGTCTACCCGTGTG ATTGTGTTGACTGGCCAGGGCACGGTGTTCTGTGCCGGCGCGGATCTGAG CGGAGATGCGTTTGCCGCTGACTACCCTGACCGGCTGATCGAGTTACACA GGGTCATGGATGCTGTTCCGATGCCGGTAATTGGCGCTATTAACGGGCCC GCCATCGGTGCTGGTCTACAGTTGGCCATGCAATGTGATCTGCGGGTTGT TGCACCGGATGCGTATTTTCAGTTTCCTACCTCGAAATATGGTTTGGCCC TTGACAACTGGAGTATTCGCCGACTGTCTTCGTTGGTTGGTCACGGCCGG GCCCGCGCGATGCTGCTGACGGCGGAGAAGTTGACCGCCGACATCGCGCT GCAGACCGGGATGGCCAATCGCATCGGTGCACTGGCCGACGCCCAGGCCT GGGCCGCCGAGGTCACCGGCCTAGCACCACTGGCGATCCAGCACGCCAAG CGGGTACTCAACGACGACGGCTCTATCGAAGAGGCGTGGCCGGAGCACAA GAAGCTCTTTGACAAGGCCTGGAGCAGCCAGGATGTCATCGAAGCGCAGG TCGCCCGGGTGGAGAAACGGCCACCTAAGTTTCAGGGGGCA
>NC_011896_1_WP_010908720_1_2253_MLBR_RS10690 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA >NC_002677_1_NP_302400_1_1272_echA6 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA >NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA >NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA >NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK RVLNDDGSIEEAWPEHKKLFDKAWTSQDVIEAQVARVEKRPPKFQGA >NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900 MIGITQAEGVMTIELQRPERRNALNSQLIEKLREAVQKASSADSEVSTRV IVLTGQGTVFCAGADLSGDAFAADYPDRLIELHRVMDAVPMPVIGAINGP AIGAGLQLAMQCDLRVVAPDAYFQFPTSKYGLALDNWSIRRLSSLVGHGR ARAMLLTAEKLTADIALQTGMANRIGALADAQAWAAEVTGLAPLAIQHAK RVLNDDGSIEEAWPEHKKLFDKAWSSQDVIEAQVARVEKRPPKFQGA
#NEXUS
[ID: 9912512636]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908720_1_2253_MLBR_RS10690
NC_002677_1_NP_302400_1_1272_echA6
NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195
NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010
NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575
NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908720_1_2253_MLBR_RS10690,
2 NC_002677_1_NP_302400_1_1272_echA6,
3 NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195,
4 NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010,
5 NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575,
6 NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06371098,2:0.06101241,3:0.0619924,4:0.05977634,5:0.06201059,6:0.1137815);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06371098,2:0.06101241,3:0.0619924,4:0.05977634,5:0.06201059,6:0.1137815);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1024.15 -1028.99
2 -1024.16 -1027.88
--------------------------------------
TOTAL -1024.15 -1028.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/echA6/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.874790 0.087177 0.344641 1.433962 0.847467 1501.00 1501.00 1.000
r(A<->C){all} 0.151304 0.017505 0.000054 0.420756 0.115148 167.45 245.08 1.004
r(A<->G){all} 0.169547 0.019921 0.000133 0.454036 0.135127 321.75 335.25 1.000
r(A<->T){all} 0.153898 0.017709 0.000060 0.425084 0.119090 141.77 180.52 1.001
r(C<->G){all} 0.208833 0.026647 0.000412 0.544682 0.166682 152.36 217.47 1.002
r(C<->T){all} 0.143778 0.017416 0.000215 0.435289 0.104400 265.92 284.81 1.000
r(G<->T){all} 0.172639 0.020888 0.000011 0.451814 0.135088 209.71 266.94 1.001
pi(A){all} 0.194627 0.000211 0.166867 0.223565 0.194463 1164.88 1194.64 1.000
pi(C){all} 0.276118 0.000262 0.244572 0.307426 0.275793 1278.40 1348.74 1.000
pi(G){all} 0.324623 0.000295 0.291474 0.358626 0.324028 1231.67 1249.37 1.000
pi(T){all} 0.204632 0.000215 0.176043 0.232981 0.204702 1064.51 1155.74 1.000
alpha{1,2} 0.289203 0.109145 0.000557 0.978628 0.182930 1376.15 1438.57 1.000
alpha{3} 0.404260 0.232958 0.000124 1.384001 0.232148 1169.04 1285.71 1.000
pinvar{all} 0.995225 0.000016 0.987648 0.999902 0.996382 1007.55 1183.56 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/echA6/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 247
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 5 5 5 5 5 5 | Ser TCT 3 3 3 3 3 3 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 2 2 2 2 2 2
TTC 1 1 1 1 1 1 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 2 2 2 2 2 | Pro CCT 3 3 3 3 3 3 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 4 4 4 4 4 4 | CGC 5 5 5 5 5 5
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 12 12 12 12 12 12 | CCG 4 4 4 4 4 4 | CAG 12 12 12 12 12 12 | CGG 7 7 7 7 7 7
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 3 3 3 3 3 3 | Asn AAT 3 3 3 3 3 3 | Ser AGT 3 3 3 3 3 3
ATC 9 9 9 9 9 9 | ACC 6 6 6 6 6 5 | AAC 3 3 3 3 3 3 | AGC 3 3 3 3 3 4
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 7 7 7 7 7 7 | ACG 2 2 2 2 2 2 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 6 6 6 6 6 6 | Asp GAT 6 6 6 6 6 6 | Gly GGT 6 6 6 6 6 6
GTC 4 4 4 4 4 4 | GCC 19 19 19 19 19 19 | GAC 9 9 9 9 9 9 | GGC 8 8 8 8 8 8
GTA 2 2 2 2 2 2 | GCA 4 4 4 4 4 4 | Glu GAA 3 3 3 3 3 3 | GGA 1 1 1 1 1 1
GTG 6 6 6 6 6 6 | GCG 9 9 9 9 9 9 | GAG 11 11 11 11 11 11 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908720_1_2253_MLBR_RS10690
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26721 A:0.26721 G:0.18623
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27530 A:0.19433 G:0.32524
#2: NC_002677_1_NP_302400_1_1272_echA6
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26721 A:0.26721 G:0.18623
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27530 A:0.19433 G:0.32524
#3: NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26721 A:0.26721 G:0.18623
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27530 A:0.19433 G:0.32524
#4: NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26721 A:0.26721 G:0.18623
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27530 A:0.19433 G:0.32524
#5: NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26721 A:0.26721 G:0.18623
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27530 A:0.19433 G:0.32524
#6: NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26316 A:0.26721 G:0.19028
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27395 A:0.19433 G:0.32659
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 30 | Ser S TCT 18 | Tyr Y TAT 12 | Cys C TGT 12
TTC 6 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 18 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 12 | Pro P CCT 18 | His H CAT 0 | Arg R CGT 12
CTC 12 | CCC 12 | CAC 24 | CGC 30
CTA 12 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 72 | CCG 24 | CAG 72 | CGG 42
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 18 | Asn N AAT 18 | Ser S AGT 18
ATC 54 | ACC 35 | AAC 18 | AGC 19
ATA 6 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 42 | ACG 12 | AAG 42 | AGG 6
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 36 | Asp D GAT 36 | Gly G GGT 36
GTC 24 | GCC 114 | GAC 54 | GGC 48
GTA 12 | GCA 24 | Glu E GAA 18 | GGA 6
GTG 36 | GCG 54 | GAG 66 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10931 C:0.25101 A:0.22672 G:0.41296
position 2: T:0.27935 C:0.26653 A:0.26721 G:0.18691
position 3: T:0.22672 C:0.30769 A:0.08907 G:0.37652
Average T:0.20513 C:0.27508 A:0.19433 G:0.32546
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -979.649208 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004003 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004023
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004003);
(NC_011896_1_WP_010908720_1_2253_MLBR_RS10690: 0.000004, NC_002677_1_NP_302400_1_1272_echA6: 0.000004, NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195: 0.000004, NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010: 0.000004, NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575: 0.000004, NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900: 0.004003);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.5 160.5 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 580.5 160.5 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 580.5 160.5 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 580.5 160.5 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 580.5 160.5 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 580.5 160.5 999.0000 0.0017 0.0000 1.0 0.0
tree length for dN: 0.0017
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -979.874157 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004079 0.000100 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004099
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004079);
(NC_011896_1_WP_010908720_1_2253_MLBR_RS10690: 0.000004, NC_002677_1_NP_302400_1_1272_echA6: 0.000004, NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195: 0.000004, NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010: 0.000004, NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575: 0.000004, NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900: 0.004079);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 580.5 160.5 1.0000 0.0014 0.0014 0.8 0.2
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -979.649221 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004003 0.000100 0.000001 0.000001 1.000000 951.566090
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004023
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004003);
(NC_011896_1_WP_010908720_1_2253_MLBR_RS10690: 0.000004, NC_002677_1_NP_302400_1_1272_echA6: 0.000004, NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195: 0.000004, NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010: 0.000004, NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575: 0.000004, NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900: 0.004003);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 951.56609
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.5 160.5 951.5637 0.0000 0.0000 0.0 0.0
7..2 0.000 580.5 160.5 951.5637 0.0000 0.0000 0.0 0.0
7..3 0.000 580.5 160.5 951.5637 0.0000 0.0000 0.0 0.0
7..4 0.000 580.5 160.5 951.5637 0.0000 0.0000 0.0 0.0
7..5 0.000 580.5 160.5 951.5637 0.0000 0.0000 0.0 0.0
7..6 0.004 580.5 160.5 951.5637 0.0017 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908720_1_2253_MLBR_RS10690)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.564
2 I 1.000** 951.564
3 G 1.000** 951.564
4 I 1.000** 951.564
5 T 1.000** 951.564
6 Q 1.000** 951.564
7 A 1.000** 951.564
8 E 1.000** 951.564
9 G 1.000** 951.564
10 V 1.000** 951.564
11 M 1.000** 951.564
12 T 1.000** 951.564
13 I 1.000** 951.564
14 E 1.000** 951.564
15 L 1.000** 951.564
16 Q 1.000** 951.564
17 R 1.000** 951.564
18 P 1.000** 951.564
19 E 1.000** 951.564
20 R 1.000** 951.564
21 R 1.000** 951.564
22 N 1.000** 951.564
23 A 1.000** 951.564
24 L 1.000** 951.564
25 N 1.000** 951.564
26 S 1.000** 951.564
27 Q 1.000** 951.564
28 L 1.000** 951.564
29 I 1.000** 951.564
30 E 1.000** 951.564
31 K 1.000** 951.564
32 L 1.000** 951.564
33 R 1.000** 951.564
34 E 1.000** 951.564
35 A 1.000** 951.564
36 V 1.000** 951.564
37 Q 1.000** 951.564
38 K 1.000** 951.564
39 A 1.000** 951.564
40 S 1.000** 951.564
41 S 1.000** 951.564
42 A 1.000** 951.564
43 D 1.000** 951.564
44 S 1.000** 951.564
45 E 1.000** 951.564
46 V 1.000** 951.564
47 S 1.000** 951.564
48 T 1.000** 951.564
49 R 1.000** 951.564
50 V 1.000** 951.564
51 I 1.000** 951.564
52 V 1.000** 951.564
53 L 1.000** 951.564
54 T 1.000** 951.564
55 G 1.000** 951.564
56 Q 1.000** 951.564
57 G 1.000** 951.564
58 T 1.000** 951.564
59 V 1.000** 951.564
60 F 1.000** 951.564
61 C 1.000** 951.564
62 A 1.000** 951.564
63 G 1.000** 951.564
64 A 1.000** 951.564
65 D 1.000** 951.564
66 L 1.000** 951.564
67 S 1.000** 951.564
68 G 1.000** 951.564
69 D 1.000** 951.564
70 A 1.000** 951.564
71 F 1.000** 951.564
72 A 1.000** 951.564
73 A 1.000** 951.564
74 D 1.000** 951.564
75 Y 1.000** 951.564
76 P 1.000** 951.564
77 D 1.000** 951.564
78 R 1.000** 951.564
79 L 1.000** 951.564
80 I 1.000** 951.564
81 E 1.000** 951.564
82 L 1.000** 951.564
83 H 1.000** 951.564
84 R 1.000** 951.564
85 V 1.000** 951.564
86 M 1.000** 951.564
87 D 1.000** 951.564
88 A 1.000** 951.564
89 V 1.000** 951.564
90 P 1.000** 951.564
91 M 1.000** 951.564
92 P 1.000** 951.564
93 V 1.000** 951.564
94 I 1.000** 951.564
95 G 1.000** 951.564
96 A 1.000** 951.564
97 I 1.000** 951.564
98 N 1.000** 951.564
99 G 1.000** 951.564
100 P 1.000** 951.564
101 A 1.000** 951.564
102 I 1.000** 951.564
103 G 1.000** 951.564
104 A 1.000** 951.564
105 G 1.000** 951.564
106 L 1.000** 951.564
107 Q 1.000** 951.564
108 L 1.000** 951.564
109 A 1.000** 951.564
110 M 1.000** 951.564
111 Q 1.000** 951.564
112 C 1.000** 951.564
113 D 1.000** 951.564
114 L 1.000** 951.564
115 R 1.000** 951.564
116 V 1.000** 951.564
117 V 1.000** 951.564
118 A 1.000** 951.564
119 P 1.000** 951.564
120 D 1.000** 951.564
121 A 1.000** 951.564
122 Y 1.000** 951.564
123 F 1.000** 951.564
124 Q 1.000** 951.564
125 F 1.000** 951.564
126 P 1.000** 951.564
127 T 1.000** 951.564
128 S 1.000** 951.564
129 K 1.000** 951.564
130 Y 1.000** 951.564
131 G 1.000** 951.564
132 L 1.000** 951.564
133 A 1.000** 951.564
134 L 1.000** 951.564
135 D 1.000** 951.564
136 N 1.000** 951.564
137 W 1.000** 951.564
138 S 1.000** 951.564
139 I 1.000** 951.564
140 R 1.000** 951.564
141 R 1.000** 951.564
142 L 1.000** 951.564
143 S 1.000** 951.564
144 S 1.000** 951.564
145 L 1.000** 951.564
146 V 1.000** 951.564
147 G 1.000** 951.564
148 H 1.000** 951.564
149 G 1.000** 951.564
150 R 1.000** 951.564
151 A 1.000** 951.564
152 R 1.000** 951.564
153 A 1.000** 951.564
154 M 1.000** 951.564
155 L 1.000** 951.564
156 L 1.000** 951.564
157 T 1.000** 951.564
158 A 1.000** 951.564
159 E 1.000** 951.564
160 K 1.000** 951.564
161 L 1.000** 951.564
162 T 1.000** 951.564
163 A 1.000** 951.564
164 D 1.000** 951.564
165 I 1.000** 951.564
166 A 1.000** 951.564
167 L 1.000** 951.564
168 Q 1.000** 951.564
169 T 1.000** 951.564
170 G 1.000** 951.564
171 M 1.000** 951.564
172 A 1.000** 951.564
173 N 1.000** 951.564
174 R 1.000** 951.564
175 I 1.000** 951.564
176 G 1.000** 951.564
177 A 1.000** 951.564
178 L 1.000** 951.564
179 A 1.000** 951.564
180 D 1.000** 951.564
181 A 1.000** 951.564
182 Q 1.000** 951.564
183 A 1.000** 951.564
184 W 1.000** 951.564
185 A 1.000** 951.564
186 A 1.000** 951.564
187 E 1.000** 951.564
188 V 1.000** 951.564
189 T 1.000** 951.564
190 G 1.000** 951.564
191 L 1.000** 951.564
192 A 1.000** 951.564
193 P 1.000** 951.564
194 L 1.000** 951.564
195 A 1.000** 951.564
196 I 1.000** 951.564
197 Q 1.000** 951.564
198 H 1.000** 951.564
199 A 1.000** 951.564
200 K 1.000** 951.564
201 R 1.000** 951.564
202 V 1.000** 951.564
203 L 1.000** 951.564
204 N 1.000** 951.564
205 D 1.000** 951.564
206 D 1.000** 951.564
207 G 1.000** 951.564
208 S 1.000** 951.564
209 I 1.000** 951.564
210 E 1.000** 951.564
211 E 1.000** 951.564
212 A 1.000** 951.564
213 W 1.000** 951.564
214 P 1.000** 951.564
215 E 1.000** 951.564
216 H 1.000** 951.564
217 K 1.000** 951.564
218 K 1.000** 951.564
219 L 1.000** 951.564
220 F 1.000** 951.564
221 D 1.000** 951.564
222 K 1.000** 951.564
223 A 1.000** 951.564
224 W 1.000** 951.564
225 T 1.000** 951.566
226 S 1.000** 951.564
227 Q 1.000** 951.564
228 D 1.000** 951.564
229 V 1.000** 951.564
230 I 1.000** 951.564
231 E 1.000** 951.564
232 A 1.000** 951.564
233 Q 1.000** 951.564
234 V 1.000** 951.564
235 A 1.000** 951.564
236 R 1.000** 951.564
237 V 1.000** 951.564
238 E 1.000** 951.564
239 K 1.000** 951.564
240 R 1.000** 951.564
241 P 1.000** 951.564
242 P 1.000** 951.564
243 K 1.000** 951.564
244 F 1.000** 951.564
245 Q 1.000** 951.564
246 G 1.000** 951.564
247 A 1.000** 951.564
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908720_1_2253_MLBR_RS10690)
Pr(w>1) post mean +- SE for w
225 T 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -979.874155 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004079 0.000100 13.671749 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004099
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004079);
(NC_011896_1_WP_010908720_1_2253_MLBR_RS10690: 0.000004, NC_002677_1_NP_302400_1_1272_echA6: 0.000004, NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195: 0.000004, NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010: 0.000004, NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575: 0.000004, NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900: 0.004079);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 13.67175 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 580.5 160.5 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.004 580.5 160.5 1.0000 0.0014 0.0014 0.8 0.2
Time used: 0:19
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -979.649221 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.004003 0.000100 0.000010 98.999964 0.005000 951.479028
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.004023
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.004003);
(NC_011896_1_WP_010908720_1_2253_MLBR_RS10690: 0.000004, NC_002677_1_NP_302400_1_1272_echA6: 0.000004, NZ_LVXE01000011_1_WP_010908720_1_326_A3216_RS05195: 0.000004, NZ_LYPH01000017_1_WP_010908720_1_640_A8144_RS03010: 0.000004, NZ_CP029543_1_WP_010908720_1_2275_DIJ64_RS11575: 0.000004, NZ_AP014567_1_WP_119608000_1_2340_JK2ML_RS11900: 0.004003);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 98.99996 q = 0.00500
(p1 = 0.99999) w = 951.47903
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 951.47903
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.5 160.5 951.4695 0.0000 0.0000 0.0 0.0
7..2 0.000 580.5 160.5 951.4695 0.0000 0.0000 0.0 0.0
7..3 0.000 580.5 160.5 951.4695 0.0000 0.0000 0.0 0.0
7..4 0.000 580.5 160.5 951.4695 0.0000 0.0000 0.0 0.0
7..5 0.000 580.5 160.5 951.4695 0.0000 0.0000 0.0 0.0
7..6 0.004 580.5 160.5 951.4695 0.0017 0.0000 1.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908720_1_2253_MLBR_RS10690)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.469
2 I 1.000** 951.470
3 G 1.000** 951.469
4 I 1.000** 951.469
5 T 1.000** 951.470
6 Q 1.000** 951.469
7 A 1.000** 951.469
8 E 1.000** 951.469
9 G 1.000** 951.469
10 V 1.000** 951.469
11 M 1.000** 951.469
12 T 1.000** 951.470
13 I 1.000** 951.469
14 E 1.000** 951.469
15 L 1.000** 951.469
16 Q 1.000** 951.469
17 R 1.000** 951.469
18 P 1.000** 951.469
19 E 1.000** 951.469
20 R 1.000** 951.469
21 R 1.000** 951.469
22 N 1.000** 951.469
23 A 1.000** 951.469
24 L 1.000** 951.469
25 N 1.000** 951.469
26 S 1.000** 951.469
27 Q 1.000** 951.469
28 L 1.000** 951.469
29 I 1.000** 951.469
30 E 1.000** 951.469
31 K 1.000** 951.469
32 L 1.000** 951.469
33 R 1.000** 951.469
34 E 1.000** 951.469
35 A 1.000** 951.469
36 V 1.000** 951.469
37 Q 1.000** 951.469
38 K 1.000** 951.470
39 A 1.000** 951.469
40 S 1.000** 951.469
41 S 1.000** 951.469
42 A 1.000** 951.469
43 D 1.000** 951.469
44 S 1.000** 951.469
45 E 1.000** 951.469
46 V 1.000** 951.469
47 S 1.000** 951.470
48 T 1.000** 951.469
49 R 1.000** 951.469
50 V 1.000** 951.469
51 I 1.000** 951.469
52 V 1.000** 951.469
53 L 1.000** 951.469
54 T 1.000** 951.470
55 G 1.000** 951.469
56 Q 1.000** 951.469
57 G 1.000** 951.469
58 T 1.000** 951.469
59 V 1.000** 951.469
60 F 1.000** 951.469
61 C 1.000** 951.470
62 A 1.000** 951.469
63 G 1.000** 951.469
64 A 1.000** 951.469
65 D 1.000** 951.469
66 L 1.000** 951.469
67 S 1.000** 951.469
68 G 1.000** 951.470
69 D 1.000** 951.469
70 A 1.000** 951.469
71 F 1.000** 951.469
72 A 1.000** 951.469
73 A 1.000** 951.469
74 D 1.000** 951.469
75 Y 1.000** 951.469
76 P 1.000** 951.469
77 D 1.000** 951.469
78 R 1.000** 951.469
79 L 1.000** 951.469
80 I 1.000** 951.469
81 E 1.000** 951.469
82 L 1.000** 951.470
83 H 1.000** 951.469
84 R 1.000** 951.469
85 V 1.000** 951.469
86 M 1.000** 951.469
87 D 1.000** 951.469
88 A 1.000** 951.469
89 V 1.000** 951.469
90 P 1.000** 951.469
91 M 1.000** 951.469
92 P 1.000** 951.469
93 V 1.000** 951.470
94 I 1.000** 951.469
95 G 1.000** 951.469
96 A 1.000** 951.469
97 I 1.000** 951.469
98 N 1.000** 951.469
99 G 1.000** 951.469
100 P 1.000** 951.469
101 A 1.000** 951.469
102 I 1.000** 951.469
103 G 1.000** 951.469
104 A 1.000** 951.469
105 G 1.000** 951.469
106 L 1.000** 951.470
107 Q 1.000** 951.469
108 L 1.000** 951.469
109 A 1.000** 951.469
110 M 1.000** 951.469
111 Q 1.000** 951.469
112 C 1.000** 951.470
113 D 1.000** 951.469
114 L 1.000** 951.469
115 R 1.000** 951.469
116 V 1.000** 951.469
117 V 1.000** 951.469
118 A 1.000** 951.470
119 P 1.000** 951.469
120 D 1.000** 951.469
121 A 1.000** 951.469
122 Y 1.000** 951.470
123 F 1.000** 951.469
124 Q 1.000** 951.469
125 F 1.000** 951.469
126 P 1.000** 951.469
127 T 1.000** 951.469
128 S 1.000** 951.469
129 K 1.000** 951.470
130 Y 1.000** 951.470
131 G 1.000** 951.469
132 L 1.000** 951.469
133 A 1.000** 951.469
134 L 1.000** 951.469
135 D 1.000** 951.469
136 N 1.000** 951.469
137 W 1.000** 951.469
138 S 1.000** 951.469
139 I 1.000** 951.469
140 R 1.000** 951.469
141 R 1.000** 951.470
142 L 1.000** 951.469
143 S 1.000** 951.470
144 S 1.000** 951.469
145 L 1.000** 951.469
146 V 1.000** 951.469
147 G 1.000** 951.469
148 H 1.000** 951.469
149 G 1.000** 951.469
150 R 1.000** 951.469
151 A 1.000** 951.469
152 R 1.000** 951.469
153 A 1.000** 951.469
154 M 1.000** 951.469
155 L 1.000** 951.469
156 L 1.000** 951.469
157 T 1.000** 951.469
158 A 1.000** 951.469
159 E 1.000** 951.469
160 K 1.000** 951.469
161 L 1.000** 951.469
162 T 1.000** 951.469
163 A 1.000** 951.469
164 D 1.000** 951.469
165 I 1.000** 951.469
166 A 1.000** 951.469
167 L 1.000** 951.469
168 Q 1.000** 951.469
169 T 1.000** 951.469
170 G 1.000** 951.469
171 M 1.000** 951.469
172 A 1.000** 951.469
173 N 1.000** 951.469
174 R 1.000** 951.469
175 I 1.000** 951.469
176 G 1.000** 951.469
177 A 1.000** 951.470
178 L 1.000** 951.469
179 A 1.000** 951.469
180 D 1.000** 951.469
181 A 1.000** 951.469
182 Q 1.000** 951.469
183 A 1.000** 951.469
184 W 1.000** 951.469
185 A 1.000** 951.469
186 A 1.000** 951.469
187 E 1.000** 951.469
188 V 1.000** 951.469
189 T 1.000** 951.469
190 G 1.000** 951.469
191 L 1.000** 951.470
192 A 1.000** 951.470
193 P 1.000** 951.470
194 L 1.000** 951.469
195 A 1.000** 951.469
196 I 1.000** 951.469
197 Q 1.000** 951.469
198 H 1.000** 951.469
199 A 1.000** 951.469
200 K 1.000** 951.469
201 R 1.000** 951.469
202 V 1.000** 951.470
203 L 1.000** 951.469
204 N 1.000** 951.469
205 D 1.000** 951.469
206 D 1.000** 951.469
207 G 1.000** 951.469
208 S 1.000** 951.470
209 I 1.000** 951.469
210 E 1.000** 951.469
211 E 1.000** 951.469
212 A 1.000** 951.469
213 W 1.000** 951.469
214 P 1.000** 951.469
215 E 1.000** 951.469
216 H 1.000** 951.469
217 K 1.000** 951.469
218 K 1.000** 951.469
219 L 1.000** 951.469
220 F 1.000** 951.469
221 D 1.000** 951.469
222 K 1.000** 951.469
223 A 1.000** 951.469
224 W 1.000** 951.469
225 T 1.000** 951.479
226 S 1.000** 951.469
227 Q 1.000** 951.469
228 D 1.000** 951.469
229 V 1.000** 951.469
230 I 1.000** 951.469
231 E 1.000** 951.469
232 A 1.000** 951.469
233 Q 1.000** 951.469
234 V 1.000** 951.469
235 A 1.000** 951.469
236 R 1.000** 951.469
237 V 1.000** 951.469
238 E 1.000** 951.469
239 K 1.000** 951.470
240 R 1.000** 951.469
241 P 1.000** 951.470
242 P 1.000** 951.469
243 K 1.000** 951.469
244 F 1.000** 951.469
245 Q 1.000** 951.469
246 G 1.000** 951.469
247 A 1.000** 951.470
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908720_1_2253_MLBR_RS10690)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 I 0.639 4.860 +- 3.856
3 G 0.639 4.860 +- 3.856
4 I 0.639 4.860 +- 3.856
5 T 0.639 4.860 +- 3.856
6 Q 0.639 4.860 +- 3.856
7 A 0.639 4.860 +- 3.856
8 E 0.639 4.860 +- 3.856
9 G 0.639 4.860 +- 3.856
10 V 0.639 4.860 +- 3.856
11 M 0.639 4.860 +- 3.856
12 T 0.639 4.860 +- 3.856
13 I 0.639 4.860 +- 3.856
14 E 0.639 4.860 +- 3.856
15 L 0.639 4.860 +- 3.856
16 Q 0.639 4.860 +- 3.856
17 R 0.639 4.860 +- 3.856
18 P 0.639 4.860 +- 3.856
19 E 0.639 4.860 +- 3.856
20 R 0.639 4.860 +- 3.856
21 R 0.639 4.860 +- 3.856
22 N 0.639 4.860 +- 3.856
23 A 0.639 4.860 +- 3.856
24 L 0.639 4.860 +- 3.856
25 N 0.639 4.860 +- 3.856
26 S 0.639 4.860 +- 3.856
27 Q 0.639 4.860 +- 3.856
28 L 0.639 4.860 +- 3.856
29 I 0.639 4.860 +- 3.856
30 E 0.639 4.860 +- 3.856
31 K 0.639 4.860 +- 3.856
32 L 0.639 4.860 +- 3.856
33 R 0.639 4.860 +- 3.856
34 E 0.639 4.860 +- 3.856
35 A 0.639 4.860 +- 3.856
36 V 0.639 4.860 +- 3.856
37 Q 0.639 4.860 +- 3.856
38 K 0.639 4.860 +- 3.856
39 A 0.639 4.860 +- 3.856
40 S 0.639 4.860 +- 3.856
41 S 0.639 4.860 +- 3.856
42 A 0.639 4.860 +- 3.856
43 D 0.639 4.860 +- 3.856
44 S 0.639 4.860 +- 3.856
45 E 0.639 4.860 +- 3.856
46 V 0.639 4.860 +- 3.856
47 S 0.639 4.860 +- 3.856
48 T 0.639 4.860 +- 3.856
49 R 0.639 4.860 +- 3.856
50 V 0.639 4.860 +- 3.856
51 I 0.639 4.860 +- 3.856
52 V 0.639 4.860 +- 3.856
53 L 0.639 4.860 +- 3.856
54 T 0.639 4.860 +- 3.856
55 G 0.639 4.860 +- 3.856
56 Q 0.639 4.860 +- 3.856
57 G 0.639 4.860 +- 3.856
58 T 0.639 4.860 +- 3.856
59 V 0.639 4.860 +- 3.856
60 F 0.639 4.860 +- 3.856
61 C 0.639 4.860 +- 3.856
62 A 0.639 4.860 +- 3.856
63 G 0.639 4.860 +- 3.856
64 A 0.639 4.860 +- 3.856
65 D 0.639 4.860 +- 3.856
66 L 0.639 4.860 +- 3.856
67 S 0.639 4.860 +- 3.856
68 G 0.639 4.860 +- 3.856
69 D 0.639 4.860 +- 3.856
70 A 0.639 4.860 +- 3.856
71 F 0.639 4.860 +- 3.856
72 A 0.639 4.860 +- 3.856
73 A 0.639 4.860 +- 3.856
74 D 0.639 4.860 +- 3.856
75 Y 0.639 4.860 +- 3.856
76 P 0.639 4.860 +- 3.856
77 D 0.639 4.860 +- 3.856
78 R 0.639 4.860 +- 3.856
79 L 0.639 4.860 +- 3.856
80 I 0.639 4.860 +- 3.856
81 E 0.639 4.860 +- 3.856
82 L 0.639 4.860 +- 3.856
83 H 0.639 4.860 +- 3.856
84 R 0.639 4.860 +- 3.856
85 V 0.639 4.860 +- 3.856
86 M 0.639 4.860 +- 3.856
87 D 0.639 4.860 +- 3.856
88 A 0.639 4.860 +- 3.856
89 V 0.639 4.860 +- 3.856
90 P 0.639 4.860 +- 3.856
91 M 0.639 4.860 +- 3.856
92 P 0.639 4.860 +- 3.856
93 V 0.639 4.860 +- 3.856
94 I 0.639 4.860 +- 3.856
95 G 0.639 4.860 +- 3.856
96 A 0.639 4.860 +- 3.856
97 I 0.639 4.860 +- 3.856
98 N 0.639 4.860 +- 3.856
99 G 0.639 4.860 +- 3.856
100 P 0.639 4.860 +- 3.856
101 A 0.639 4.860 +- 3.856
102 I 0.639 4.860 +- 3.856
103 G 0.639 4.860 +- 3.856
104 A 0.639 4.860 +- 3.856
105 G 0.639 4.860 +- 3.856
106 L 0.639 4.860 +- 3.856
107 Q 0.639 4.860 +- 3.856
108 L 0.639 4.860 +- 3.856
109 A 0.639 4.860 +- 3.856
110 M 0.639 4.860 +- 3.856
111 Q 0.639 4.860 +- 3.856
112 C 0.639 4.860 +- 3.856
113 D 0.639 4.860 +- 3.856
114 L 0.639 4.860 +- 3.856
115 R 0.639 4.860 +- 3.856
116 V 0.639 4.860 +- 3.856
117 V 0.639 4.860 +- 3.856
118 A 0.639 4.860 +- 3.856
119 P 0.639 4.860 +- 3.856
120 D 0.639 4.860 +- 3.856
121 A 0.639 4.860 +- 3.856
122 Y 0.639 4.860 +- 3.856
123 F 0.639 4.860 +- 3.856
124 Q 0.639 4.860 +- 3.856
125 F 0.639 4.860 +- 3.856
126 P 0.639 4.860 +- 3.856
127 T 0.639 4.860 +- 3.856
128 S 0.639 4.860 +- 3.856
129 K 0.639 4.860 +- 3.856
130 Y 0.639 4.860 +- 3.856
131 G 0.639 4.860 +- 3.856
132 L 0.639 4.860 +- 3.856
133 A 0.639 4.860 +- 3.856
134 L 0.639 4.860 +- 3.856
135 D 0.639 4.860 +- 3.856
136 N 0.639 4.860 +- 3.856
137 W 0.639 4.860 +- 3.856
138 S 0.639 4.860 +- 3.856
139 I 0.639 4.860 +- 3.856
140 R 0.639 4.860 +- 3.856
141 R 0.639 4.860 +- 3.856
142 L 0.639 4.860 +- 3.856
143 S 0.639 4.860 +- 3.856
144 S 0.639 4.860 +- 3.856
145 L 0.639 4.860 +- 3.856
146 V 0.639 4.860 +- 3.856
147 G 0.639 4.860 +- 3.856
148 H 0.639 4.860 +- 3.856
149 G 0.639 4.860 +- 3.856
150 R 0.639 4.860 +- 3.856
151 A 0.639 4.860 +- 3.856
152 R 0.639 4.860 +- 3.856
153 A 0.639 4.860 +- 3.856
154 M 0.639 4.860 +- 3.856
155 L 0.639 4.860 +- 3.856
156 L 0.639 4.860 +- 3.856
157 T 0.639 4.860 +- 3.856
158 A 0.639 4.860 +- 3.856
159 E 0.639 4.860 +- 3.856
160 K 0.639 4.860 +- 3.856
161 L 0.639 4.860 +- 3.856
162 T 0.639 4.860 +- 3.856
163 A 0.639 4.860 +- 3.856
164 D 0.639 4.860 +- 3.856
165 I 0.639 4.860 +- 3.856
166 A 0.639 4.860 +- 3.856
167 L 0.639 4.860 +- 3.856
168 Q 0.639 4.860 +- 3.856
169 T 0.639 4.860 +- 3.856
170 G 0.639 4.860 +- 3.856
171 M 0.639 4.860 +- 3.856
172 A 0.639 4.860 +- 3.856
173 N 0.639 4.860 +- 3.856
174 R 0.639 4.860 +- 3.856
175 I 0.639 4.860 +- 3.856
176 G 0.639 4.860 +- 3.856
177 A 0.639 4.860 +- 3.856
178 L 0.639 4.860 +- 3.856
179 A 0.639 4.860 +- 3.856
180 D 0.639 4.860 +- 3.856
181 A 0.639 4.860 +- 3.856
182 Q 0.639 4.860 +- 3.856
183 A 0.639 4.860 +- 3.856
184 W 0.639 4.860 +- 3.856
185 A 0.639 4.860 +- 3.856
186 A 0.639 4.860 +- 3.856
187 E 0.639 4.860 +- 3.856
188 V 0.639 4.860 +- 3.856
189 T 0.639 4.860 +- 3.856
190 G 0.639 4.860 +- 3.856
191 L 0.639 4.860 +- 3.856
192 A 0.639 4.860 +- 3.856
193 P 0.639 4.860 +- 3.856
194 L 0.639 4.860 +- 3.856
195 A 0.639 4.860 +- 3.856
196 I 0.639 4.860 +- 3.856
197 Q 0.639 4.860 +- 3.856
198 H 0.639 4.860 +- 3.856
199 A 0.639 4.860 +- 3.856
200 K 0.639 4.860 +- 3.856
201 R 0.639 4.860 +- 3.856
202 V 0.639 4.860 +- 3.856
203 L 0.639 4.860 +- 3.856
204 N 0.639 4.860 +- 3.856
205 D 0.639 4.860 +- 3.856
206 D 0.639 4.860 +- 3.856
207 G 0.639 4.860 +- 3.856
208 S 0.639 4.860 +- 3.856
209 I 0.639 4.860 +- 3.856
210 E 0.639 4.860 +- 3.856
211 E 0.639 4.860 +- 3.856
212 A 0.639 4.860 +- 3.856
213 W 0.639 4.860 +- 3.856
214 P 0.639 4.860 +- 3.856
215 E 0.639 4.860 +- 3.856
216 H 0.639 4.860 +- 3.856
217 K 0.639 4.860 +- 3.856
218 K 0.639 4.860 +- 3.856
219 L 0.639 4.860 +- 3.856
220 F 0.639 4.860 +- 3.856
221 D 0.639 4.860 +- 3.856
222 K 0.639 4.860 +- 3.856
223 A 0.639 4.860 +- 3.856
224 W 0.639 4.860 +- 3.856
225 T 0.923 6.858 +- 3.003
226 S 0.639 4.860 +- 3.856
227 Q 0.639 4.860 +- 3.856
228 D 0.639 4.860 +- 3.856
229 V 0.639 4.860 +- 3.856
230 I 0.639 4.860 +- 3.856
231 E 0.639 4.860 +- 3.856
232 A 0.639 4.860 +- 3.856
233 Q 0.639 4.860 +- 3.856
234 V 0.639 4.860 +- 3.856
235 A 0.639 4.860 +- 3.856
236 R 0.639 4.860 +- 3.856
237 V 0.639 4.860 +- 3.856
238 E 0.639 4.860 +- 3.856
239 K 0.639 4.860 +- 3.856
240 R 0.639 4.860 +- 3.856
241 P 0.639 4.860 +- 3.856
242 P 0.639 4.860 +- 3.856
243 K 0.639 4.860 +- 3.856
244 F 0.639 4.860 +- 3.856
245 Q 0.639 4.860 +- 3.856
246 G 0.639 4.860 +- 3.856
247 A 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:33
Model 1: NearlyNeutral -979.874157 Model 2: PositiveSelection -979.649221 Model 0: one-ratio -979.649208 Model 7: beta -979.874155 Model 8: beta&w>1 -979.649221 Model 0 vs 1 0.44989799999984825 Model 2 vs 1 0.4498719999999139 Model 8 vs 7 0.449867999999924
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
