--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:09:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/rpsQ/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -532.34          -535.40
2       -532.30          -536.54
--------------------------------------
TOTAL     -532.32          -536.12
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.864628    0.085718    0.362501    1.478783    0.834164   1460.78   1480.89    1.000
r(A<->C){all}   0.156066    0.017462    0.000011    0.420224    0.124690    364.48    378.17    1.003
r(A<->G){all}   0.152770    0.018554    0.000002    0.429607    0.114033    281.91    299.65    1.002
r(A<->T){all}   0.166205    0.019661    0.000011    0.447319    0.133537    166.04    202.97    1.003
r(C<->G){all}   0.156334    0.020457    0.000028    0.468683    0.114950    234.46    238.86    1.001
r(C<->T){all}   0.161201    0.022549    0.000116    0.481651    0.113170    154.01    171.12    1.000
r(G<->T){all}   0.207425    0.023196    0.000225    0.498694    0.176712    177.05    264.00    1.006
pi(A){all}      0.265231    0.000498    0.222645    0.308772    0.264508   1302.04   1375.08    1.000
pi(C){all}      0.244884    0.000470    0.201856    0.286048    0.244475   1261.73   1381.36    1.000
pi(G){all}      0.320028    0.000565    0.272011    0.364057    0.319839   1194.70   1347.85    1.000
pi(T){all}      0.169857    0.000374    0.132730    0.207325    0.169341   1196.51   1250.12    1.000
alpha{1,2}      0.349867    0.161262    0.000595    1.129292    0.221040   1273.35   1328.41    1.000
alpha{3}        0.400992    0.217771    0.000135    1.376451    0.233324   1180.95   1256.15    1.000
pinvar{all}     0.990688    0.000063    0.975490    0.999851    0.992888   1468.14   1484.57    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-507.838844
Model 2: PositiveSelection	-507.470636
Model 0: one-ratio	-507.612393
Model 7: beta	-507.838843
Model 8: beta&w>1	-507.468702


Model 0 vs 1	0.4529019999999946

Model 2 vs 1	0.7364159999999629

Model 8 vs 7	0.7402819999999792
>C1
MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C2
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C3
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C4
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C5
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C6
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=127 

C1              MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
C2              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C3              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C4              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C5              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C6              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
                *********************** **************************

C1              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C2              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C3              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C4              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C5              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C6              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
                **************************************************

C1              DRVSLMETRPLSATKRWRLVEILEKAK
C2              DRVSLMETRPLSATKRWRLVEILEKAK
C3              DRVSLMETRPLSATKRWRLVEILEKAK
C4              DRVSLMETRPLSATKRWRLVEILEKAK
C5              DRVSLMETRPLSATKRWRLVEILEKAK
C6              DRVSLMETRPLSATKRWRLVEILEKAK
                ***************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  127 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  127 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3810]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3810]--->[3810]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.440 Mb, Max= 30.636 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
C2              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C3              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C4              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C5              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C6              MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
                *********************** **************************

C1              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C2              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C3              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C4              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C5              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C6              MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
                **************************************************

C1              DRVSLMETRPLSATKRWRLVEILEKAK
C2              DRVSLMETRPLSATKRWRLVEILEKAK
C3              DRVSLMETRPLSATKRWRLVEILEKAK
C4              DRVSLMETRPLSATKRWRLVEILEKAK
C5              DRVSLMETRPLSATKRWRLVEILEKAK
C6              DRVSLMETRPLSATKRWRLVEILEKAK
                ***************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.21 C1	 C2	 99.21
TOP	    1    0	 99.21 C2	 C1	 99.21
BOT	    0    2	 99.21 C1	 C3	 99.21
TOP	    2    0	 99.21 C3	 C1	 99.21
BOT	    0    3	 99.21 C1	 C4	 99.21
TOP	    3    0	 99.21 C4	 C1	 99.21
BOT	    0    4	 99.21 C1	 C5	 99.21
TOP	    4    0	 99.21 C5	 C1	 99.21
BOT	    0    5	 99.21 C1	 C6	 99.21
TOP	    5    0	 99.21 C6	 C1	 99.21
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 99.21
AVG	 1	 C2	  *	 99.84
AVG	 2	 C3	  *	 99.84
AVG	 3	 C4	  *	 99.84
AVG	 4	 C5	  *	 99.84
AVG	 5	 C6	  *	 99.84
TOT	 TOT	  *	 99.74
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C2              ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C3              ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C4              ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C5              ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C6              ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
                **************************************************

C1              CACAGCCGCTCCTAAGGGAGTAGCTGTCAAGGGTGGCGTATCAAAAGACA
C2              CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C3              CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C4              CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C5              CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C6              CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
                ******************** *****************************

C1              AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C2              AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C3              AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C4              AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C5              AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C6              AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
                **************************************************

C1              ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C2              ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C3              ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C4              ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C5              ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C6              ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
                **************************************************

C1              TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C2              TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C3              TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C4              TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C5              TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C6              TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
                **************************************************

C1              CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C2              CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C3              CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C4              CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C5              CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C6              CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
                **************************************************

C1              GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C2              GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C3              GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C4              GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C5              GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C6              GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
                **************************************************

C1              GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C2              GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C3              GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C4              GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C5              GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C6              GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
                *******************************



>C1
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGTAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C2
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C3
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C4
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C5
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C6
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C1
MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C2
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C3
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C4
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C5
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C6
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 381 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788452
      Setting output file names to "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1482563601
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0729204141
      Seed = 573140179
      Swapseed = 1579788452
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 5 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -856.097531 -- -24.965149
         Chain 2 -- -856.099129 -- -24.965149
         Chain 3 -- -856.099129 -- -24.965149
         Chain 4 -- -856.099129 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -856.099129 -- -24.965149
         Chain 2 -- -856.099129 -- -24.965149
         Chain 3 -- -856.097531 -- -24.965149
         Chain 4 -- -856.098933 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-856.098] (-856.099) (-856.099) (-856.099) * [-856.099] (-856.099) (-856.098) (-856.099) 
        500 -- (-539.363) (-536.030) (-538.930) [-543.536] * (-533.200) (-544.833) (-543.841) [-547.861] -- 0:00:00
       1000 -- (-536.285) (-537.695) [-534.652] (-541.267) * (-538.790) [-538.396] (-540.213) (-538.432) -- 0:00:00
       1500 -- (-536.710) (-532.663) [-534.168] (-533.955) * [-539.122] (-537.376) (-538.199) (-537.119) -- 0:00:00
       2000 -- (-537.240) (-539.095) [-534.757] (-540.174) * (-541.091) (-536.365) (-540.709) [-535.943] -- 0:00:00
       2500 -- (-543.589) [-533.995] (-542.387) (-539.135) * (-542.253) [-535.936] (-536.237) (-543.570) -- 0:00:00
       3000 -- (-541.275) (-543.850) [-544.156] (-540.018) * (-538.131) [-541.516] (-537.768) (-535.081) -- 0:00:00
       3500 -- (-546.301) (-543.750) (-539.521) [-539.249] * (-542.919) [-539.178] (-533.047) (-535.749) -- 0:00:00
       4000 -- [-533.199] (-543.866) (-544.928) (-540.176) * (-534.232) (-544.120) [-536.537] (-539.447) -- 0:00:00
       4500 -- (-539.255) (-533.879) (-533.593) [-534.342] * [-539.243] (-537.908) (-535.223) (-536.309) -- 0:00:00
       5000 -- (-540.366) [-542.270] (-531.611) (-538.520) * (-537.336) (-545.235) (-542.471) [-534.648] -- 0:00:00

      Average standard deviation of split frequencies: 0.117851

       5500 -- (-541.507) (-536.891) (-531.913) [-534.963] * (-537.659) (-536.767) [-537.742] (-536.272) -- 0:00:00
       6000 -- (-540.009) [-535.538] (-535.854) (-537.948) * [-532.878] (-540.161) (-536.880) (-544.626) -- 0:00:00
       6500 -- [-540.509] (-542.641) (-541.477) (-542.127) * [-537.215] (-542.629) (-542.324) (-540.853) -- 0:00:00
       7000 -- (-546.566) [-532.809] (-535.282) (-532.821) * (-548.686) [-535.934] (-548.628) (-535.844) -- 0:00:00
       7500 -- [-545.262] (-542.607) (-535.578) (-534.718) * (-544.103) (-542.837) [-543.505] (-542.188) -- 0:00:00
       8000 -- (-538.116) (-537.825) [-538.709] (-536.965) * (-541.828) [-532.357] (-537.641) (-533.630) -- 0:00:00
       8500 -- (-543.900) [-535.080] (-533.278) (-536.313) * (-535.672) (-539.640) [-532.613] (-550.435) -- 0:00:00
       9000 -- (-548.630) (-538.133) [-535.850] (-538.939) * (-533.519) (-541.805) [-539.720] (-539.727) -- 0:00:00
       9500 -- [-539.154] (-537.439) (-539.651) (-546.793) * (-537.746) [-535.414] (-540.177) (-547.072) -- 0:00:00
      10000 -- (-541.196) [-534.894] (-537.198) (-540.273) * [-537.698] (-537.769) (-532.959) (-546.409) -- 0:00:00

      Average standard deviation of split frequencies: 0.092597

      10500 -- [-536.193] (-545.754) (-534.081) (-539.838) * [-535.507] (-545.322) (-545.671) (-535.784) -- 0:00:00
      11000 -- (-542.580) (-537.844) (-545.628) [-545.734] * [-534.710] (-539.839) (-543.200) (-540.067) -- 0:00:00
      11500 -- (-538.875) [-538.420] (-535.623) (-538.773) * (-537.712) [-533.933] (-533.044) (-543.075) -- 0:00:00
      12000 -- (-540.686) (-537.402) (-541.105) [-536.327] * (-539.189) (-537.743) (-537.264) [-536.210] -- 0:00:00
      12500 -- (-554.682) [-532.649] (-548.919) (-535.171) * (-536.603) (-534.685) [-534.407] (-541.905) -- 0:00:00
      13000 -- (-545.511) [-533.927] (-543.510) (-536.780) * (-537.512) (-538.754) [-536.201] (-542.652) -- 0:00:00
      13500 -- (-549.477) [-536.606] (-542.351) (-541.277) * [-538.825] (-545.618) (-532.743) (-537.324) -- 0:00:00
      14000 -- (-533.191) [-544.391] (-540.668) (-534.962) * (-536.789) (-534.942) (-533.874) [-535.771] -- 0:01:10
      14500 -- (-532.566) (-541.993) [-539.965] (-536.399) * (-535.283) [-534.620] (-534.308) (-546.936) -- 0:01:07
      15000 -- (-533.315) (-546.164) [-530.814] (-536.191) * (-536.649) (-537.709) (-533.827) [-535.887] -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-534.044) [-537.496] (-543.592) (-541.346) * (-537.426) [-537.553] (-536.074) (-540.261) -- 0:01:03
      16000 -- (-532.383) (-542.760) (-549.435) [-542.270] * (-535.989) (-536.421) (-533.504) [-535.759] -- 0:01:01
      16500 -- (-534.100) (-536.417) (-537.125) [-532.732] * (-534.596) (-535.520) (-532.848) [-536.978] -- 0:00:59
      17000 -- (-533.092) (-535.123) (-533.387) [-532.822] * (-538.013) (-538.257) (-535.219) [-534.448] -- 0:00:57
      17500 -- (-535.257) [-532.912] (-532.146) (-536.315) * (-536.189) [-541.640] (-534.661) (-542.005) -- 0:00:56
      18000 -- (-535.929) [-540.424] (-538.624) (-534.811) * (-539.685) (-536.387) [-532.335] (-537.759) -- 0:00:54
      18500 -- (-538.835) (-535.553) [-542.117] (-533.647) * (-537.840) [-539.436] (-536.672) (-545.447) -- 0:00:53
      19000 -- (-536.954) (-546.687) [-533.841] (-533.109) * (-533.962) [-536.240] (-533.703) (-554.680) -- 0:00:51
      19500 -- (-535.180) (-535.615) [-532.644] (-536.104) * [-533.092] (-536.135) (-534.748) (-552.768) -- 0:00:50
      20000 -- (-532.568) (-533.813) [-532.578] (-533.426) * (-543.166) [-533.497] (-534.914) (-544.636) -- 0:00:49

      Average standard deviation of split frequencies: 0.043339

      20500 -- (-534.804) (-536.498) (-532.863) [-533.288] * (-536.806) [-532.477] (-536.402) (-535.760) -- 0:00:47
      21000 -- (-536.231) (-540.748) [-535.860] (-535.205) * [-541.230] (-536.410) (-534.346) (-532.329) -- 0:00:46
      21500 -- (-534.210) [-535.169] (-536.292) (-534.375) * (-544.907) (-537.733) (-533.814) [-533.815] -- 0:00:45
      22000 -- (-534.959) (-539.981) [-533.913] (-533.016) * (-542.718) [-537.034] (-533.693) (-534.902) -- 0:00:44
      22500 -- (-534.582) [-534.187] (-534.504) (-533.545) * (-539.535) (-540.313) [-534.298] (-531.897) -- 0:00:43
      23000 -- (-534.449) (-537.750) [-533.481] (-535.313) * (-539.104) (-535.765) [-533.282] (-533.055) -- 0:00:42
      23500 -- (-533.539) [-538.267] (-538.071) (-534.660) * (-538.348) (-540.216) [-532.640] (-537.043) -- 0:00:41
      24000 -- (-532.847) (-544.999) [-531.564] (-532.859) * (-534.753) [-539.760] (-532.438) (-534.407) -- 0:00:40
      24500 -- (-533.902) [-537.035] (-535.971) (-534.573) * [-537.680] (-536.664) (-533.280) (-536.109) -- 0:00:39
      25000 -- (-534.701) (-540.330) (-532.837) [-533.737] * (-539.855) (-542.927) [-534.474] (-532.369) -- 0:00:39

      Average standard deviation of split frequencies: 0.037910

      25500 -- (-534.569) [-535.314] (-532.610) (-533.212) * (-539.695) (-557.480) (-533.780) [-531.014] -- 0:00:38
      26000 -- (-530.785) [-537.025] (-533.267) (-533.408) * [-539.150] (-545.106) (-532.443) (-532.299) -- 0:00:37
      26500 -- (-532.101) [-540.800] (-533.559) (-533.772) * (-543.713) (-533.627) (-534.613) [-533.739] -- 0:00:36
      27000 -- (-531.647) (-538.050) [-534.138] (-534.745) * (-538.533) (-541.592) [-534.030] (-533.074) -- 0:00:36
      27500 -- (-532.416) (-540.515) [-531.941] (-532.591) * [-534.389] (-535.774) (-534.172) (-534.033) -- 0:00:35
      28000 -- (-533.195) (-544.916) (-532.023) [-533.384] * [-541.396] (-533.207) (-532.135) (-533.974) -- 0:00:34
      28500 -- [-531.857] (-532.226) (-535.748) (-533.543) * (-533.848) (-533.817) [-531.382] (-532.639) -- 0:00:34
      29000 -- [-532.672] (-533.294) (-534.204) (-534.836) * [-539.502] (-535.620) (-534.703) (-534.843) -- 0:01:06
      29500 -- (-532.644) [-531.668] (-532.726) (-537.878) * [-536.092] (-532.720) (-535.440) (-533.200) -- 0:01:05
      30000 -- (-533.975) [-533.077] (-531.761) (-532.711) * (-538.779) (-533.163) (-534.370) [-533.577] -- 0:01:04

      Average standard deviation of split frequencies: 0.039198

      30500 -- [-531.899] (-534.264) (-535.579) (-540.003) * [-535.043] (-533.720) (-531.855) (-534.128) -- 0:01:03
      31000 -- [-530.290] (-533.204) (-536.807) (-533.251) * (-543.851) [-532.499] (-531.655) (-531.635) -- 0:01:02
      31500 -- (-535.710) [-530.535] (-534.799) (-533.862) * (-534.992) [-533.875] (-534.965) (-535.240) -- 0:01:01
      32000 -- [-531.800] (-538.803) (-536.649) (-535.706) * (-538.104) (-533.578) [-532.755] (-535.987) -- 0:01:00
      32500 -- (-535.533) (-532.922) [-533.442] (-534.321) * [-536.782] (-532.702) (-536.013) (-536.467) -- 0:00:59
      33000 -- [-535.647] (-534.533) (-532.722) (-534.222) * (-537.974) (-532.524) [-532.486] (-534.622) -- 0:00:58
      33500 -- (-540.462) (-530.573) (-539.064) [-534.161] * (-535.729) (-531.743) [-534.421] (-535.988) -- 0:00:57
      34000 -- (-540.788) (-531.798) [-532.694] (-532.828) * [-536.925] (-532.909) (-533.172) (-534.103) -- 0:00:56
      34500 -- (-533.020) [-532.137] (-534.428) (-531.372) * (-534.953) (-532.656) [-532.939] (-532.262) -- 0:00:55
      35000 -- (-535.743) (-531.030) [-533.121] (-530.397) * [-537.412] (-533.656) (-537.698) (-532.138) -- 0:00:55

      Average standard deviation of split frequencies: 0.039284

      35500 -- (-536.834) (-532.487) (-533.916) [-532.032] * [-539.102] (-532.176) (-532.508) (-534.331) -- 0:00:54
      36000 -- (-533.799) (-534.728) [-531.114] (-534.545) * (-540.786) [-532.385] (-533.824) (-536.286) -- 0:00:53
      36500 -- (-533.620) (-531.261) (-532.628) [-535.118] * (-544.691) (-531.475) (-534.093) [-534.346] -- 0:00:52
      37000 -- [-533.525] (-534.966) (-533.710) (-533.321) * [-540.587] (-534.156) (-535.107) (-533.252) -- 0:00:52
      37500 -- (-531.439) (-532.146) [-532.491] (-531.188) * [-533.964] (-535.585) (-534.767) (-531.860) -- 0:00:51
      38000 -- [-535.132] (-532.139) (-532.060) (-530.958) * [-531.322] (-532.386) (-531.468) (-531.720) -- 0:00:50
      38500 -- (-535.485) (-531.380) [-542.187] (-531.565) * (-534.187) [-533.774] (-532.490) (-533.849) -- 0:00:49
      39000 -- (-534.704) [-533.378] (-537.049) (-533.734) * (-533.170) (-534.796) (-533.672) [-535.992] -- 0:00:49
      39500 -- (-538.017) (-533.496) [-533.226] (-533.201) * (-531.586) (-536.551) [-534.290] (-531.406) -- 0:00:48
      40000 -- (-533.591) (-533.095) (-533.838) [-532.214] * (-532.634) [-531.707] (-532.796) (-532.064) -- 0:00:48

      Average standard deviation of split frequencies: 0.043317

      40500 -- (-538.501) (-533.598) (-537.421) [-531.722] * [-537.196] (-535.858) (-532.781) (-533.115) -- 0:00:47
      41000 -- (-532.497) (-533.561) [-530.492] (-534.810) * [-534.593] (-534.044) (-533.302) (-533.353) -- 0:00:46
      41500 -- (-534.059) (-532.119) (-534.485) [-531.208] * [-533.579] (-540.425) (-534.152) (-533.219) -- 0:00:46
      42000 -- (-530.227) (-533.313) (-530.486) [-531.970] * [-531.167] (-533.376) (-533.013) (-536.964) -- 0:00:45
      42500 -- (-535.751) (-532.018) (-532.396) [-535.170] * (-534.190) (-535.640) [-534.278] (-536.745) -- 0:00:45
      43000 -- (-533.883) [-530.988] (-534.396) (-533.758) * (-533.687) (-534.962) [-533.843] (-530.778) -- 0:00:44
      43500 -- (-536.228) (-534.348) (-532.478) [-531.207] * (-531.495) [-532.489] (-533.769) (-533.520) -- 0:01:05
      44000 -- (-533.254) (-533.691) [-532.860] (-530.721) * [-533.108] (-535.808) (-531.975) (-533.180) -- 0:01:05
      44500 -- (-534.619) (-532.731) [-533.506] (-531.248) * (-530.568) (-535.334) (-538.676) [-533.767] -- 0:01:04
      45000 -- (-538.008) (-533.126) (-533.348) [-531.139] * (-531.187) (-530.483) [-532.392] (-533.033) -- 0:01:03

      Average standard deviation of split frequencies: 0.042456

      45500 -- [-532.519] (-535.845) (-533.724) (-531.556) * (-533.395) (-534.179) (-534.906) [-533.707] -- 0:01:02
      46000 -- (-531.528) (-532.782) [-533.302] (-531.120) * (-535.415) (-531.090) (-534.639) [-533.521] -- 0:01:02
      46500 -- (-534.675) [-532.887] (-532.350) (-532.945) * (-535.019) (-533.055) (-534.022) [-533.067] -- 0:01:01
      47000 -- (-533.606) [-533.802] (-538.208) (-533.635) * (-536.533) (-531.887) (-533.164) [-532.166] -- 0:01:00
      47500 -- [-536.049] (-531.559) (-541.451) (-533.930) * (-533.305) [-533.082] (-539.400) (-535.026) -- 0:01:00
      48000 -- (-533.362) [-532.663] (-531.823) (-535.080) * (-533.558) [-533.505] (-536.472) (-533.467) -- 0:00:59
      48500 -- (-537.480) (-536.664) [-532.703] (-533.864) * (-539.814) [-531.708] (-534.038) (-531.500) -- 0:00:58
      49000 -- [-535.668] (-534.024) (-534.361) (-532.335) * [-534.108] (-532.693) (-533.433) (-534.145) -- 0:00:58
      49500 -- [-533.158] (-535.483) (-533.250) (-533.250) * [-535.135] (-533.602) (-532.893) (-535.935) -- 0:00:57
      50000 -- (-533.195) [-533.162] (-534.022) (-533.188) * (-535.628) (-533.009) [-532.551] (-533.383) -- 0:00:57

      Average standard deviation of split frequencies: 0.043092

      50500 -- (-533.175) [-533.831] (-536.279) (-532.182) * [-533.629] (-533.921) (-533.844) (-533.019) -- 0:00:56
      51000 -- [-537.441] (-537.016) (-532.146) (-532.035) * (-532.923) (-533.912) [-533.095] (-532.839) -- 0:00:55
      51500 -- (-536.711) (-533.435) (-535.684) [-533.383] * (-533.800) (-533.246) (-532.811) [-533.195] -- 0:00:55
      52000 -- (-533.425) [-532.807] (-534.913) (-532.928) * [-534.258] (-534.089) (-533.945) (-534.055) -- 0:00:54
      52500 -- (-533.206) (-530.981) [-532.873] (-532.830) * [-533.155] (-534.823) (-533.751) (-534.271) -- 0:00:54
      53000 -- (-534.696) [-532.405] (-537.940) (-532.367) * (-530.309) (-534.351) (-531.815) [-534.716] -- 0:00:53
      53500 -- (-533.666) (-536.434) [-533.069] (-533.619) * [-531.372] (-533.967) (-533.216) (-533.079) -- 0:00:53
      54000 -- (-535.916) (-535.083) (-532.221) [-535.096] * [-533.294] (-533.896) (-536.184) (-542.292) -- 0:00:52
      54500 -- (-533.139) (-532.819) [-531.595] (-532.540) * (-533.211) (-532.002) [-531.738] (-535.329) -- 0:00:52
      55000 -- (-537.260) (-532.640) [-533.828] (-531.644) * (-534.372) (-534.290) (-532.488) [-532.313] -- 0:00:51

      Average standard deviation of split frequencies: 0.030127

      55500 -- [-534.345] (-535.379) (-537.986) (-531.149) * (-539.542) [-536.534] (-534.630) (-534.847) -- 0:00:51
      56000 -- (-530.932) (-532.914) (-533.425) [-533.290] * (-537.226) (-531.476) [-533.404] (-534.406) -- 0:00:50
      56500 -- [-532.218] (-535.831) (-533.678) (-539.001) * (-537.545) (-535.879) [-533.453] (-533.289) -- 0:00:50
      57000 -- (-532.439) (-532.631) (-532.724) [-533.947] * (-532.616) (-533.145) [-533.342] (-535.148) -- 0:00:49
      57500 -- (-534.157) (-533.179) (-529.868) [-532.942] * (-535.255) (-532.646) [-532.137] (-533.743) -- 0:00:49
      58000 -- (-536.514) [-531.523] (-532.783) (-532.086) * (-535.082) [-535.259] (-532.278) (-535.222) -- 0:00:48
      58500 -- (-532.719) (-533.893) [-530.472] (-533.903) * (-535.166) (-534.296) (-532.298) [-537.215] -- 0:00:48
      59000 -- (-534.767) [-532.583] (-531.260) (-534.024) * [-531.902] (-534.134) (-532.373) (-536.585) -- 0:01:03
      59500 -- (-533.753) [-533.565] (-533.997) (-540.634) * (-532.215) [-533.137] (-533.060) (-537.497) -- 0:01:03
      60000 -- (-532.874) [-532.014] (-531.331) (-532.472) * [-534.372] (-531.863) (-531.914) (-536.780) -- 0:01:02

      Average standard deviation of split frequencies: 0.031470

      60500 -- (-533.435) (-533.831) [-532.213] (-531.466) * (-534.383) (-534.444) [-531.639] (-532.952) -- 0:01:02
      61000 -- (-534.143) [-534.861] (-529.624) (-532.776) * (-533.356) (-533.199) (-533.917) [-534.388] -- 0:01:01
      61500 -- [-535.392] (-534.636) (-532.115) (-534.780) * (-538.255) (-532.957) [-533.643] (-532.594) -- 0:01:01
      62000 -- (-533.230) (-534.472) [-533.173] (-536.514) * (-535.707) (-539.807) [-534.259] (-532.167) -- 0:01:00
      62500 -- (-535.703) [-535.905] (-531.102) (-532.215) * (-534.069) [-534.944] (-535.125) (-538.924) -- 0:01:00
      63000 -- (-537.607) [-534.828] (-534.843) (-532.204) * [-531.020] (-532.666) (-531.576) (-535.789) -- 0:00:59
      63500 -- (-534.763) [-531.614] (-535.322) (-531.393) * [-534.950] (-533.692) (-533.039) (-534.779) -- 0:00:58
      64000 -- (-532.288) (-533.154) (-533.699) [-532.925] * [-531.348] (-535.077) (-538.122) (-534.334) -- 0:00:58
      64500 -- (-532.224) (-541.015) (-531.862) [-531.074] * (-530.811) [-533.368] (-533.432) (-534.841) -- 0:00:58
      65000 -- [-535.895] (-531.763) (-531.738) (-537.244) * (-532.248) [-534.947] (-533.844) (-532.046) -- 0:00:57

      Average standard deviation of split frequencies: 0.028570

      65500 -- (-533.551) [-534.437] (-533.800) (-535.398) * [-533.724] (-533.710) (-531.559) (-534.105) -- 0:00:57
      66000 -- (-532.857) [-533.867] (-533.812) (-532.287) * [-531.625] (-535.178) (-532.811) (-532.423) -- 0:00:56
      66500 -- (-531.521) (-532.830) (-531.452) [-537.365] * [-533.277] (-535.695) (-534.573) (-534.367) -- 0:00:56
      67000 -- (-533.452) [-532.829] (-531.878) (-535.277) * (-532.633) [-533.605] (-535.605) (-537.088) -- 0:00:55
      67500 -- (-530.840) [-533.264] (-532.647) (-536.015) * (-536.772) (-536.705) [-532.586] (-533.350) -- 0:00:55
      68000 -- (-532.252) [-531.615] (-534.616) (-534.579) * (-535.221) (-536.603) (-536.122) [-532.225] -- 0:00:54
      68500 -- (-531.429) [-532.420] (-535.195) (-532.382) * [-533.467] (-534.711) (-537.239) (-535.033) -- 0:00:54
      69000 -- (-531.966) [-534.786] (-533.235) (-533.737) * (-530.670) (-532.286) (-539.089) [-536.505] -- 0:00:53
      69500 -- (-533.232) [-530.639] (-532.306) (-534.471) * (-532.541) (-535.047) [-533.151] (-535.662) -- 0:00:53
      70000 -- (-532.050) [-533.211] (-534.380) (-533.612) * (-531.997) [-533.686] (-534.243) (-534.762) -- 0:00:53

      Average standard deviation of split frequencies: 0.028351

      70500 -- (-535.272) (-532.673) [-532.855] (-532.313) * (-536.681) [-534.530] (-538.972) (-533.910) -- 0:00:52
      71000 -- (-534.272) (-535.738) [-531.250] (-533.943) * (-535.606) [-532.288] (-536.400) (-532.418) -- 0:00:52
      71500 -- [-533.800] (-534.447) (-535.101) (-532.471) * [-532.967] (-533.700) (-532.980) (-533.391) -- 0:00:51
      72000 -- (-534.061) (-530.794) (-533.549) [-532.345] * (-533.997) (-530.831) (-530.131) [-532.128] -- 0:00:51
      72500 -- (-535.991) [-536.884] (-535.529) (-532.834) * (-533.905) (-532.616) [-531.395] (-532.687) -- 0:00:51
      73000 -- (-533.140) (-532.288) (-532.420) [-531.701] * (-533.583) [-535.662] (-533.626) (-538.750) -- 0:00:50
      73500 -- [-533.208] (-534.520) (-536.031) (-533.442) * [-531.737] (-532.844) (-532.110) (-535.006) -- 0:00:50
      74000 -- (-531.856) (-537.304) [-531.805] (-533.380) * (-535.661) (-535.744) (-531.322) [-533.784] -- 0:00:50
      74500 -- (-531.595) (-531.320) (-532.767) [-533.850] * [-531.868] (-531.996) (-532.299) (-533.087) -- 0:00:49
      75000 -- (-533.194) (-530.543) (-532.588) [-533.053] * (-532.934) (-530.878) (-534.187) [-532.740] -- 0:01:01

      Average standard deviation of split frequencies: 0.030393

      75500 -- (-531.856) (-531.737) [-534.411] (-532.250) * [-533.322] (-530.782) (-532.639) (-531.628) -- 0:01:01
      76000 -- (-533.497) (-534.844) [-533.368] (-531.876) * (-531.019) (-533.522) [-534.176] (-531.372) -- 0:01:00
      76500 -- (-534.686) [-531.147] (-532.745) (-532.907) * (-533.526) (-532.887) (-537.040) [-531.408] -- 0:01:00
      77000 -- [-532.638] (-535.763) (-534.029) (-531.718) * (-535.922) [-534.104] (-534.072) (-532.097) -- 0:00:59
      77500 -- (-532.564) (-537.480) (-537.405) [-532.270] * [-532.724] (-533.930) (-535.163) (-535.716) -- 0:00:59
      78000 -- (-534.826) (-532.740) [-530.408] (-533.214) * (-538.541) [-533.506] (-540.248) (-530.406) -- 0:00:59
      78500 -- (-535.049) (-533.403) (-530.620) [-533.496] * (-533.122) (-533.579) [-536.392] (-532.791) -- 0:00:58
      79000 -- (-533.940) [-531.102] (-532.153) (-532.198) * (-530.025) [-530.906] (-534.257) (-535.817) -- 0:00:58
      79500 -- (-531.953) (-535.078) [-531.592] (-534.504) * (-531.594) (-531.899) [-538.722] (-534.622) -- 0:00:57
      80000 -- (-533.706) (-536.046) [-532.098] (-536.261) * [-532.878] (-536.296) (-539.941) (-536.327) -- 0:00:57

      Average standard deviation of split frequencies: 0.027466

      80500 -- (-532.078) [-532.973] (-531.134) (-532.198) * (-535.366) (-532.713) [-533.286] (-534.797) -- 0:00:57
      81000 -- (-531.601) (-531.124) [-531.169] (-535.482) * [-533.382] (-537.267) (-534.416) (-531.885) -- 0:00:56
      81500 -- (-535.900) (-534.085) [-532.694] (-532.378) * (-533.683) [-531.989] (-533.304) (-533.163) -- 0:00:56
      82000 -- [-532.948] (-535.799) (-535.075) (-531.994) * (-535.234) (-532.842) (-534.045) [-534.310] -- 0:00:55
      82500 -- (-530.653) (-531.302) [-536.992] (-533.126) * (-531.986) (-535.564) [-534.601] (-538.004) -- 0:00:55
      83000 -- (-535.281) (-534.302) (-534.261) [-532.083] * (-534.110) (-532.057) (-535.824) [-537.289] -- 0:00:55
      83500 -- (-533.114) (-533.830) (-536.599) [-536.214] * [-532.787] (-534.482) (-538.178) (-531.885) -- 0:00:54
      84000 -- (-529.789) (-534.783) (-532.645) [-533.059] * [-534.133] (-532.965) (-535.836) (-535.967) -- 0:00:54
      84500 -- (-534.327) [-534.511] (-533.021) (-533.078) * (-537.467) (-531.713) [-534.509] (-531.796) -- 0:00:54
      85000 -- (-531.584) [-533.126] (-533.905) (-535.237) * [-534.214] (-537.680) (-533.086) (-536.797) -- 0:00:53

      Average standard deviation of split frequencies: 0.020830

      85500 -- (-536.487) [-531.728] (-533.393) (-532.156) * [-531.140] (-537.994) (-532.695) (-535.127) -- 0:00:53
      86000 -- (-539.501) [-534.165] (-532.426) (-531.583) * (-530.298) (-533.828) [-532.713] (-532.010) -- 0:00:53
      86500 -- [-534.032] (-531.792) (-538.481) (-531.694) * (-531.627) [-533.728] (-533.359) (-537.417) -- 0:00:52
      87000 -- [-532.972] (-531.918) (-535.488) (-533.499) * (-532.453) [-532.928] (-536.382) (-531.732) -- 0:00:52
      87500 -- (-535.005) (-532.342) (-535.068) [-533.742] * (-531.614) (-537.883) (-533.506) [-535.953] -- 0:00:52
      88000 -- (-533.102) [-534.653] (-533.471) (-538.724) * (-530.490) [-533.917] (-533.625) (-531.524) -- 0:00:51
      88500 -- (-532.662) (-534.733) [-532.707] (-534.564) * [-534.784] (-536.305) (-538.187) (-531.873) -- 0:00:51
      89000 -- (-532.065) (-537.518) (-536.452) [-533.688] * (-536.290) (-537.364) [-536.326] (-532.718) -- 0:00:51
      89500 -- (-533.126) (-533.652) (-532.502) [-535.372] * (-535.308) [-532.237] (-534.113) (-536.316) -- 0:00:50
      90000 -- (-533.076) (-532.174) [-532.041] (-537.497) * (-534.841) (-531.228) [-536.284] (-534.807) -- 0:00:50

      Average standard deviation of split frequencies: 0.022283

      90500 -- (-538.797) (-535.203) (-533.668) [-533.635] * [-531.646] (-532.714) (-535.455) (-533.760) -- 0:00:50
      91000 -- (-533.928) (-535.072) (-531.394) [-534.854] * (-532.552) (-533.330) [-531.846] (-533.089) -- 0:00:59
      91500 -- [-535.089] (-534.872) (-533.934) (-533.498) * (-531.820) (-534.259) (-537.468) [-532.745] -- 0:00:59
      92000 -- (-536.349) [-530.459] (-538.742) (-534.947) * (-533.279) [-531.132] (-533.456) (-534.003) -- 0:00:59
      92500 -- (-533.019) (-539.198) [-532.477] (-535.851) * (-533.406) (-531.197) [-533.085] (-537.108) -- 0:00:58
      93000 -- (-536.097) [-534.599] (-531.087) (-533.836) * (-533.641) [-532.486] (-536.827) (-532.534) -- 0:00:58
      93500 -- (-533.661) [-536.113] (-532.279) (-536.292) * (-533.417) (-536.993) (-533.594) [-534.140] -- 0:00:58
      94000 -- (-536.905) [-535.525] (-533.179) (-535.335) * (-535.133) [-534.264] (-532.743) (-534.226) -- 0:00:57
      94500 -- (-536.345) (-533.135) [-536.612] (-534.240) * (-535.056) (-534.320) (-533.626) [-534.542] -- 0:00:57
      95000 -- (-532.350) (-531.503) [-531.411] (-536.377) * (-542.155) (-534.775) (-534.105) [-534.846] -- 0:00:57

      Average standard deviation of split frequencies: 0.023851

      95500 -- [-534.789] (-532.035) (-533.254) (-531.490) * (-536.627) [-538.880] (-533.045) (-534.254) -- 0:00:56
      96000 -- (-536.357) (-537.549) (-533.009) [-533.518] * (-532.919) (-531.564) (-532.542) [-532.641] -- 0:00:56
      96500 -- (-532.230) [-532.678] (-535.202) (-531.753) * (-532.889) [-530.698] (-531.483) (-533.529) -- 0:00:56
      97000 -- (-535.321) [-533.549] (-535.187) (-531.755) * (-532.352) (-531.960) (-532.467) [-532.258] -- 0:00:55
      97500 -- (-536.083) (-532.705) (-535.919) [-532.187] * [-533.214] (-531.614) (-533.123) (-531.271) -- 0:00:55
      98000 -- (-533.896) (-531.782) (-537.261) [-533.937] * (-532.731) (-530.950) [-532.908] (-532.265) -- 0:00:55
      98500 -- (-535.695) [-533.905] (-532.691) (-531.707) * (-534.776) (-531.639) (-533.273) [-532.434] -- 0:00:54
      99000 -- (-533.927) [-532.285] (-533.962) (-533.034) * (-533.226) (-534.101) (-532.008) [-532.963] -- 0:00:54
      99500 -- (-536.163) [-534.390] (-534.315) (-532.885) * (-533.271) (-531.764) [-533.835] (-532.164) -- 0:00:54
      100000 -- (-534.091) (-536.306) (-533.226) [-532.838] * (-531.677) (-535.602) [-534.917] (-534.287) -- 0:00:54

      Average standard deviation of split frequencies: 0.025287

      100500 -- [-533.093] (-535.746) (-533.331) (-532.244) * (-532.293) (-530.709) (-532.847) [-532.174] -- 0:00:53
      101000 -- (-535.523) (-534.561) [-533.792] (-532.841) * (-533.048) [-531.679] (-533.345) (-532.814) -- 0:00:53
      101500 -- (-533.566) [-531.814] (-531.707) (-534.508) * [-532.133] (-531.706) (-534.307) (-533.760) -- 0:00:53
      102000 -- (-534.894) (-534.296) (-536.319) [-536.315] * (-531.464) (-530.639) [-531.196] (-534.460) -- 0:00:52
      102500 -- (-531.177) (-531.441) [-534.323] (-534.049) * (-530.686) (-532.554) [-531.930] (-532.374) -- 0:00:52
      103000 -- (-532.548) (-531.209) [-534.792] (-533.374) * (-530.449) (-532.827) [-532.061] (-532.469) -- 0:00:52
      103500 -- (-537.951) (-532.531) (-531.562) [-536.514] * (-533.350) [-530.724] (-530.903) (-533.496) -- 0:00:51
      104000 -- (-538.649) (-540.530) (-533.775) [-532.127] * (-532.253) [-530.128] (-532.242) (-534.872) -- 0:00:51
      104500 -- (-535.131) [-533.683] (-532.409) (-534.789) * (-531.839) (-531.435) [-531.804] (-536.088) -- 0:00:51
      105000 -- [-532.303] (-533.821) (-536.837) (-531.318) * (-532.200) [-531.698] (-532.055) (-534.054) -- 0:00:51

      Average standard deviation of split frequencies: 0.023045

      105500 -- (-530.839) (-534.150) [-531.487] (-532.735) * (-533.362) [-532.570] (-531.752) (-535.969) -- 0:00:50
      106000 -- (-532.629) (-534.486) (-535.409) [-533.564] * (-531.322) [-534.388] (-533.947) (-538.537) -- 0:00:50
      106500 -- (-537.195) [-534.820] (-532.633) (-533.569) * (-532.751) (-532.668) (-532.668) [-530.784] -- 0:00:58
      107000 -- (-531.813) (-533.164) (-540.823) [-533.563] * (-533.928) (-533.299) [-533.234] (-533.562) -- 0:00:58
      107500 -- (-535.369) (-533.166) [-533.573] (-534.197) * [-530.672] (-532.339) (-530.173) (-533.747) -- 0:00:58
      108000 -- (-533.384) (-534.361) [-534.938] (-536.371) * (-533.689) (-535.356) (-531.679) [-533.864] -- 0:00:57
      108500 -- [-536.657] (-534.508) (-538.536) (-539.730) * (-533.679) (-532.343) (-531.538) [-533.131] -- 0:00:57
      109000 -- (-530.743) (-532.448) [-534.571] (-539.418) * [-535.647] (-535.204) (-535.338) (-532.882) -- 0:00:57
      109500 -- [-530.796] (-533.024) (-534.315) (-531.622) * [-533.672] (-532.161) (-538.850) (-532.841) -- 0:00:56
      110000 -- (-533.350) [-532.659] (-534.744) (-532.067) * (-533.923) (-533.004) (-535.976) [-533.637] -- 0:00:56

      Average standard deviation of split frequencies: 0.025110

      110500 -- [-532.167] (-533.647) (-535.365) (-533.685) * (-533.002) (-531.989) (-535.412) [-531.998] -- 0:00:56
      111000 -- [-530.444] (-535.812) (-534.168) (-534.827) * (-533.333) [-532.494] (-533.337) (-533.507) -- 0:00:56
      111500 -- (-531.668) (-531.934) (-534.945) [-531.095] * (-534.400) (-533.252) (-531.595) [-532.098] -- 0:00:55
      112000 -- [-531.202] (-533.146) (-530.554) (-534.498) * (-534.459) [-531.949] (-531.752) (-533.588) -- 0:00:55
      112500 -- (-533.062) (-533.165) (-532.351) [-533.368] * (-536.874) (-533.900) [-532.297] (-530.022) -- 0:00:55
      113000 -- (-533.378) (-532.788) (-531.673) [-532.786] * (-534.576) [-533.024] (-536.143) (-534.109) -- 0:00:54
      113500 -- (-530.480) [-531.748] (-530.943) (-535.750) * (-534.206) (-534.426) (-535.233) [-532.578] -- 0:00:54
      114000 -- (-531.802) (-533.786) (-536.205) [-535.530] * [-533.179] (-533.657) (-534.953) (-534.212) -- 0:00:54
      114500 -- [-533.242] (-535.394) (-532.130) (-531.763) * (-532.919) (-533.347) (-535.383) [-531.696] -- 0:00:54
      115000 -- [-533.474] (-536.996) (-532.573) (-534.444) * (-532.695) [-533.941] (-535.940) (-532.343) -- 0:00:53

      Average standard deviation of split frequencies: 0.023527

      115500 -- (-535.607) (-532.322) (-532.245) [-531.733] * [-534.238] (-536.832) (-534.669) (-532.710) -- 0:00:53
      116000 -- (-534.898) (-536.036) [-535.238] (-531.752) * (-535.225) (-533.691) [-534.293] (-532.897) -- 0:00:53
      116500 -- (-534.235) (-531.539) (-540.632) [-531.358] * (-535.125) (-533.015) (-532.690) [-531.297] -- 0:00:53
      117000 -- (-531.823) [-530.909] (-532.357) (-532.351) * [-534.855] (-536.982) (-534.502) (-530.303) -- 0:00:52
      117500 -- [-533.857] (-534.053) (-533.899) (-534.043) * (-534.462) (-533.608) [-534.451] (-534.452) -- 0:00:52
      118000 -- (-532.285) (-532.234) (-534.797) [-529.161] * (-538.156) (-532.615) (-531.012) [-530.821] -- 0:00:52
      118500 -- [-530.573] (-531.878) (-534.003) (-531.055) * (-535.401) [-531.242] (-533.830) (-531.478) -- 0:00:52
      119000 -- (-531.061) (-534.663) [-535.497] (-534.681) * (-536.504) (-536.088) (-532.245) [-532.237] -- 0:00:51
      119500 -- (-531.197) [-533.885] (-532.942) (-534.426) * [-531.344] (-536.448) (-531.878) (-531.669) -- 0:00:51
      120000 -- (-534.997) (-532.666) (-537.170) [-532.873] * (-533.661) (-533.881) [-533.388] (-532.683) -- 0:00:51

      Average standard deviation of split frequencies: 0.019122

      120500 -- (-533.237) (-533.692) (-535.949) [-533.713] * (-532.526) (-533.008) (-533.107) [-535.225] -- 0:00:51
      121000 -- (-532.827) (-534.298) [-535.528] (-533.522) * [-531.737] (-533.181) (-534.100) (-534.212) -- 0:00:50
      121500 -- (-535.104) (-534.373) (-535.444) [-531.206] * (-532.414) (-539.534) [-532.160] (-532.155) -- 0:00:50
      122000 -- (-535.405) (-534.375) [-533.013] (-532.667) * [-531.932] (-532.675) (-533.967) (-530.053) -- 0:00:50
      122500 -- (-533.364) (-533.754) (-532.569) [-533.977] * [-532.999] (-534.273) (-531.748) (-532.411) -- 0:00:57
      123000 -- (-532.491) (-532.703) [-533.383] (-537.216) * [-532.978] (-532.679) (-533.694) (-531.119) -- 0:00:57
      123500 -- (-532.604) [-536.733] (-532.774) (-530.505) * (-533.060) [-532.072] (-532.548) (-529.477) -- 0:00:56
      124000 -- (-533.413) (-533.024) [-532.741] (-532.674) * (-530.990) (-535.694) (-531.969) [-530.848] -- 0:00:56
      124500 -- (-537.712) [-532.879] (-533.274) (-532.186) * (-534.358) [-534.683] (-529.828) (-533.830) -- 0:00:56
      125000 -- [-533.046] (-536.799) (-538.795) (-537.728) * [-532.653] (-533.525) (-532.831) (-533.993) -- 0:00:56

      Average standard deviation of split frequencies: 0.020764

      125500 -- (-531.852) [-535.112] (-536.831) (-542.153) * [-533.114] (-533.840) (-531.920) (-533.287) -- 0:00:55
      126000 -- (-530.847) (-533.406) [-533.866] (-538.637) * (-531.404) (-534.967) [-535.182] (-537.883) -- 0:00:55
      126500 -- (-533.031) (-533.559) [-537.351] (-531.309) * (-532.108) (-533.222) (-532.463) [-532.753] -- 0:00:55
      127000 -- (-531.411) (-533.354) (-539.315) [-532.010] * (-533.446) [-532.940] (-531.835) (-532.570) -- 0:00:54
      127500 -- (-531.518) (-533.596) (-536.122) [-532.173] * (-536.864) (-533.092) (-531.445) [-533.783] -- 0:00:54
      128000 -- [-531.907] (-533.492) (-536.963) (-533.537) * (-532.767) [-531.674] (-532.842) (-534.883) -- 0:00:54
      128500 -- [-529.647] (-534.391) (-537.638) (-534.582) * [-532.405] (-533.470) (-535.815) (-531.862) -- 0:00:54
      129000 -- (-533.558) [-536.721] (-534.466) (-530.736) * (-531.367) (-534.682) [-532.191] (-534.013) -- 0:00:54
      129500 -- (-531.265) (-539.343) [-532.633] (-533.760) * (-533.195) (-533.586) [-531.899] (-534.958) -- 0:00:53
      130000 -- [-532.202] (-532.423) (-533.354) (-532.049) * (-533.024) (-533.171) [-529.912] (-533.210) -- 0:00:53

      Average standard deviation of split frequencies: 0.018798

      130500 -- [-533.690] (-533.629) (-533.792) (-530.633) * (-535.470) (-533.171) (-531.455) [-530.523] -- 0:00:53
      131000 -- (-533.960) (-534.288) (-532.263) [-534.606] * (-533.842) (-532.727) [-535.785] (-530.870) -- 0:00:53
      131500 -- (-533.702) (-533.756) [-532.201] (-533.052) * (-530.876) (-535.604) (-537.069) [-531.299] -- 0:00:52
      132000 -- (-537.093) (-535.739) [-532.812] (-531.535) * (-533.404) [-534.202] (-531.348) (-534.912) -- 0:00:52
      132500 -- (-537.532) (-531.936) [-532.525] (-532.432) * (-534.544) (-532.448) (-531.220) [-531.122] -- 0:00:52
      133000 -- [-534.867] (-533.498) (-535.280) (-532.734) * (-532.874) [-531.976] (-532.786) (-537.582) -- 0:00:52
      133500 -- (-532.495) (-532.297) [-530.909] (-533.372) * (-533.729) [-532.385] (-532.283) (-531.313) -- 0:00:51
      134000 -- (-534.593) [-533.737] (-532.261) (-532.000) * (-533.021) (-533.565) [-531.520] (-532.499) -- 0:00:51
      134500 -- (-532.986) (-536.833) (-533.699) [-536.355] * (-532.393) (-531.238) [-534.052] (-533.810) -- 0:00:51
      135000 -- [-536.179] (-533.872) (-533.178) (-536.260) * (-532.877) (-533.945) (-531.621) [-536.224] -- 0:00:51

      Average standard deviation of split frequencies: 0.017513

      135500 -- (-531.441) [-534.890] (-531.715) (-535.146) * [-532.332] (-532.411) (-532.572) (-536.085) -- 0:00:51
      136000 -- [-533.206] (-543.205) (-534.089) (-532.327) * (-534.248) (-531.440) [-532.155] (-534.232) -- 0:00:50
      136500 -- (-531.156) (-539.644) [-534.046] (-533.203) * (-533.644) [-531.100] (-533.157) (-533.939) -- 0:00:50
      137000 -- [-531.904] (-534.283) (-533.344) (-531.622) * [-533.757] (-532.369) (-532.733) (-534.875) -- 0:00:50
      137500 -- (-540.855) (-534.065) (-533.584) [-533.972] * (-531.809) (-530.925) [-532.401] (-536.024) -- 0:00:50
      138000 -- (-534.377) [-533.542] (-531.197) (-530.476) * (-531.777) (-534.358) [-533.387] (-531.977) -- 0:00:56
      138500 -- (-534.852) [-532.089] (-531.142) (-531.292) * (-534.284) (-535.991) (-533.692) [-532.387] -- 0:00:55
      139000 -- (-531.807) (-534.548) (-533.292) [-530.477] * (-537.981) [-531.401] (-534.082) (-534.200) -- 0:00:55
      139500 -- (-530.094) (-534.355) (-535.019) [-531.578] * [-530.964] (-533.015) (-533.709) (-534.442) -- 0:00:55
      140000 -- (-532.688) (-534.850) [-532.756] (-535.197) * (-536.322) (-533.118) [-534.345] (-536.939) -- 0:00:55

      Average standard deviation of split frequencies: 0.017814

      140500 -- (-534.917) [-533.422] (-531.944) (-532.596) * (-534.222) [-532.925] (-535.750) (-539.032) -- 0:00:55
      141000 -- (-533.616) (-532.559) (-536.705) [-532.139] * (-533.426) (-532.461) (-535.243) [-534.391] -- 0:00:54
      141500 -- (-536.581) (-537.088) (-533.815) [-532.312] * (-533.303) (-532.288) (-535.757) [-533.918] -- 0:00:54
      142000 -- [-533.011] (-533.060) (-534.451) (-533.100) * [-539.372] (-532.961) (-531.600) (-534.034) -- 0:00:54
      142500 -- [-532.007] (-531.743) (-535.326) (-531.021) * (-538.732) [-533.325] (-532.274) (-533.390) -- 0:00:54
      143000 -- (-530.519) (-531.481) (-535.996) [-534.006] * (-536.266) (-531.238) (-533.749) [-532.281] -- 0:00:53
      143500 -- (-533.397) (-531.559) (-532.990) [-530.737] * (-531.641) (-530.050) [-533.113] (-538.180) -- 0:00:53
      144000 -- (-531.551) [-535.067] (-533.420) (-533.686) * (-531.226) (-532.914) [-536.216] (-536.486) -- 0:00:53
      144500 -- (-531.719) [-532.546] (-532.721) (-532.416) * [-534.279] (-530.509) (-535.687) (-533.002) -- 0:00:53
      145000 -- (-532.905) (-533.353) [-530.213] (-532.457) * [-533.488] (-530.843) (-531.645) (-532.692) -- 0:00:53

      Average standard deviation of split frequencies: 0.016144

      145500 -- (-534.960) (-533.224) (-532.730) [-531.730] * (-535.459) [-531.110] (-536.147) (-533.017) -- 0:00:52
      146000 -- (-533.923) [-538.889] (-533.701) (-531.806) * (-531.390) (-531.434) [-534.887] (-534.777) -- 0:00:52
      146500 -- (-532.042) [-532.863] (-532.439) (-532.441) * (-532.633) [-532.118] (-539.911) (-533.968) -- 0:00:52
      147000 -- (-534.257) (-533.578) [-534.821] (-533.916) * (-534.116) (-531.051) (-536.904) [-533.229] -- 0:00:52
      147500 -- (-532.048) (-535.085) [-535.463] (-534.338) * (-536.452) (-532.562) [-534.298] (-532.318) -- 0:00:52
      148000 -- (-532.557) (-535.362) (-533.722) [-532.963] * (-538.594) (-532.050) [-532.370] (-532.297) -- 0:00:51
      148500 -- (-532.036) (-534.970) (-531.880) [-531.692] * (-536.093) [-534.598] (-532.443) (-531.837) -- 0:00:51
      149000 -- (-534.295) [-533.881] (-535.561) (-534.606) * (-533.851) [-532.142] (-533.585) (-532.751) -- 0:00:51
      149500 -- (-531.732) [-538.956] (-535.234) (-536.979) * [-532.475] (-532.454) (-533.475) (-531.989) -- 0:00:51
      150000 -- (-532.908) [-532.570] (-532.875) (-532.990) * (-534.736) [-533.032] (-538.128) (-532.737) -- 0:00:51

      Average standard deviation of split frequencies: 0.017620

      150500 -- (-531.972) [-532.778] (-533.384) (-532.643) * (-532.486) (-535.308) (-535.284) [-535.381] -- 0:00:50
      151000 -- (-534.151) [-531.773] (-531.232) (-535.820) * (-531.881) [-538.488] (-534.521) (-538.144) -- 0:00:50
      151500 -- (-533.198) (-536.143) [-532.399] (-531.884) * [-535.442] (-532.373) (-535.237) (-531.228) -- 0:00:50
      152000 -- (-532.381) (-531.448) [-534.111] (-535.032) * (-532.543) (-531.188) (-532.662) [-534.942] -- 0:00:50
      152500 -- [-534.363] (-531.851) (-535.179) (-534.978) * (-540.009) [-534.636] (-532.926) (-536.093) -- 0:00:50
      153000 -- (-530.512) (-531.758) (-532.854) [-534.675] * (-531.217) [-533.813] (-533.159) (-530.552) -- 0:00:49
      153500 -- [-532.974] (-532.677) (-535.170) (-535.249) * (-534.087) (-535.127) (-533.971) [-532.356] -- 0:00:49
      154000 -- [-533.041] (-531.465) (-532.469) (-532.519) * (-533.815) (-535.405) [-530.977] (-533.313) -- 0:00:54
      154500 -- (-538.491) [-534.725] (-531.949) (-532.706) * [-533.983] (-534.857) (-533.871) (-532.096) -- 0:00:54
      155000 -- [-534.734] (-539.090) (-532.998) (-531.948) * (-531.406) (-533.213) [-532.622] (-534.248) -- 0:00:54

      Average standard deviation of split frequencies: 0.013996

      155500 -- (-534.768) (-533.821) [-532.130] (-532.778) * (-531.999) (-532.732) [-533.953] (-530.955) -- 0:00:54
      156000 -- (-531.755) (-534.414) (-531.199) [-530.516] * (-535.129) (-537.092) (-534.399) [-532.956] -- 0:00:54
      156500 -- (-530.707) [-535.831] (-535.363) (-532.240) * (-539.175) (-534.046) [-532.572] (-533.452) -- 0:00:53
      157000 -- (-532.768) (-535.941) [-535.709] (-531.648) * (-538.586) (-532.036) (-532.700) [-531.662] -- 0:00:53
      157500 -- (-534.774) (-535.301) (-533.226) [-531.672] * (-537.064) [-532.090] (-536.014) (-531.639) -- 0:00:53
      158000 -- (-532.389) [-531.994] (-535.232) (-533.560) * [-533.439] (-532.381) (-533.013) (-530.945) -- 0:00:53
      158500 -- [-531.274] (-533.806) (-534.983) (-532.891) * (-532.895) (-537.607) (-534.035) [-531.194] -- 0:00:53
      159000 -- (-529.900) [-532.257] (-532.447) (-534.401) * (-532.207) (-532.380) [-533.406] (-531.612) -- 0:00:52
      159500 -- [-529.964] (-534.709) (-534.173) (-533.118) * [-532.538] (-533.521) (-534.907) (-532.428) -- 0:00:52
      160000 -- (-532.219) (-534.489) [-532.473] (-534.404) * (-533.608) (-534.078) [-534.673] (-530.877) -- 0:00:52

      Average standard deviation of split frequencies: 0.013692

      160500 -- (-533.122) [-532.396] (-534.670) (-534.407) * (-533.126) [-530.842] (-531.058) (-532.845) -- 0:00:52
      161000 -- (-535.370) [-534.236] (-533.350) (-535.527) * (-533.489) (-537.978) (-534.163) [-530.866] -- 0:00:52
      161500 -- (-532.539) [-533.047] (-531.700) (-532.553) * (-537.544) [-534.568] (-533.145) (-530.570) -- 0:00:51
      162000 -- (-533.129) (-534.738) [-532.790] (-538.048) * (-534.968) [-531.132] (-533.919) (-534.334) -- 0:00:51
      162500 -- (-530.558) (-533.970) [-532.943] (-532.981) * (-536.449) (-532.478) (-535.107) [-532.856] -- 0:00:51
      163000 -- (-532.788) (-533.545) [-531.847] (-533.086) * (-532.985) [-532.854] (-533.475) (-537.077) -- 0:00:51
      163500 -- (-531.372) (-532.938) [-531.923] (-534.257) * (-536.192) (-530.506) [-532.088] (-536.120) -- 0:00:51
      164000 -- (-539.168) (-533.047) [-531.296] (-533.502) * (-540.260) (-531.409) (-532.001) [-531.730] -- 0:00:50
      164500 -- [-530.631] (-538.167) (-534.613) (-535.581) * (-541.061) (-531.334) (-534.729) [-539.792] -- 0:00:50
      165000 -- (-532.641) (-535.139) [-533.157] (-532.890) * (-534.325) (-531.715) (-535.786) [-535.815] -- 0:00:50

      Average standard deviation of split frequencies: 0.014199

      165500 -- (-533.173) (-536.840) (-534.132) [-534.675] * [-533.101] (-532.639) (-533.525) (-534.614) -- 0:00:50
      166000 -- (-532.012) (-533.090) (-535.804) [-533.854] * (-534.272) (-533.810) [-533.328] (-531.265) -- 0:00:50
      166500 -- (-531.331) (-532.642) [-534.739] (-536.165) * (-535.824) (-535.265) (-536.526) [-533.940] -- 0:00:50
      167000 -- [-532.937] (-533.521) (-534.354) (-532.817) * (-537.359) (-534.081) (-533.320) [-535.930] -- 0:00:49
      167500 -- [-530.818] (-532.156) (-533.813) (-534.361) * (-533.808) (-533.926) [-532.192] (-538.378) -- 0:00:49
      168000 -- (-535.787) [-532.470] (-533.399) (-535.109) * (-533.530) (-533.483) [-535.733] (-535.724) -- 0:00:49
      168500 -- (-534.139) (-533.839) [-532.517] (-538.958) * (-532.539) [-537.619] (-534.751) (-532.573) -- 0:00:49
      169000 -- (-534.277) [-534.579] (-533.797) (-533.373) * (-531.491) (-532.619) [-532.599] (-533.213) -- 0:00:49
      169500 -- [-532.421] (-532.755) (-535.998) (-532.329) * (-537.276) (-530.025) [-532.977] (-532.825) -- 0:00:53
      170000 -- (-535.451) [-531.795] (-536.909) (-534.657) * (-534.220) (-533.144) [-533.311] (-534.465) -- 0:00:53

      Average standard deviation of split frequencies: 0.014731

      170500 -- [-532.151] (-533.789) (-534.968) (-535.379) * (-534.990) (-533.711) (-533.319) [-534.424] -- 0:00:53
      171000 -- (-533.262) [-533.297] (-542.387) (-536.916) * (-534.324) (-533.223) (-533.236) [-530.839] -- 0:00:53
      171500 -- (-537.276) [-532.997] (-538.476) (-532.352) * (-533.544) (-532.662) (-535.129) [-531.015] -- 0:00:53
      172000 -- (-530.826) (-539.757) [-533.436] (-531.466) * (-534.406) (-532.682) [-533.064] (-530.230) -- 0:00:52
      172500 -- (-533.333) (-533.254) (-534.171) [-533.764] * (-534.866) (-534.783) (-531.960) [-530.609] -- 0:00:52
      173000 -- [-532.215] (-533.182) (-535.118) (-534.045) * (-532.647) (-533.188) (-535.443) [-530.993] -- 0:00:52
      173500 -- (-532.570) [-533.794] (-535.698) (-536.761) * [-533.963] (-532.954) (-536.831) (-532.862) -- 0:00:52
      174000 -- (-531.088) (-534.770) [-532.743] (-531.241) * (-534.028) (-532.537) (-533.328) [-531.107] -- 0:00:52
      174500 -- (-530.937) [-532.614] (-533.166) (-532.141) * (-532.791) (-533.837) [-531.752] (-533.429) -- 0:00:52
      175000 -- (-531.304) [-531.730] (-536.667) (-534.930) * (-533.396) (-535.106) [-534.108] (-533.245) -- 0:00:51

      Average standard deviation of split frequencies: 0.013815

      175500 -- (-534.141) (-537.582) [-533.846] (-533.973) * (-532.965) (-533.076) [-532.429] (-534.710) -- 0:00:51
      176000 -- (-533.463) [-531.652] (-535.030) (-535.687) * (-537.451) (-540.135) [-533.038] (-533.391) -- 0:00:51
      176500 -- [-532.538] (-532.796) (-534.023) (-532.173) * [-532.729] (-538.157) (-533.880) (-533.648) -- 0:00:51
      177000 -- [-532.882] (-534.090) (-532.800) (-535.145) * (-533.612) (-534.478) (-534.582) [-531.013] -- 0:00:51
      177500 -- [-538.042] (-534.323) (-534.931) (-535.179) * (-533.437) [-535.057] (-533.538) (-532.335) -- 0:00:50
      178000 -- [-534.165] (-535.312) (-536.229) (-534.019) * (-535.330) [-537.530] (-533.184) (-532.206) -- 0:00:50
      178500 -- (-534.014) (-533.135) [-536.079] (-532.461) * (-533.511) (-533.813) (-536.809) [-533.260] -- 0:00:50
      179000 -- (-531.181) [-536.351] (-533.490) (-533.284) * (-531.493) (-531.721) (-534.584) [-530.710] -- 0:00:50
      179500 -- (-535.506) (-534.335) (-532.843) [-537.121] * (-536.840) (-532.570) (-532.493) [-534.064] -- 0:00:50
      180000 -- (-532.336) (-531.501) (-535.185) [-531.968] * (-532.438) (-533.216) [-532.653] (-532.977) -- 0:00:50

      Average standard deviation of split frequencies: 0.013046

      180500 -- [-531.543] (-531.999) (-535.667) (-530.691) * (-534.036) [-531.762] (-534.328) (-534.919) -- 0:00:49
      181000 -- (-536.376) (-533.581) [-535.231] (-533.167) * (-534.596) (-531.196) [-533.229] (-532.318) -- 0:00:49
      181500 -- (-537.947) [-532.061] (-535.377) (-532.574) * (-535.993) (-534.384) (-535.618) [-536.278] -- 0:00:49
      182000 -- (-531.608) (-537.774) (-535.687) [-531.338] * (-537.716) (-536.679) (-532.423) [-535.137] -- 0:00:49
      182500 -- (-532.070) (-535.648) (-532.310) [-533.792] * (-532.136) (-534.178) [-531.581] (-533.793) -- 0:00:49
      183000 -- (-532.282) (-534.931) (-534.760) [-532.758] * [-533.687] (-537.070) (-535.288) (-532.612) -- 0:00:49
      183500 -- (-534.439) (-535.152) (-534.277) [-532.383] * (-534.879) (-538.328) [-531.636] (-532.399) -- 0:00:48
      184000 -- (-532.993) (-534.918) [-533.883] (-532.411) * (-534.408) [-533.709] (-532.044) (-532.839) -- 0:00:48
      184500 -- [-534.439] (-533.551) (-534.426) (-536.272) * (-532.804) (-533.391) [-532.347] (-530.834) -- 0:00:48
      185000 -- (-534.198) (-530.595) (-532.001) [-530.338] * (-533.547) (-531.518) [-535.331] (-534.127) -- 0:00:48

      Average standard deviation of split frequencies: 0.013235

      185500 -- (-534.142) (-534.624) [-537.948] (-533.045) * (-534.669) (-531.586) [-534.181] (-533.930) -- 0:00:52
      186000 -- [-533.388] (-536.052) (-532.991) (-537.570) * (-532.609) [-531.361] (-533.110) (-533.781) -- 0:00:52
      186500 -- (-531.943) [-533.587] (-533.758) (-533.003) * (-533.734) [-532.328] (-532.325) (-536.397) -- 0:00:52
      187000 -- [-533.570] (-532.900) (-533.863) (-530.675) * [-532.107] (-532.442) (-534.272) (-534.225) -- 0:00:52
      187500 -- (-533.836) (-534.323) (-533.847) [-530.276] * (-532.315) [-531.047] (-531.276) (-529.931) -- 0:00:52
      188000 -- (-533.095) (-533.306) (-533.182) [-531.091] * [-534.144] (-530.404) (-535.197) (-531.008) -- 0:00:51
      188500 -- [-534.940] (-536.789) (-532.065) (-531.629) * (-533.358) (-531.223) [-536.880] (-534.348) -- 0:00:51
      189000 -- (-536.005) (-534.813) [-534.000] (-535.596) * (-538.177) (-532.163) (-533.306) [-532.819] -- 0:00:51
      189500 -- (-530.955) (-533.381) [-534.876] (-532.663) * (-533.828) [-532.621] (-536.867) (-531.520) -- 0:00:51
      190000 -- [-532.450] (-537.600) (-532.234) (-532.033) * (-533.335) [-532.772] (-534.372) (-533.490) -- 0:00:51

      Average standard deviation of split frequencies: 0.014314

      190500 -- [-531.327] (-534.098) (-531.692) (-531.720) * (-532.543) [-529.890] (-534.555) (-532.928) -- 0:00:50
      191000 -- (-532.438) (-534.877) (-534.346) [-532.531] * (-532.233) (-537.298) [-532.084] (-532.454) -- 0:00:50
      191500 -- (-532.100) (-533.368) [-532.256] (-534.004) * (-533.058) (-533.934) (-533.302) [-533.486] -- 0:00:50
      192000 -- (-531.723) (-533.846) (-537.471) [-532.223] * (-534.071) (-532.044) (-536.726) [-533.566] -- 0:00:50
      192500 -- (-534.091) (-536.343) (-533.592) [-533.602] * (-534.712) [-532.581] (-532.306) (-530.746) -- 0:00:50
      193000 -- (-534.332) (-532.341) (-535.303) [-530.571] * [-536.119] (-534.072) (-534.309) (-531.803) -- 0:00:50
      193500 -- (-531.843) (-536.138) [-532.108] (-534.249) * [-531.731] (-533.942) (-535.928) (-532.593) -- 0:00:50
      194000 -- (-531.660) (-534.089) [-533.615] (-535.013) * (-532.789) [-532.884] (-534.979) (-532.769) -- 0:00:49
      194500 -- (-540.047) (-534.258) [-536.084] (-532.347) * [-531.238] (-533.305) (-533.251) (-532.498) -- 0:00:49
      195000 -- (-538.250) [-532.922] (-534.197) (-536.035) * [-532.862] (-535.333) (-534.857) (-532.718) -- 0:00:49

      Average standard deviation of split frequencies: 0.016301

      195500 -- (-531.882) (-536.293) (-537.010) [-531.516] * (-534.160) (-533.461) (-533.913) [-533.807] -- 0:00:49
      196000 -- [-531.165] (-537.417) (-534.888) (-533.001) * (-530.741) (-536.527) [-532.902] (-532.862) -- 0:00:49
      196500 -- (-532.653) (-536.465) [-533.631] (-535.095) * [-533.502] (-536.837) (-534.334) (-538.262) -- 0:00:49
      197000 -- (-534.370) [-533.575] (-536.987) (-532.649) * [-532.304] (-535.281) (-535.057) (-540.962) -- 0:00:48
      197500 -- (-537.012) (-536.057) [-531.369] (-534.853) * (-534.075) (-531.773) (-533.102) [-537.914] -- 0:00:48
      198000 -- [-531.843] (-533.409) (-530.847) (-537.298) * (-536.898) [-531.733] (-534.083) (-536.709) -- 0:00:48
      198500 -- (-532.394) [-534.638] (-531.094) (-540.891) * [-534.066] (-531.929) (-533.925) (-536.941) -- 0:00:48
      199000 -- [-531.455] (-534.345) (-533.131) (-537.930) * (-533.945) (-535.650) (-533.451) [-534.778] -- 0:00:48
      199500 -- (-534.549) [-533.068] (-535.341) (-537.475) * [-537.686] (-531.183) (-536.851) (-532.913) -- 0:00:48
      200000 -- (-531.135) (-532.783) (-534.732) [-532.028] * (-533.376) (-534.534) [-531.334] (-532.854) -- 0:00:48

      Average standard deviation of split frequencies: 0.017488

      200500 -- [-531.049] (-534.905) (-534.419) (-534.187) * (-532.592) (-532.810) [-532.265] (-531.009) -- 0:00:47
      201000 -- [-533.036] (-531.718) (-532.915) (-536.508) * (-535.138) [-530.644] (-535.034) (-537.132) -- 0:00:47
      201500 -- (-532.581) [-535.222] (-532.777) (-538.843) * (-532.917) (-533.670) [-534.208] (-535.572) -- 0:00:51
      202000 -- [-534.020] (-535.927) (-533.277) (-532.605) * (-530.851) (-532.083) (-532.207) [-536.192] -- 0:00:51
      202500 -- (-532.214) [-532.023] (-534.977) (-535.905) * (-534.755) [-531.305] (-532.818) (-532.444) -- 0:00:51
      203000 -- (-533.413) [-533.947] (-532.263) (-537.751) * [-533.525] (-532.941) (-531.074) (-533.655) -- 0:00:51
      203500 -- (-532.613) (-534.354) [-531.376] (-535.511) * (-540.908) [-531.975] (-535.754) (-532.572) -- 0:00:50
      204000 -- (-534.902) [-532.530] (-535.215) (-534.246) * (-534.547) (-534.057) (-532.191) [-533.021] -- 0:00:50
      204500 -- [-533.452] (-532.178) (-538.344) (-535.182) * (-534.781) (-532.172) (-532.250) [-534.207] -- 0:00:50
      205000 -- (-534.915) [-532.745] (-534.093) (-538.453) * (-533.988) (-533.296) [-530.977] (-531.665) -- 0:00:50

      Average standard deviation of split frequencies: 0.017163

      205500 -- (-532.617) (-532.205) [-532.406] (-534.260) * (-532.604) (-535.444) (-530.811) [-532.598] -- 0:00:50
      206000 -- [-534.313] (-533.861) (-532.278) (-539.515) * [-535.479] (-531.819) (-532.089) (-534.799) -- 0:00:50
      206500 -- [-531.175] (-535.272) (-534.470) (-539.049) * (-532.468) (-533.380) [-532.876] (-534.049) -- 0:00:49
      207000 -- [-531.463] (-531.298) (-533.486) (-533.056) * (-531.747) (-533.779) [-532.828] (-531.982) -- 0:00:49
      207500 -- (-531.338) [-534.496] (-534.941) (-536.457) * (-531.391) [-532.971] (-531.686) (-532.000) -- 0:00:49
      208000 -- [-531.484] (-537.061) (-532.155) (-532.879) * (-538.379) (-533.760) [-533.618] (-533.546) -- 0:00:49
      208500 -- [-533.978] (-535.676) (-534.405) (-536.485) * [-535.170] (-538.980) (-534.296) (-533.117) -- 0:00:49
      209000 -- (-533.572) (-536.061) [-533.755] (-534.737) * (-531.920) [-536.635] (-530.498) (-536.461) -- 0:00:49
      209500 -- [-537.048] (-531.117) (-535.533) (-532.677) * [-538.875] (-534.548) (-534.403) (-532.069) -- 0:00:49
      210000 -- [-536.461] (-532.200) (-536.755) (-535.064) * (-534.997) (-536.764) (-532.347) [-529.879] -- 0:00:48

      Average standard deviation of split frequencies: 0.018274

      210500 -- [-532.173] (-533.439) (-534.802) (-532.204) * (-536.032) [-531.910] (-532.998) (-537.856) -- 0:00:48
      211000 -- [-531.613] (-534.007) (-534.130) (-531.079) * (-532.702) (-534.819) (-532.534) [-530.735] -- 0:00:48
      211500 -- (-530.017) (-533.272) (-533.334) [-532.146] * (-537.345) (-531.040) (-533.238) [-534.314] -- 0:00:48
      212000 -- (-532.958) (-535.015) (-537.787) [-533.449] * (-531.402) [-532.249] (-537.467) (-532.909) -- 0:00:48
      212500 -- (-536.342) (-533.627) (-534.671) [-535.824] * (-532.320) [-532.863] (-534.720) (-533.945) -- 0:00:48
      213000 -- (-530.036) (-534.958) (-532.834) [-531.459] * (-532.791) [-535.581] (-533.237) (-532.471) -- 0:00:48
      213500 -- (-531.728) (-532.860) (-532.430) [-534.537] * [-532.734] (-534.010) (-534.728) (-532.548) -- 0:00:47
      214000 -- (-538.168) (-533.158) (-532.337) [-533.759] * [-532.121] (-533.878) (-538.723) (-532.822) -- 0:00:47
      214500 -- [-532.867] (-535.646) (-534.510) (-538.258) * (-534.922) (-531.754) (-534.715) [-531.626] -- 0:00:47
      215000 -- [-533.769] (-535.973) (-533.329) (-534.705) * (-530.305) (-534.873) [-535.404] (-533.224) -- 0:00:47

      Average standard deviation of split frequencies: 0.017459

      215500 -- (-534.807) (-536.791) [-535.716] (-531.481) * (-531.473) [-532.269] (-534.086) (-532.860) -- 0:00:47
      216000 -- [-532.470] (-541.593) (-531.913) (-533.422) * (-533.097) (-534.191) [-531.331] (-537.999) -- 0:00:47
      216500 -- (-532.889) (-536.926) [-533.419] (-535.738) * (-532.943) [-533.778] (-537.089) (-531.234) -- 0:00:47
      217000 -- [-536.399] (-535.373) (-532.018) (-537.111) * [-531.569] (-533.328) (-534.765) (-536.454) -- 0:00:50
      217500 -- (-530.719) [-533.887] (-533.464) (-532.105) * (-531.280) [-533.663] (-531.587) (-533.925) -- 0:00:50
      218000 -- (-530.647) (-535.070) [-532.304] (-533.713) * (-534.352) (-532.432) (-534.764) [-531.681] -- 0:00:50
      218500 -- (-536.592) (-534.792) [-533.745] (-533.302) * [-531.994] (-536.719) (-531.519) (-532.152) -- 0:00:50
      219000 -- [-535.884] (-532.914) (-532.952) (-538.135) * (-532.064) (-536.260) (-535.821) [-530.673] -- 0:00:49
      219500 -- (-532.348) (-534.668) (-533.862) [-535.049] * (-531.830) [-537.581] (-534.986) (-535.597) -- 0:00:49
      220000 -- (-531.908) (-533.800) (-532.627) [-531.484] * [-531.093] (-535.067) (-533.797) (-533.150) -- 0:00:49

      Average standard deviation of split frequencies: 0.018040

      220500 -- (-534.754) (-533.241) [-532.152] (-534.000) * [-531.885] (-532.076) (-531.651) (-532.381) -- 0:00:49
      221000 -- (-535.198) (-536.207) (-532.901) [-538.426] * (-532.906) (-532.576) (-533.976) [-538.507] -- 0:00:49
      221500 -- (-536.698) (-534.241) [-533.111] (-531.788) * (-534.138) (-532.593) [-532.929] (-533.476) -- 0:00:49
      222000 -- (-534.088) (-533.451) (-540.342) [-530.953] * (-536.397) (-536.037) [-533.691] (-530.706) -- 0:00:49
      222500 -- (-532.709) [-531.885] (-538.590) (-531.818) * (-535.159) (-537.782) [-533.890] (-533.818) -- 0:00:48
      223000 -- (-534.076) [-530.583] (-539.257) (-532.196) * (-534.047) (-532.325) [-533.826] (-531.273) -- 0:00:48
      223500 -- (-532.504) [-532.793] (-534.515) (-533.678) * [-533.743] (-534.146) (-531.104) (-534.788) -- 0:00:48
      224000 -- (-532.371) (-536.009) (-534.090) [-532.443] * (-538.038) [-532.663] (-531.837) (-539.620) -- 0:00:48
      224500 -- (-538.537) [-531.047] (-538.358) (-531.707) * (-531.688) [-533.136] (-531.984) (-533.494) -- 0:00:48
      225000 -- (-532.614) (-531.260) [-534.573] (-531.076) * [-533.022] (-535.429) (-532.134) (-532.119) -- 0:00:48

      Average standard deviation of split frequencies: 0.017675

      225500 -- (-533.440) [-533.589] (-540.587) (-531.699) * (-533.339) (-533.455) (-533.396) [-530.946] -- 0:00:48
      226000 -- (-533.312) (-533.132) (-533.903) [-532.772] * (-534.041) (-532.045) [-533.292] (-533.622) -- 0:00:47
      226500 -- (-534.659) [-532.894] (-534.066) (-533.472) * (-531.633) (-532.804) (-532.004) [-531.939] -- 0:00:47
      227000 -- (-537.944) (-532.563) [-532.807] (-534.683) * (-533.864) (-534.404) [-533.411] (-532.294) -- 0:00:47
      227500 -- [-534.324] (-534.368) (-534.290) (-535.641) * (-534.568) (-535.524) (-535.663) [-534.110] -- 0:00:47
      228000 -- (-534.122) [-532.236] (-534.424) (-535.361) * [-534.781] (-532.884) (-536.035) (-533.486) -- 0:00:47
      228500 -- (-535.225) (-534.659) (-534.695) [-532.352] * (-534.626) (-536.642) (-533.428) [-530.326] -- 0:00:47
      229000 -- (-531.460) (-535.789) (-534.801) [-532.103] * (-533.342) (-531.120) (-531.035) [-533.586] -- 0:00:47
      229500 -- (-534.506) (-534.264) (-532.548) [-531.327] * [-533.415] (-534.388) (-534.317) (-532.231) -- 0:00:47
      230000 -- [-533.777] (-534.829) (-533.791) (-533.795) * (-532.463) (-535.423) (-534.066) [-531.798] -- 0:00:46

      Average standard deviation of split frequencies: 0.017780

      230500 -- [-532.514] (-534.991) (-534.678) (-534.222) * [-532.382] (-536.372) (-531.391) (-532.405) -- 0:00:46
      231000 -- [-535.719] (-533.236) (-532.758) (-531.551) * (-532.058) [-536.567] (-531.431) (-534.390) -- 0:00:46
      231500 -- (-531.763) (-538.713) [-533.384] (-533.579) * [-532.413] (-534.554) (-531.486) (-533.729) -- 0:00:46
      232000 -- (-531.881) [-532.676] (-533.555) (-534.753) * (-532.539) [-534.255] (-532.216) (-532.515) -- 0:00:46
      232500 -- (-534.537) [-532.867] (-535.593) (-531.707) * [-534.231] (-533.173) (-536.248) (-532.676) -- 0:00:46
      233000 -- [-533.947] (-534.151) (-535.022) (-532.811) * [-531.935] (-533.675) (-534.446) (-533.735) -- 0:00:49
      233500 -- (-534.507) (-533.568) [-535.624] (-537.430) * (-534.539) (-532.884) (-534.388) [-534.805] -- 0:00:49
      234000 -- (-533.580) (-531.381) [-536.443] (-533.497) * [-531.777] (-532.892) (-532.277) (-532.058) -- 0:00:49
      234500 -- (-536.638) (-533.290) (-534.075) [-532.559] * [-531.946] (-532.928) (-532.687) (-531.833) -- 0:00:48
      235000 -- (-530.645) (-534.959) (-534.015) [-532.850] * (-533.383) (-535.566) (-532.102) [-531.947] -- 0:00:48

      Average standard deviation of split frequencies: 0.018577

      235500 -- (-532.635) [-531.734] (-533.342) (-531.253) * (-534.887) (-534.291) [-532.155] (-532.525) -- 0:00:48
      236000 -- [-531.961] (-532.774) (-537.617) (-532.977) * (-536.540) (-537.709) (-531.822) [-533.054] -- 0:00:48
      236500 -- (-534.408) (-537.447) (-533.965) [-536.041] * [-533.133] (-534.235) (-536.539) (-532.008) -- 0:00:48
      237000 -- (-537.829) (-534.032) [-533.791] (-533.929) * [-531.901] (-532.992) (-532.975) (-533.693) -- 0:00:48
      237500 -- (-536.254) (-532.243) [-533.518] (-535.698) * (-533.132) (-533.378) [-535.139] (-537.607) -- 0:00:48
      238000 -- (-538.087) [-533.692] (-533.168) (-538.155) * (-534.349) (-532.986) [-531.111] (-534.720) -- 0:00:48
      238500 -- (-533.859) (-534.159) [-532.624] (-534.955) * [-534.202] (-534.330) (-533.966) (-534.349) -- 0:00:47
      239000 -- [-532.675] (-531.917) (-533.223) (-533.518) * (-535.602) (-537.505) [-530.930] (-533.692) -- 0:00:47
      239500 -- (-535.273) (-535.675) (-535.622) [-536.093] * (-533.552) (-537.237) (-536.047) [-533.810] -- 0:00:47
      240000 -- (-534.305) (-530.670) [-533.455] (-535.511) * (-535.094) [-533.717] (-531.996) (-531.502) -- 0:00:47

      Average standard deviation of split frequencies: 0.020349

      240500 -- (-532.404) (-537.379) [-533.858] (-535.354) * [-532.186] (-532.457) (-533.490) (-536.501) -- 0:00:47
      241000 -- (-532.174) (-533.213) (-534.357) [-533.740] * [-532.385] (-534.082) (-532.130) (-534.222) -- 0:00:47
      241500 -- [-533.320] (-533.320) (-533.919) (-536.935) * [-531.743] (-534.359) (-533.285) (-535.520) -- 0:00:47
      242000 -- (-533.752) (-532.577) [-534.596] (-535.439) * (-533.404) (-533.687) (-532.083) [-529.776] -- 0:00:46
      242500 -- (-535.885) [-533.289] (-538.418) (-533.476) * [-532.918] (-535.008) (-536.646) (-532.720) -- 0:00:46
      243000 -- (-532.929) (-536.622) [-533.536] (-533.370) * (-540.424) (-534.724) (-534.605) [-531.691] -- 0:00:46
      243500 -- (-533.007) (-536.544) (-537.176) [-533.982] * (-533.916) [-532.256] (-533.722) (-530.559) -- 0:00:46
      244000 -- (-536.464) (-532.555) (-533.271) [-535.382] * [-533.045] (-537.425) (-533.169) (-531.568) -- 0:00:46
      244500 -- (-534.521) [-532.111] (-537.492) (-532.953) * [-532.091] (-533.456) (-533.216) (-531.355) -- 0:00:46
      245000 -- (-533.811) (-532.926) (-532.538) [-532.518] * [-534.857] (-534.020) (-533.408) (-534.365) -- 0:00:46

      Average standard deviation of split frequencies: 0.019345

      245500 -- (-532.810) [-531.788] (-530.613) (-533.083) * (-532.977) (-536.805) (-534.946) [-531.462] -- 0:00:46
      246000 -- [-534.262] (-533.435) (-532.850) (-533.748) * [-534.479] (-534.383) (-534.893) (-533.205) -- 0:00:45
      246500 -- (-531.042) (-536.430) [-535.502] (-534.824) * (-536.842) (-533.408) [-532.610] (-534.538) -- 0:00:45
      247000 -- (-536.246) (-532.621) (-532.318) [-534.888] * [-536.382] (-532.608) (-533.901) (-532.144) -- 0:00:45
      247500 -- [-534.899] (-531.958) (-535.121) (-536.847) * (-533.607) (-536.555) [-535.551] (-532.520) -- 0:00:45
      248000 -- [-532.022] (-533.346) (-533.361) (-538.995) * [-532.977] (-532.589) (-534.754) (-532.351) -- 0:00:45
      248500 -- (-531.768) [-532.720] (-536.566) (-533.057) * (-534.638) (-533.844) (-534.636) [-531.300] -- 0:00:45
      249000 -- [-534.730] (-535.103) (-533.977) (-533.542) * [-532.784] (-537.951) (-533.820) (-534.350) -- 0:00:48
      249500 -- (-533.020) (-532.868) (-533.350) [-534.115] * (-532.323) (-535.330) (-533.215) [-531.484] -- 0:00:48
      250000 -- (-536.517) (-532.698) (-533.899) [-533.501] * (-540.811) (-535.061) [-532.912] (-533.319) -- 0:00:48

      Average standard deviation of split frequencies: 0.020311

      250500 -- (-534.104) [-537.372] (-534.213) (-537.686) * (-532.748) [-533.806] (-533.151) (-532.211) -- 0:00:47
      251000 -- (-536.882) (-537.172) [-533.763] (-535.515) * [-533.199] (-535.454) (-532.919) (-533.026) -- 0:00:47
      251500 -- (-533.248) (-537.137) [-533.948] (-530.984) * [-534.388] (-533.477) (-532.445) (-533.183) -- 0:00:47
      252000 -- (-537.176) (-534.815) (-531.100) [-533.999] * (-533.395) (-534.931) (-532.497) [-536.709] -- 0:00:47
      252500 -- [-532.596] (-532.677) (-533.124) (-533.628) * [-535.072] (-534.915) (-536.311) (-534.142) -- 0:00:47
      253000 -- (-533.585) [-531.837] (-531.275) (-531.396) * (-535.523) (-534.363) (-534.369) [-533.233] -- 0:00:47
      253500 -- [-531.931] (-534.817) (-532.231) (-532.905) * (-534.963) (-537.572) [-533.869] (-532.541) -- 0:00:47
      254000 -- (-535.407) [-534.318] (-534.006) (-534.665) * (-533.500) (-532.880) [-532.439] (-534.584) -- 0:00:46
      254500 -- (-532.292) (-532.402) [-534.677] (-533.067) * (-533.108) (-536.652) (-533.729) [-532.670] -- 0:00:46
      255000 -- [-534.510] (-533.442) (-537.603) (-533.922) * [-533.726] (-534.504) (-532.410) (-530.533) -- 0:00:46

      Average standard deviation of split frequencies: 0.020256

      255500 -- (-534.748) [-530.843] (-539.168) (-531.097) * (-536.507) [-532.535] (-532.396) (-532.704) -- 0:00:46
      256000 -- (-533.395) (-534.031) (-532.385) [-534.120] * (-534.604) (-536.224) (-532.938) [-532.105] -- 0:00:46
      256500 -- (-533.146) [-533.699] (-532.938) (-533.973) * (-532.675) (-533.579) [-535.371] (-532.100) -- 0:00:46
      257000 -- (-532.659) [-533.348] (-532.080) (-535.042) * [-532.032] (-535.776) (-535.283) (-532.451) -- 0:00:46
      257500 -- (-533.964) (-532.772) (-535.102) [-531.575] * (-534.478) [-533.210] (-536.280) (-536.150) -- 0:00:46
      258000 -- [-533.412] (-536.602) (-535.805) (-531.279) * (-536.142) (-536.350) (-533.869) [-531.344] -- 0:00:46
      258500 -- (-533.460) (-531.945) (-534.558) [-531.524] * (-534.053) [-534.984] (-534.783) (-534.194) -- 0:00:45
      259000 -- (-535.761) [-530.028] (-534.981) (-532.813) * (-535.149) [-532.414] (-531.273) (-534.643) -- 0:00:45
      259500 -- (-532.107) [-532.512] (-536.090) (-538.177) * (-533.234) (-532.819) [-533.305] (-535.422) -- 0:00:45
      260000 -- (-532.439) [-532.474] (-536.350) (-532.363) * (-531.711) (-532.934) [-532.756] (-535.299) -- 0:00:45

      Average standard deviation of split frequencies: 0.019798

      260500 -- (-531.186) (-532.188) (-532.705) [-533.354] * [-533.609] (-532.687) (-532.156) (-538.507) -- 0:00:45
      261000 -- [-534.946] (-534.321) (-532.103) (-533.682) * (-533.291) (-532.974) [-532.501] (-532.026) -- 0:00:45
      261500 -- (-534.692) (-531.984) (-535.186) [-534.917] * (-533.428) [-533.101] (-533.586) (-530.854) -- 0:00:45
      262000 -- (-533.106) [-532.215] (-534.099) (-534.571) * (-534.949) [-533.423] (-534.975) (-532.080) -- 0:00:45
      262500 -- (-531.090) (-538.064) [-533.111] (-533.550) * (-530.621) (-531.080) (-532.824) [-534.195] -- 0:00:44
      263000 -- (-535.231) (-531.322) (-533.220) [-532.451] * (-531.111) (-532.075) (-533.528) [-531.847] -- 0:00:44
      263500 -- (-530.818) (-533.457) (-533.333) [-532.293] * [-533.037] (-532.504) (-533.188) (-532.343) -- 0:00:44
      264000 -- (-533.288) (-532.929) (-534.492) [-530.833] * [-535.025] (-535.223) (-536.559) (-532.603) -- 0:00:44
      264500 -- (-534.596) (-534.590) (-533.168) [-532.249] * (-534.645) (-531.343) (-534.149) [-530.048] -- 0:00:47
      265000 -- [-532.125] (-537.310) (-534.111) (-531.560) * (-536.438) [-533.897] (-532.122) (-531.473) -- 0:00:47

      Average standard deviation of split frequencies: 0.020912

      265500 -- (-534.577) (-535.786) (-534.243) [-532.717] * (-536.864) (-533.006) (-536.117) [-531.506] -- 0:00:47
      266000 -- (-531.530) (-535.365) [-537.697] (-531.694) * (-537.590) (-534.668) (-540.760) [-532.892] -- 0:00:46
      266500 -- (-536.655) [-535.940] (-536.744) (-535.271) * (-533.562) [-531.489] (-531.551) (-531.223) -- 0:00:46
      267000 -- (-537.253) [-532.553] (-536.706) (-533.671) * (-532.490) (-535.864) [-532.607] (-534.886) -- 0:00:46
      267500 -- (-534.947) (-533.600) (-535.626) [-533.413] * (-532.330) (-531.770) [-531.913] (-533.562) -- 0:00:46
      268000 -- (-533.986) [-532.999] (-536.426) (-530.818) * [-534.372] (-534.757) (-532.351) (-532.545) -- 0:00:46
      268500 -- (-534.151) (-531.192) (-533.642) [-531.382] * [-534.665] (-532.826) (-532.499) (-533.797) -- 0:00:46
      269000 -- (-531.777) (-532.651) [-535.640] (-533.936) * [-531.703] (-533.012) (-534.983) (-533.108) -- 0:00:46
      269500 -- [-532.709] (-533.278) (-536.038) (-533.735) * (-534.341) (-531.867) (-533.855) [-531.303] -- 0:00:46
      270000 -- (-533.003) (-533.326) [-535.375] (-531.598) * (-535.102) [-530.879] (-535.442) (-530.709) -- 0:00:45

      Average standard deviation of split frequencies: 0.020551

      270500 -- (-531.077) (-541.378) (-534.154) [-532.062] * (-534.550) (-531.663) [-534.361] (-532.749) -- 0:00:45
      271000 -- [-532.570] (-541.042) (-537.497) (-531.878) * [-535.655] (-533.650) (-531.956) (-534.212) -- 0:00:45
      271500 -- (-533.113) [-534.619] (-531.511) (-532.284) * (-537.466) (-534.122) (-536.203) [-533.012] -- 0:00:45
      272000 -- (-532.495) [-534.087] (-534.364) (-532.674) * (-534.601) [-532.979] (-536.507) (-532.892) -- 0:00:45
      272500 -- (-532.881) (-537.467) (-533.441) [-533.499] * (-532.947) [-531.761] (-533.239) (-532.939) -- 0:00:45
      273000 -- (-532.961) (-534.557) (-535.623) [-530.027] * [-534.911] (-532.853) (-532.901) (-532.309) -- 0:00:45
      273500 -- (-532.964) (-531.979) (-535.744) [-532.107] * (-532.782) [-534.544] (-534.233) (-535.029) -- 0:00:45
      274000 -- (-533.636) (-536.250) (-535.030) [-532.876] * [-531.926] (-533.645) (-534.395) (-532.062) -- 0:00:45
      274500 -- (-537.444) (-533.574) (-533.808) [-537.035] * [-532.555] (-536.874) (-534.484) (-533.852) -- 0:00:44
      275000 -- (-534.953) (-534.533) (-533.980) [-533.385] * (-534.261) (-535.749) [-534.133] (-532.904) -- 0:00:44

      Average standard deviation of split frequencies: 0.020837

      275500 -- [-532.784] (-531.221) (-531.714) (-531.842) * [-534.864] (-537.080) (-533.692) (-532.067) -- 0:00:44
      276000 -- (-534.828) [-533.038] (-532.793) (-535.163) * (-537.186) (-534.170) (-534.145) [-534.888] -- 0:00:44
      276500 -- (-534.738) (-533.194) (-532.823) [-536.769] * [-535.303] (-534.221) (-534.997) (-532.857) -- 0:00:44
      277000 -- (-535.894) (-532.310) (-531.799) [-535.203] * [-534.724] (-538.343) (-532.490) (-534.318) -- 0:00:44
      277500 -- [-533.544] (-533.706) (-533.458) (-532.124) * [-532.317] (-531.446) (-532.251) (-532.825) -- 0:00:44
      278000 -- (-533.375) (-534.866) [-530.642] (-534.417) * (-532.673) [-535.381] (-533.803) (-533.766) -- 0:00:44
      278500 -- (-534.334) (-536.978) [-532.281] (-530.851) * [-532.941] (-533.036) (-537.060) (-533.005) -- 0:00:44
      279000 -- (-535.445) (-534.025) [-532.688] (-533.889) * (-535.089) [-532.861] (-533.515) (-531.982) -- 0:00:43
      279500 -- (-537.092) [-533.861] (-532.874) (-534.655) * (-534.425) [-533.829] (-537.046) (-532.996) -- 0:00:43
      280000 -- (-533.649) [-531.060] (-531.244) (-535.670) * (-531.655) (-530.675) [-533.951] (-534.880) -- 0:00:43

      Average standard deviation of split frequencies: 0.020071

      280500 -- [-535.841] (-534.270) (-535.336) (-536.461) * (-536.484) (-533.166) (-533.810) [-533.983] -- 0:00:46
      281000 -- (-534.091) (-537.348) [-534.389] (-533.248) * (-533.719) [-536.456] (-533.289) (-532.992) -- 0:00:46
      281500 -- (-531.491) [-533.000] (-533.556) (-532.544) * (-535.576) (-537.653) (-534.304) [-533.514] -- 0:00:45
      282000 -- [-532.204] (-534.744) (-531.786) (-531.048) * [-533.180] (-540.758) (-535.712) (-532.236) -- 0:00:45
      282500 -- (-535.973) (-534.020) [-531.554] (-533.767) * (-532.393) [-534.285] (-532.817) (-532.828) -- 0:00:45
      283000 -- (-538.765) (-532.003) (-535.332) [-533.532] * [-533.003] (-532.128) (-534.279) (-533.495) -- 0:00:45
      283500 -- [-534.396] (-533.625) (-534.126) (-536.607) * [-533.943] (-534.945) (-532.178) (-533.096) -- 0:00:45
      284000 -- (-533.899) (-531.863) (-531.202) [-536.425] * (-535.148) [-535.909] (-537.440) (-533.887) -- 0:00:45
      284500 -- [-533.091] (-532.757) (-535.836) (-537.930) * (-535.115) (-533.040) [-533.835] (-534.064) -- 0:00:45
      285000 -- (-535.220) [-532.902] (-533.494) (-534.600) * (-533.709) [-537.793] (-534.861) (-534.263) -- 0:00:45

      Average standard deviation of split frequencies: 0.018790

      285500 -- (-533.150) (-532.621) (-533.579) [-533.640] * (-535.157) (-531.777) (-533.123) [-535.374] -- 0:00:45
      286000 -- [-534.486] (-538.930) (-535.855) (-531.496) * (-535.529) [-533.445] (-537.202) (-532.413) -- 0:00:44
      286500 -- [-533.953] (-533.677) (-535.624) (-534.136) * [-533.390] (-536.398) (-534.135) (-532.116) -- 0:00:44
      287000 -- (-535.718) (-533.629) (-533.151) [-534.415] * [-531.831] (-534.019) (-532.116) (-532.453) -- 0:00:44
      287500 -- [-531.880] (-533.066) (-532.285) (-533.016) * (-533.531) (-533.529) (-533.717) [-531.718] -- 0:00:44
      288000 -- (-531.128) (-535.499) (-534.500) [-534.804] * (-534.634) (-533.364) (-534.010) [-530.265] -- 0:00:44
      288500 -- [-532.139] (-535.331) (-533.185) (-531.484) * (-533.671) (-533.681) (-535.792) [-530.714] -- 0:00:44
      289000 -- (-533.030) [-531.653] (-533.020) (-533.516) * [-531.708] (-534.007) (-539.635) (-532.178) -- 0:00:44
      289500 -- (-535.310) (-532.978) [-533.707] (-538.768) * (-532.417) (-533.250) [-535.821] (-539.921) -- 0:00:44
      290000 -- [-534.116] (-534.156) (-532.251) (-532.869) * (-536.269) (-532.791) [-533.880] (-542.324) -- 0:00:44

      Average standard deviation of split frequencies: 0.017669

      290500 -- (-536.045) (-531.274) [-532.121] (-534.207) * (-534.181) (-533.280) (-537.087) [-531.650] -- 0:00:43
      291000 -- (-532.393) [-532.055] (-532.167) (-537.186) * [-533.162] (-533.530) (-532.512) (-536.794) -- 0:00:43
      291500 -- (-533.512) (-531.982) [-533.546] (-532.644) * (-530.969) (-535.494) (-533.846) [-533.120] -- 0:00:43
      292000 -- [-532.831] (-530.997) (-531.786) (-532.617) * (-533.371) (-538.043) [-533.467] (-532.505) -- 0:00:43
      292500 -- (-534.601) (-531.021) [-531.137] (-533.174) * [-532.956] (-533.982) (-534.417) (-532.272) -- 0:00:43
      293000 -- (-535.080) (-531.367) [-532.214] (-532.900) * [-531.111] (-533.393) (-532.363) (-531.240) -- 0:00:43
      293500 -- [-533.909] (-531.596) (-531.539) (-531.333) * (-532.293) (-532.219) (-534.960) [-532.382] -- 0:00:43
      294000 -- (-534.677) (-535.144) (-532.368) [-533.037] * (-532.042) [-530.349] (-537.807) (-535.477) -- 0:00:43
      294500 -- (-531.629) (-534.284) (-534.556) [-531.543] * (-532.703) (-532.026) [-534.612] (-533.236) -- 0:00:43
      295000 -- (-530.807) (-536.339) (-535.067) [-531.282] * (-532.853) [-533.017] (-536.128) (-532.886) -- 0:00:43

      Average standard deviation of split frequencies: 0.017099

      295500 -- (-532.710) (-533.417) [-533.981] (-532.916) * (-532.986) (-531.519) [-532.848] (-530.876) -- 0:00:42
      296000 -- (-540.197) (-536.259) (-534.718) [-533.821] * (-531.652) (-535.618) (-534.343) [-534.977] -- 0:00:45
      296500 -- (-538.104) [-532.047] (-531.732) (-534.889) * (-536.804) (-533.183) (-533.620) [-532.318] -- 0:00:45
      297000 -- (-533.465) [-531.754] (-530.133) (-534.132) * [-539.292] (-533.957) (-536.427) (-533.947) -- 0:00:44
      297500 -- (-532.727) [-530.417] (-534.852) (-533.616) * (-532.150) (-531.339) (-533.770) [-533.773] -- 0:00:44
      298000 -- (-538.035) (-534.758) [-532.711] (-534.346) * (-533.806) (-533.523) (-533.166) [-532.935] -- 0:00:44
      298500 -- (-532.875) [-534.615] (-533.939) (-534.272) * (-537.879) (-543.694) (-535.007) [-531.160] -- 0:00:44
      299000 -- (-533.109) (-537.097) (-532.907) [-533.591] * [-531.691] (-533.756) (-536.332) (-530.362) -- 0:00:44
      299500 -- (-532.365) (-538.677) [-534.379] (-533.754) * (-531.734) (-536.035) (-533.112) [-532.513] -- 0:00:44
      300000 -- [-534.576] (-535.428) (-533.566) (-534.671) * (-533.198) [-535.565] (-537.829) (-536.083) -- 0:00:44

      Average standard deviation of split frequencies: 0.016999

      300500 -- [-533.338] (-531.771) (-533.950) (-539.115) * (-532.323) [-532.172] (-535.384) (-535.876) -- 0:00:44
      301000 -- (-532.447) (-532.184) [-534.090] (-532.646) * [-534.677] (-529.939) (-534.273) (-534.725) -- 0:00:44
      301500 -- [-533.883] (-533.182) (-534.368) (-534.016) * [-531.068] (-533.133) (-534.747) (-536.467) -- 0:00:44
      302000 -- (-532.476) (-533.043) (-534.118) [-535.048] * [-532.256] (-541.416) (-533.424) (-533.649) -- 0:00:43
      302500 -- (-532.905) (-534.236) [-532.555] (-532.788) * (-531.715) (-532.787) (-532.638) [-532.952] -- 0:00:43
      303000 -- (-533.735) [-534.060] (-534.026) (-532.470) * [-535.384] (-532.188) (-535.162) (-533.815) -- 0:00:43
      303500 -- [-533.187] (-533.541) (-534.428) (-533.706) * (-532.524) (-531.978) (-534.328) [-533.578] -- 0:00:43
      304000 -- [-533.555] (-535.156) (-532.363) (-536.313) * (-536.450) [-534.001] (-534.763) (-533.983) -- 0:00:43
      304500 -- [-533.503] (-534.293) (-539.296) (-535.555) * (-531.336) (-531.220) (-534.611) [-533.977] -- 0:00:43
      305000 -- (-532.891) (-533.086) [-536.959] (-539.573) * (-533.305) [-530.810] (-534.168) (-534.925) -- 0:00:43

      Average standard deviation of split frequencies: 0.017757

      305500 -- [-533.240] (-534.556) (-536.677) (-533.016) * (-532.936) (-531.430) (-535.690) [-533.168] -- 0:00:43
      306000 -- (-530.801) (-532.998) [-539.009] (-531.651) * (-534.494) (-531.315) (-536.258) [-535.315] -- 0:00:43
      306500 -- (-531.647) (-535.299) [-533.364] (-534.095) * (-532.353) (-532.585) (-535.755) [-532.877] -- 0:00:42
      307000 -- [-534.659] (-534.530) (-533.964) (-532.445) * (-534.517) (-534.093) (-532.216) [-534.318] -- 0:00:42
      307500 -- (-531.853) [-537.308] (-532.314) (-533.124) * (-534.390) [-533.170] (-536.988) (-534.665) -- 0:00:42
      308000 -- (-532.530) [-536.930] (-535.506) (-533.183) * (-533.098) (-534.715) (-533.997) [-533.136] -- 0:00:42
      308500 -- [-534.592] (-536.127) (-534.792) (-532.436) * (-533.214) (-532.741) (-534.418) [-531.867] -- 0:00:42
      309000 -- (-535.784) (-534.039) [-532.861] (-533.415) * [-532.617] (-532.263) (-537.991) (-532.330) -- 0:00:42
      309500 -- (-538.565) (-532.335) (-534.861) [-533.067] * (-533.340) [-535.507] (-533.184) (-534.933) -- 0:00:42
      310000 -- [-534.922] (-538.984) (-534.596) (-533.579) * (-533.768) (-532.064) [-534.792] (-534.121) -- 0:00:42

      Average standard deviation of split frequencies: 0.017570

      310500 -- (-533.869) [-535.495] (-533.979) (-533.226) * (-534.894) [-531.828] (-535.248) (-534.133) -- 0:00:42
      311000 -- (-534.012) (-533.444) [-532.108] (-533.298) * (-532.905) (-530.551) [-533.012] (-535.987) -- 0:00:42
      311500 -- (-532.877) (-535.757) [-537.622] (-533.348) * (-533.092) (-531.624) [-534.609] (-534.566) -- 0:00:41
      312000 -- [-532.191] (-533.005) (-531.804) (-534.306) * (-534.959) (-531.954) [-536.456] (-531.797) -- 0:00:44
      312500 -- (-533.754) (-532.934) (-532.344) [-531.778] * (-538.646) (-531.097) (-537.404) [-531.394] -- 0:00:44
      313000 -- (-533.834) (-535.206) (-535.265) [-532.196] * (-536.706) [-532.736] (-533.952) (-535.270) -- 0:00:43
      313500 -- (-533.451) (-535.063) [-532.678] (-536.125) * (-533.926) (-531.579) (-535.793) [-534.003] -- 0:00:43
      314000 -- (-534.765) [-533.047] (-531.737) (-532.062) * (-533.922) (-533.600) (-535.990) [-532.414] -- 0:00:43
      314500 -- (-532.981) [-539.761] (-532.461) (-532.682) * [-533.597] (-533.854) (-534.827) (-533.982) -- 0:00:43
      315000 -- (-537.712) (-533.725) (-532.708) [-537.472] * (-533.084) (-531.578) (-533.759) [-531.675] -- 0:00:43

      Average standard deviation of split frequencies: 0.018215

      315500 -- (-534.220) (-535.997) [-532.998] (-534.053) * [-534.866] (-532.884) (-533.314) (-535.988) -- 0:00:43
      316000 -- (-534.434) (-533.976) (-530.600) [-535.417] * (-534.883) [-532.545] (-531.038) (-534.365) -- 0:00:43
      316500 -- [-534.204] (-534.126) (-533.013) (-537.456) * [-532.032] (-534.258) (-533.542) (-532.314) -- 0:00:43
      317000 -- (-535.350) [-532.830] (-534.166) (-539.019) * (-533.764) [-532.501] (-533.145) (-532.281) -- 0:00:43
      317500 -- (-532.821) (-534.027) (-532.833) [-534.261] * (-531.699) (-535.345) (-532.208) [-532.927] -- 0:00:42
      318000 -- (-534.751) [-532.553] (-534.435) (-533.279) * [-530.285] (-533.029) (-532.014) (-534.484) -- 0:00:42
      318500 -- (-532.901) [-533.000] (-535.322) (-532.278) * (-531.959) [-532.379] (-530.850) (-537.045) -- 0:00:42
      319000 -- (-532.970) (-533.345) (-530.818) [-534.784] * (-534.806) [-534.558] (-531.851) (-534.476) -- 0:00:42
      319500 -- (-533.471) (-535.665) (-534.104) [-536.052] * [-532.274] (-532.209) (-535.213) (-533.923) -- 0:00:42
      320000 -- (-535.011) (-532.595) [-532.106] (-531.751) * (-533.863) (-531.789) (-531.679) [-532.785] -- 0:00:42

      Average standard deviation of split frequencies: 0.017564

      320500 -- (-532.417) (-534.460) (-533.083) [-533.832] * (-532.544) (-529.008) [-534.538] (-535.290) -- 0:00:42
      321000 -- (-533.226) (-534.288) [-535.441] (-533.121) * (-534.005) (-532.287) [-533.934] (-536.107) -- 0:00:42
      321500 -- [-535.950] (-533.085) (-532.178) (-535.116) * [-536.554] (-533.180) (-532.978) (-533.630) -- 0:00:42
      322000 -- (-536.454) (-533.562) [-530.761] (-534.271) * (-534.104) (-534.011) (-534.594) [-533.078] -- 0:00:42
      322500 -- [-536.295] (-532.229) (-536.738) (-531.019) * (-535.079) [-530.590] (-537.394) (-530.738) -- 0:00:42
      323000 -- (-535.690) (-531.792) [-533.181] (-532.568) * [-534.635] (-531.039) (-533.943) (-535.023) -- 0:00:41
      323500 -- [-535.514] (-533.175) (-531.470) (-534.198) * (-531.678) [-534.661] (-532.967) (-534.547) -- 0:00:41
      324000 -- (-534.055) (-534.100) [-534.375] (-532.358) * (-533.952) (-531.124) (-531.300) [-532.413] -- 0:00:41
      324500 -- (-536.985) [-532.702] (-535.133) (-529.862) * (-533.446) (-531.046) [-533.751] (-532.744) -- 0:00:41
      325000 -- (-536.027) (-532.662) (-530.755) [-531.669] * (-535.838) [-533.012] (-539.114) (-534.632) -- 0:00:41

      Average standard deviation of split frequencies: 0.017200

      325500 -- (-533.369) (-531.988) (-531.600) [-531.692] * (-533.953) [-530.501] (-538.478) (-536.008) -- 0:00:41
      326000 -- (-533.617) (-534.616) (-532.190) [-534.378] * [-535.515] (-534.992) (-532.435) (-534.216) -- 0:00:41
      326500 -- (-533.587) [-532.372] (-531.358) (-531.686) * (-533.866) (-532.352) [-535.087] (-533.488) -- 0:00:41
      327000 -- (-533.569) (-532.562) (-533.896) [-531.481] * (-530.920) (-533.454) (-534.222) [-531.462] -- 0:00:41
      327500 -- (-531.935) (-532.872) (-531.627) [-531.389] * (-542.316) [-530.548] (-533.186) (-532.463) -- 0:00:43
      328000 -- (-532.828) (-533.717) (-533.277) [-531.835] * (-532.702) (-533.319) [-532.920] (-532.577) -- 0:00:43
      328500 -- [-534.138] (-531.296) (-532.181) (-530.643) * (-535.277) (-532.399) [-533.885] (-532.869) -- 0:00:42
      329000 -- (-534.441) (-533.552) (-534.602) [-531.931] * [-534.609] (-534.536) (-533.945) (-531.072) -- 0:00:42
      329500 -- (-537.446) (-534.528) [-532.602] (-539.524) * [-532.537] (-537.424) (-534.088) (-532.665) -- 0:00:42
      330000 -- [-534.946] (-533.999) (-532.659) (-532.331) * (-539.115) [-531.933] (-533.815) (-533.361) -- 0:00:42

      Average standard deviation of split frequencies: 0.017257

      330500 -- (-532.988) (-533.709) (-537.619) [-531.407] * (-533.711) (-533.548) (-534.781) [-533.902] -- 0:00:42
      331000 -- (-532.948) (-531.500) (-536.637) [-533.584] * (-534.239) (-531.576) [-535.241] (-533.453) -- 0:00:42
      331500 -- (-533.949) [-533.466] (-535.249) (-533.862) * (-532.529) (-535.618) [-533.665] (-533.104) -- 0:00:42
      332000 -- (-534.813) (-539.085) [-532.743] (-532.689) * (-537.686) (-532.973) [-533.395] (-533.510) -- 0:00:42
      332500 -- (-531.283) (-534.941) (-531.728) [-531.825] * (-537.738) (-531.115) [-532.572] (-533.041) -- 0:00:42
      333000 -- (-536.995) (-532.745) [-533.423] (-534.029) * (-534.314) [-535.879] (-533.300) (-531.372) -- 0:00:42
      333500 -- [-531.873] (-531.595) (-534.114) (-534.011) * (-533.182) (-533.699) [-535.871] (-535.663) -- 0:00:41
      334000 -- (-535.464) (-531.915) (-532.919) [-533.951] * [-532.175] (-531.738) (-533.676) (-533.632) -- 0:00:41
      334500 -- (-532.725) (-531.618) [-532.034] (-535.241) * [-537.465] (-535.192) (-533.879) (-535.742) -- 0:00:41
      335000 -- [-530.313] (-531.502) (-534.244) (-536.672) * (-534.062) [-535.808] (-534.203) (-538.417) -- 0:00:41

      Average standard deviation of split frequencies: 0.017943

      335500 -- [-533.701] (-531.935) (-531.945) (-531.550) * (-535.710) [-532.617] (-532.922) (-533.107) -- 0:00:41
      336000 -- [-533.417] (-532.243) (-533.354) (-529.981) * (-532.039) (-536.045) [-532.311] (-535.136) -- 0:00:41
      336500 -- (-533.519) (-532.420) [-533.428] (-531.452) * (-532.007) (-533.278) (-532.693) [-534.214] -- 0:00:41
      337000 -- [-533.612] (-532.517) (-534.082) (-532.305) * (-532.871) [-532.513] (-537.450) (-533.072) -- 0:00:41
      337500 -- [-533.461] (-535.286) (-533.142) (-533.085) * (-532.107) [-535.959] (-534.072) (-535.751) -- 0:00:41
      338000 -- [-532.804] (-530.989) (-534.688) (-533.578) * [-534.373] (-534.067) (-533.064) (-534.015) -- 0:00:41
      338500 -- (-536.547) (-534.213) (-533.730) [-533.000] * (-537.458) [-533.638] (-536.531) (-533.932) -- 0:00:41
      339000 -- (-535.804) [-532.544] (-536.530) (-531.751) * [-532.354] (-536.789) (-534.013) (-534.727) -- 0:00:40
      339500 -- (-536.254) (-541.513) [-534.762] (-533.965) * (-533.657) [-534.898] (-536.187) (-536.089) -- 0:00:40
      340000 -- (-531.930) [-533.008] (-532.483) (-532.701) * [-533.823] (-533.796) (-532.793) (-535.335) -- 0:00:40

      Average standard deviation of split frequencies: 0.017479

      340500 -- (-533.534) (-536.152) (-530.280) [-533.794] * (-533.884) [-532.845] (-534.064) (-535.403) -- 0:00:40
      341000 -- (-537.906) (-532.641) [-531.579] (-532.825) * [-543.181] (-532.960) (-533.906) (-533.391) -- 0:00:40
      341500 -- (-536.160) (-536.597) [-533.968] (-532.803) * (-533.684) [-532.504] (-537.797) (-534.778) -- 0:00:40
      342000 -- (-535.386) [-535.354] (-531.586) (-538.311) * [-532.265] (-536.178) (-537.496) (-533.642) -- 0:00:40
      342500 -- [-533.530] (-534.522) (-532.706) (-535.236) * (-533.273) (-533.077) (-533.489) [-533.240] -- 0:00:40
      343000 -- (-534.871) (-533.020) [-531.625] (-538.357) * (-537.279) [-534.709] (-534.111) (-537.856) -- 0:00:40
      343500 -- [-533.093] (-536.794) (-531.892) (-533.700) * (-535.824) (-533.549) (-532.419) [-537.271] -- 0:00:42
      344000 -- (-534.221) (-532.780) [-533.262] (-533.031) * (-533.528) (-533.025) (-535.100) [-535.789] -- 0:00:41
      344500 -- [-535.146] (-533.607) (-531.529) (-534.913) * [-531.458] (-530.777) (-536.192) (-533.502) -- 0:00:41
      345000 -- (-537.075) [-533.902] (-535.778) (-534.423) * [-534.953] (-533.865) (-534.633) (-534.077) -- 0:00:41

      Average standard deviation of split frequencies: 0.018214

      345500 -- [-532.483] (-536.160) (-535.535) (-535.469) * [-534.505] (-531.965) (-532.733) (-533.537) -- 0:00:41
      346000 -- (-532.702) (-535.906) [-533.784] (-534.713) * (-532.442) [-533.788] (-533.844) (-532.945) -- 0:00:41
      346500 -- [-534.823] (-532.143) (-533.437) (-537.315) * (-532.051) [-531.037] (-537.483) (-532.132) -- 0:00:41
      347000 -- (-532.945) [-532.242] (-531.131) (-533.753) * (-532.826) [-532.125] (-534.413) (-531.897) -- 0:00:41
      347500 -- (-534.840) (-532.944) (-533.289) [-533.491] * (-532.643) (-533.172) [-536.088] (-534.751) -- 0:00:41
      348000 -- [-536.292] (-530.742) (-535.206) (-535.287) * (-531.011) (-537.282) [-535.232] (-532.656) -- 0:00:41
      348500 -- (-533.258) (-535.260) [-533.653] (-533.843) * (-535.138) (-532.735) (-534.158) [-531.958] -- 0:00:41
      349000 -- (-533.248) (-534.778) [-532.092] (-532.388) * (-533.694) (-534.724) (-534.675) [-533.477] -- 0:00:41
      349500 -- (-533.426) (-537.257) [-532.920] (-533.971) * (-532.580) (-534.969) (-532.331) [-532.385] -- 0:00:40
      350000 -- (-536.740) [-531.890] (-535.449) (-531.936) * (-536.098) (-535.466) [-532.248] (-531.766) -- 0:00:40

      Average standard deviation of split frequencies: 0.018537

      350500 -- (-535.036) [-537.516] (-537.372) (-537.589) * [-534.710] (-534.077) (-535.484) (-531.333) -- 0:00:40
      351000 -- (-537.985) (-543.314) [-534.089] (-536.576) * (-539.636) [-532.690] (-532.825) (-535.054) -- 0:00:40
      351500 -- (-540.281) (-534.832) [-532.294] (-532.137) * (-537.219) (-533.584) [-532.397] (-533.780) -- 0:00:40
      352000 -- [-536.695] (-535.826) (-531.670) (-532.210) * (-535.492) (-535.538) (-531.995) [-531.516] -- 0:00:40
      352500 -- (-535.367) (-536.859) (-532.959) [-531.796] * (-534.202) (-533.347) (-532.362) [-534.748] -- 0:00:40
      353000 -- (-534.793) (-534.834) [-539.195] (-533.761) * (-533.008) (-533.674) (-532.690) [-532.479] -- 0:00:40
      353500 -- [-533.775] (-533.526) (-537.518) (-536.758) * [-533.304] (-534.983) (-532.581) (-533.307) -- 0:00:40
      354000 -- (-534.842) (-530.810) [-533.997] (-535.490) * (-533.174) [-534.236] (-532.393) (-532.036) -- 0:00:40
      354500 -- [-535.750] (-535.092) (-532.323) (-536.433) * (-533.920) [-533.121] (-530.752) (-534.628) -- 0:00:40
      355000 -- [-533.971] (-536.571) (-536.232) (-533.371) * (-533.551) [-532.177] (-531.778) (-535.321) -- 0:00:39

      Average standard deviation of split frequencies: 0.017435

      355500 -- (-533.745) [-535.058] (-531.581) (-533.113) * [-535.214] (-533.528) (-532.759) (-534.679) -- 0:00:39
      356000 -- (-536.452) [-532.540] (-543.043) (-533.572) * [-532.719] (-532.210) (-534.686) (-534.545) -- 0:00:39
      356500 -- (-531.733) (-532.882) (-538.575) [-533.008] * [-532.664] (-531.125) (-533.764) (-536.880) -- 0:00:39
      357000 -- (-532.852) (-531.769) [-535.840] (-534.881) * [-532.368] (-533.578) (-532.395) (-534.913) -- 0:00:39
      357500 -- (-534.898) (-530.480) [-532.789] (-535.425) * (-532.714) (-533.548) [-534.277] (-532.953) -- 0:00:39
      358000 -- (-532.670) [-533.082] (-533.245) (-533.551) * [-532.116] (-533.838) (-534.446) (-535.087) -- 0:00:39
      358500 -- (-538.710) [-532.629] (-533.763) (-538.186) * (-531.128) [-533.659] (-536.631) (-534.193) -- 0:00:39
      359000 -- (-535.297) (-532.346) [-534.393] (-535.024) * [-533.899] (-532.449) (-533.027) (-535.276) -- 0:00:41
      359500 -- (-532.053) [-533.215] (-536.230) (-532.836) * [-532.309] (-533.304) (-536.469) (-535.031) -- 0:00:40
      360000 -- [-533.171] (-533.747) (-534.516) (-533.909) * (-533.295) [-535.411] (-531.725) (-533.120) -- 0:00:40

      Average standard deviation of split frequencies: 0.016048

      360500 -- (-531.948) (-531.866) (-534.855) [-536.219] * [-534.791] (-533.605) (-530.871) (-533.914) -- 0:00:40
      361000 -- (-533.463) (-533.108) [-538.798] (-534.288) * (-537.713) [-533.154] (-534.321) (-532.829) -- 0:00:40
      361500 -- (-532.056) (-531.120) [-532.243] (-533.125) * (-535.732) (-535.081) (-535.004) [-532.441] -- 0:00:40
      362000 -- (-533.770) (-533.384) (-531.493) [-532.723] * [-533.027] (-533.110) (-531.664) (-533.253) -- 0:00:40
      362500 -- (-533.878) [-533.508] (-532.744) (-535.781) * (-533.163) (-534.972) [-534.313] (-534.444) -- 0:00:40
      363000 -- (-532.835) (-531.003) [-533.183] (-533.036) * (-530.952) (-535.059) [-532.425] (-533.730) -- 0:00:40
      363500 -- (-532.655) (-532.261) [-531.958] (-533.003) * (-531.044) [-533.944] (-535.925) (-532.847) -- 0:00:40
      364000 -- (-532.281) (-535.443) (-532.523) [-536.853] * (-533.548) (-534.240) [-532.444] (-535.009) -- 0:00:40
      364500 -- (-532.540) (-532.804) (-532.515) [-532.238] * (-532.240) [-533.488] (-534.723) (-536.584) -- 0:00:40
      365000 -- (-532.724) (-534.066) (-532.357) [-531.009] * [-533.842] (-532.518) (-532.628) (-536.011) -- 0:00:40

      Average standard deviation of split frequencies: 0.016959

      365500 -- (-534.703) (-534.727) [-533.650] (-533.249) * (-532.278) [-531.565] (-533.000) (-532.105) -- 0:00:39
      366000 -- (-534.184) [-533.201] (-534.489) (-532.686) * (-532.850) (-531.266) [-532.274] (-533.940) -- 0:00:39
      366500 -- [-534.314] (-533.397) (-534.331) (-536.575) * [-533.437] (-532.591) (-532.966) (-533.712) -- 0:00:39
      367000 -- (-533.449) (-534.062) [-532.026] (-534.077) * (-534.203) [-532.102] (-534.602) (-532.345) -- 0:00:39
      367500 -- (-535.069) [-532.619] (-534.396) (-535.148) * [-532.632] (-534.786) (-537.349) (-532.577) -- 0:00:39
      368000 -- (-533.085) [-533.454] (-546.167) (-531.042) * (-532.689) (-535.060) (-533.801) [-531.350] -- 0:00:39
      368500 -- (-532.873) (-534.292) [-531.543] (-531.083) * (-531.118) (-532.405) [-534.302] (-533.601) -- 0:00:39
      369000 -- (-533.086) (-532.663) [-533.491] (-532.420) * [-531.715] (-534.672) (-535.266) (-531.494) -- 0:00:39
      369500 -- (-533.126) (-535.715) (-533.336) [-532.150] * (-532.846) (-535.672) (-535.087) [-533.526] -- 0:00:39
      370000 -- (-532.779) (-532.928) (-537.419) [-534.592] * (-533.413) [-535.825] (-535.352) (-533.930) -- 0:00:39

      Average standard deviation of split frequencies: 0.015897

      370500 -- (-532.675) [-530.379] (-535.087) (-533.604) * (-534.618) (-532.169) [-533.299] (-534.724) -- 0:00:39
      371000 -- (-533.447) (-534.900) (-535.419) [-531.811] * (-532.745) (-531.497) (-532.616) [-534.091] -- 0:00:38
      371500 -- (-532.690) (-532.832) (-533.428) [-531.792] * (-531.468) (-534.045) [-533.046] (-535.331) -- 0:00:38
      372000 -- (-535.863) (-533.214) (-532.598) [-533.546] * (-533.726) (-533.176) [-533.441] (-532.074) -- 0:00:38
      372500 -- [-532.438] (-535.631) (-536.340) (-530.260) * [-530.845] (-534.737) (-534.415) (-538.398) -- 0:00:38
      373000 -- [-532.554] (-535.795) (-532.901) (-531.903) * (-532.989) (-531.638) [-533.872] (-537.782) -- 0:00:38
      373500 -- (-534.093) [-536.065] (-532.141) (-534.583) * (-533.067) (-536.067) (-532.020) [-533.741] -- 0:00:38
      374000 -- (-531.724) (-532.573) (-531.865) [-530.393] * (-532.330) (-534.905) [-533.540] (-537.754) -- 0:00:38
      374500 -- (-536.364) (-531.418) [-530.936] (-530.786) * [-532.435] (-533.338) (-534.202) (-533.860) -- 0:00:38
      375000 -- (-533.660) (-530.575) [-531.757] (-536.093) * [-532.672] (-533.422) (-534.639) (-533.656) -- 0:00:40

      Average standard deviation of split frequencies: 0.016020

      375500 -- (-532.585) (-533.714) [-533.861] (-536.739) * (-536.782) [-534.215] (-532.630) (-535.061) -- 0:00:39
      376000 -- (-535.385) (-535.651) [-533.338] (-531.712) * (-533.626) (-532.576) [-534.481] (-534.603) -- 0:00:39
      376500 -- (-533.928) (-532.207) [-533.394] (-532.447) * (-532.705) [-532.804] (-533.225) (-532.980) -- 0:00:39
      377000 -- (-532.717) (-532.987) [-532.211] (-534.853) * (-530.852) [-531.433] (-533.756) (-532.108) -- 0:00:39
      377500 -- (-536.899) (-534.240) (-532.156) [-532.128] * (-531.457) [-535.379] (-532.369) (-538.539) -- 0:00:39
      378000 -- (-533.771) (-534.794) (-532.895) [-535.420] * (-532.604) (-536.068) (-538.263) [-531.994] -- 0:00:39
      378500 -- (-533.726) [-532.170] (-532.127) (-537.525) * [-530.752] (-537.296) (-542.585) (-533.806) -- 0:00:39
      379000 -- (-536.219) [-532.462] (-531.127) (-536.802) * [-531.222] (-535.462) (-536.434) (-535.730) -- 0:00:39
      379500 -- [-533.968] (-534.643) (-533.304) (-533.026) * (-532.193) [-531.323] (-541.570) (-536.332) -- 0:00:39
      380000 -- (-536.388) (-535.844) (-532.205) [-533.172] * (-534.175) [-532.620] (-535.011) (-532.944) -- 0:00:39

      Average standard deviation of split frequencies: 0.016099

      380500 -- (-533.090) (-532.622) [-533.242] (-534.088) * [-532.129] (-538.662) (-534.743) (-532.409) -- 0:00:39
      381000 -- (-534.693) [-534.356] (-532.273) (-534.121) * [-531.826] (-534.017) (-534.816) (-532.911) -- 0:00:38
      381500 -- (-539.561) (-534.864) [-533.714] (-533.680) * (-532.420) (-535.322) (-533.625) [-535.559] -- 0:00:38
      382000 -- (-532.500) (-534.120) [-532.527] (-536.089) * (-532.682) (-534.427) [-537.034] (-535.294) -- 0:00:38
      382500 -- (-532.974) [-533.356] (-531.607) (-532.995) * [-533.932] (-531.935) (-535.485) (-532.996) -- 0:00:38
      383000 -- (-535.421) (-533.935) (-531.705) [-533.007] * [-530.792] (-534.863) (-532.667) (-533.411) -- 0:00:38
      383500 -- (-535.199) [-533.258] (-534.323) (-532.695) * (-533.032) (-532.787) [-533.811] (-533.643) -- 0:00:38
      384000 -- (-540.791) (-533.260) [-538.564] (-530.785) * [-532.169] (-531.958) (-533.251) (-534.577) -- 0:00:38
      384500 -- (-537.607) (-535.332) [-538.737] (-532.808) * (-535.472) [-533.542] (-535.146) (-532.685) -- 0:00:38
      385000 -- (-536.487) [-538.825] (-533.057) (-533.875) * (-531.940) (-536.988) [-534.295] (-535.152) -- 0:00:38

      Average standard deviation of split frequencies: 0.015876

      385500 -- (-533.076) (-533.235) (-533.840) [-532.654] * (-531.710) [-532.865] (-533.153) (-533.525) -- 0:00:38
      386000 -- (-534.243) (-545.754) (-533.982) [-533.831] * (-533.573) (-534.010) (-534.832) [-533.532] -- 0:00:38
      386500 -- (-532.256) [-532.694] (-531.518) (-531.961) * (-532.055) (-531.440) [-534.297] (-539.196) -- 0:00:38
      387000 -- [-534.764] (-536.933) (-532.356) (-531.481) * (-532.565) (-531.270) [-532.855] (-532.902) -- 0:00:38
      387500 -- (-533.497) (-534.050) (-530.962) [-534.086] * (-533.592) (-534.379) (-536.104) [-532.442] -- 0:00:37
      388000 -- (-534.578) (-533.795) [-533.165] (-537.286) * [-532.789] (-531.847) (-534.949) (-534.082) -- 0:00:37
      388500 -- (-532.770) (-534.958) (-531.412) [-535.443] * (-533.726) [-530.352] (-533.251) (-533.936) -- 0:00:37
      389000 -- (-533.829) [-532.961] (-532.288) (-533.687) * [-541.184] (-530.283) (-532.012) (-531.982) -- 0:00:37
      389500 -- [-532.506] (-533.204) (-532.344) (-532.709) * (-537.122) [-530.277] (-532.293) (-532.747) -- 0:00:37
      390000 -- (-532.009) (-534.146) [-535.986] (-534.761) * (-531.306) (-532.153) [-533.497] (-532.492) -- 0:00:37

      Average standard deviation of split frequencies: 0.015955

      390500 -- (-533.605) (-532.986) (-537.405) [-532.335] * (-532.061) (-535.473) (-531.963) [-533.476] -- 0:00:39
      391000 -- (-538.328) (-533.411) [-534.646] (-533.488) * [-532.425] (-534.278) (-536.641) (-532.989) -- 0:00:38
      391500 -- [-533.906] (-535.123) (-532.215) (-533.046) * (-534.394) (-532.828) [-533.384] (-533.076) -- 0:00:38
      392000 -- (-533.556) (-533.833) [-533.327] (-533.435) * (-532.676) [-532.289] (-533.356) (-533.061) -- 0:00:38
      392500 -- (-534.445) (-540.433) [-534.320] (-535.122) * (-532.284) (-532.901) [-533.491] (-533.717) -- 0:00:38
      393000 -- (-536.301) [-534.290] (-534.959) (-537.907) * (-531.495) [-531.801] (-534.849) (-533.146) -- 0:00:38
      393500 -- (-534.864) (-532.242) (-539.341) [-532.931] * (-534.263) (-535.137) [-534.322] (-533.632) -- 0:00:38
      394000 -- [-532.960] (-534.319) (-531.247) (-532.861) * (-534.132) (-535.175) (-532.694) [-533.007] -- 0:00:38
      394500 -- (-534.412) (-534.003) [-532.226] (-534.578) * (-536.761) (-532.876) (-533.013) [-536.563] -- 0:00:38
      395000 -- (-535.503) (-533.570) (-532.674) [-534.533] * (-532.690) (-532.864) (-531.753) [-533.859] -- 0:00:38

      Average standard deviation of split frequencies: 0.015211

      395500 -- [-531.398] (-534.412) (-533.209) (-536.016) * (-534.557) [-532.223] (-533.651) (-532.992) -- 0:00:38
      396000 -- [-534.940] (-533.150) (-536.211) (-533.747) * (-534.552) [-531.144] (-531.448) (-533.556) -- 0:00:38
      396500 -- [-533.352] (-531.561) (-532.739) (-534.837) * [-530.728] (-531.194) (-533.422) (-532.042) -- 0:00:38
      397000 -- [-534.772] (-534.513) (-533.331) (-532.359) * (-533.205) (-536.142) (-533.709) [-533.733] -- 0:00:37
      397500 -- (-533.394) (-540.741) [-534.607] (-535.774) * [-534.975] (-535.375) (-533.099) (-537.112) -- 0:00:37
      398000 -- (-537.044) [-533.757] (-535.566) (-531.748) * (-532.302) (-532.571) (-532.937) [-532.944] -- 0:00:37
      398500 -- (-538.370) (-534.735) (-533.233) [-533.180] * (-531.555) (-533.869) (-532.429) [-535.029] -- 0:00:37
      399000 -- [-535.411] (-534.090) (-533.508) (-534.198) * [-531.264] (-534.158) (-532.258) (-534.811) -- 0:00:37
      399500 -- (-536.111) (-540.647) [-531.752] (-539.359) * (-531.493) (-532.698) [-533.937] (-533.407) -- 0:00:37
      400000 -- [-535.039] (-533.187) (-533.145) (-532.956) * (-531.711) (-534.254) [-531.077] (-535.919) -- 0:00:37

      Average standard deviation of split frequencies: 0.015419

      400500 -- (-536.849) (-535.141) (-532.878) [-532.497] * (-532.626) (-533.929) (-537.498) [-534.955] -- 0:00:37
      401000 -- (-533.939) [-532.734] (-533.259) (-534.641) * (-531.574) [-537.523] (-534.118) (-534.906) -- 0:00:37
      401500 -- [-532.519] (-538.144) (-533.490) (-532.204) * (-530.661) [-536.382] (-533.750) (-533.351) -- 0:00:37
      402000 -- [-533.628] (-536.764) (-533.445) (-533.904) * (-533.675) [-536.250] (-534.113) (-531.868) -- 0:00:37
      402500 -- (-540.174) (-532.473) (-533.227) [-533.141] * (-533.140) (-535.546) [-532.096] (-532.731) -- 0:00:37
      403000 -- (-533.102) [-532.325] (-534.584) (-533.506) * (-532.628) [-539.111] (-534.339) (-532.878) -- 0:00:37
      403500 -- (-535.091) (-533.415) (-533.593) [-535.580] * [-532.570] (-538.539) (-530.318) (-537.165) -- 0:00:36
      404000 -- (-534.595) [-532.869] (-534.177) (-537.284) * (-534.576) (-533.209) (-532.934) [-534.343] -- 0:00:36
      404500 -- (-534.362) (-537.961) [-537.768] (-532.153) * (-532.885) (-536.639) [-532.852] (-533.321) -- 0:00:36
      405000 -- (-536.999) (-532.771) [-533.151] (-533.392) * (-532.588) [-535.422] (-534.173) (-535.837) -- 0:00:36

      Average standard deviation of split frequencies: 0.014972

      405500 -- (-532.434) [-533.185] (-534.681) (-537.151) * [-530.358] (-536.034) (-533.976) (-533.739) -- 0:00:36
      406000 -- (-536.409) [-530.752] (-533.696) (-533.203) * [-531.357] (-535.086) (-530.324) (-533.513) -- 0:00:38
      406500 -- [-534.276] (-531.777) (-532.283) (-532.084) * (-531.401) [-532.573] (-530.875) (-532.811) -- 0:00:37
      407000 -- [-532.772] (-533.798) (-533.725) (-531.316) * (-532.094) (-533.304) (-531.305) [-533.158] -- 0:00:37
      407500 -- (-533.450) (-532.142) (-535.139) [-535.076] * (-532.248) (-537.870) [-530.563] (-538.841) -- 0:00:37
      408000 -- (-535.059) (-530.533) [-534.500] (-533.865) * (-535.206) (-535.185) [-531.552] (-536.355) -- 0:00:37
      408500 -- (-535.617) (-533.974) (-535.126) [-535.218] * (-532.890) (-533.769) (-532.718) [-532.838] -- 0:00:37
      409000 -- (-533.334) [-532.900] (-535.568) (-534.267) * [-532.150] (-539.008) (-532.297) (-534.209) -- 0:00:37
      409500 -- (-534.191) (-533.047) (-535.489) [-535.581] * [-532.625] (-536.755) (-531.851) (-539.858) -- 0:00:37
      410000 -- (-535.284) (-530.859) (-532.719) [-533.112] * (-531.920) [-540.616] (-532.400) (-534.900) -- 0:00:37

      Average standard deviation of split frequencies: 0.014983

      410500 -- (-532.828) (-533.551) (-531.086) [-535.513] * (-534.266) (-535.039) [-532.073] (-532.593) -- 0:00:37
      411000 -- (-532.814) (-536.417) (-533.589) [-533.720] * (-532.922) (-533.821) [-529.799] (-535.118) -- 0:00:37
      411500 -- (-533.088) (-536.472) [-532.771] (-532.331) * (-534.242) (-533.625) [-530.881] (-532.636) -- 0:00:37
      412000 -- (-533.284) [-532.712] (-532.818) (-532.335) * (-534.727) (-533.267) [-532.983] (-531.885) -- 0:00:37
      412500 -- (-533.304) (-534.010) (-536.467) [-533.849] * (-534.885) (-533.898) [-531.943] (-533.363) -- 0:00:37
      413000 -- [-533.220] (-533.757) (-533.174) (-531.714) * (-535.256) (-533.851) [-531.412] (-532.598) -- 0:00:36
      413500 -- (-532.660) (-531.147) [-531.638] (-532.986) * [-531.806] (-533.270) (-530.898) (-532.545) -- 0:00:36
      414000 -- (-534.215) (-532.901) (-532.571) [-532.026] * (-534.092) (-532.069) [-530.244] (-538.341) -- 0:00:36
      414500 -- (-533.807) [-531.059] (-535.712) (-531.469) * (-537.225) (-532.204) [-531.053] (-534.592) -- 0:00:36
      415000 -- (-534.851) (-531.057) [-535.167] (-533.562) * [-533.437] (-533.657) (-530.508) (-535.038) -- 0:00:36

      Average standard deviation of split frequencies: 0.013956

      415500 -- (-536.473) [-532.371] (-538.244) (-531.495) * (-533.232) (-534.286) [-531.665] (-532.226) -- 0:00:36
      416000 -- (-532.008) (-532.144) (-534.736) [-532.917] * (-533.143) [-533.325] (-529.707) (-532.973) -- 0:00:36
      416500 -- (-533.427) (-532.620) (-533.749) [-535.118] * (-532.786) (-532.243) [-532.130] (-533.467) -- 0:00:36
      417000 -- (-533.629) (-533.192) [-533.918] (-533.188) * (-538.195) (-534.883) (-531.947) [-533.664] -- 0:00:36
      417500 -- (-533.145) (-532.151) [-531.563] (-533.826) * [-533.778] (-535.563) (-533.136) (-532.857) -- 0:00:36
      418000 -- (-532.949) [-534.217] (-536.670) (-535.504) * (-536.067) (-536.355) [-530.880] (-535.749) -- 0:00:36
      418500 -- (-535.069) (-532.357) [-532.024] (-533.601) * (-537.194) [-536.445] (-536.746) (-534.337) -- 0:00:36
      419000 -- (-534.790) (-532.296) [-533.064] (-532.811) * [-535.731] (-532.901) (-531.113) (-532.457) -- 0:00:36
      419500 -- (-531.612) (-533.614) (-534.403) [-533.435] * [-532.819] (-534.093) (-536.866) (-533.387) -- 0:00:35
      420000 -- (-532.376) (-533.628) [-531.359] (-534.798) * (-533.727) (-533.129) [-533.502] (-533.147) -- 0:00:35

      Average standard deviation of split frequencies: 0.012799

      420500 -- (-533.489) (-533.064) (-536.903) [-534.899] * (-534.762) [-530.937] (-532.225) (-534.414) -- 0:00:35
      421000 -- (-533.326) [-532.742] (-531.136) (-532.485) * [-532.743] (-536.212) (-532.477) (-535.881) -- 0:00:35
      421500 -- (-531.838) [-533.614] (-533.713) (-533.115) * (-534.832) (-533.592) [-533.328] (-536.446) -- 0:00:37
      422000 -- [-536.204] (-535.438) (-532.656) (-535.522) * [-532.620] (-533.817) (-535.598) (-535.839) -- 0:00:36
      422500 -- (-534.128) [-534.674] (-531.900) (-534.825) * (-537.768) (-531.714) [-531.144] (-535.381) -- 0:00:36
      423000 -- (-532.372) (-535.642) (-533.023) [-534.921] * (-536.215) (-533.604) [-531.405] (-538.586) -- 0:00:36
      423500 -- [-532.115] (-531.653) (-536.350) (-535.218) * [-531.400] (-539.242) (-533.691) (-532.952) -- 0:00:36
      424000 -- (-532.281) (-534.728) (-532.180) [-531.620] * [-532.062] (-538.382) (-533.175) (-538.671) -- 0:00:36
      424500 -- (-535.062) (-531.344) (-536.352) [-534.685] * [-532.937] (-531.592) (-536.755) (-536.652) -- 0:00:36
      425000 -- [-534.594] (-533.646) (-535.791) (-533.237) * (-532.718) (-531.240) [-532.303] (-539.567) -- 0:00:36

      Average standard deviation of split frequencies: 0.011357

      425500 -- (-533.678) [-533.582] (-532.412) (-537.401) * (-532.047) [-537.871] (-532.116) (-534.897) -- 0:00:36
      426000 -- (-533.251) [-533.267] (-537.360) (-532.424) * (-532.767) (-533.030) [-530.945] (-535.573) -- 0:00:36
      426500 -- [-534.207] (-533.620) (-532.888) (-534.424) * (-532.533) [-532.453] (-532.275) (-533.615) -- 0:00:36
      427000 -- (-533.862) (-533.261) [-532.905] (-534.410) * (-535.062) (-533.732) (-533.606) [-531.884] -- 0:00:36
      427500 -- [-533.922] (-536.423) (-532.990) (-535.358) * (-532.126) (-533.883) (-530.959) [-537.944] -- 0:00:36
      428000 -- (-536.354) [-532.848] (-531.811) (-534.361) * (-535.683) [-534.215] (-531.449) (-534.164) -- 0:00:36
      428500 -- (-531.976) [-531.060] (-535.921) (-532.059) * (-535.212) (-535.141) (-534.924) [-533.176] -- 0:00:36
      429000 -- (-533.531) [-535.388] (-535.576) (-534.376) * (-533.125) (-534.374) [-531.016] (-535.133) -- 0:00:35
      429500 -- (-531.818) (-534.348) (-531.236) [-533.886] * (-531.173) (-538.546) (-531.737) [-533.271] -- 0:00:35
      430000 -- [-535.788] (-534.982) (-532.534) (-531.402) * (-531.214) (-536.250) [-530.762] (-535.450) -- 0:00:35

      Average standard deviation of split frequencies: 0.010888

      430500 -- (-531.339) [-533.382] (-531.686) (-532.300) * (-531.176) (-535.460) [-529.095] (-532.644) -- 0:00:35
      431000 -- [-533.605] (-533.732) (-539.257) (-531.730) * [-531.008] (-533.776) (-532.950) (-533.896) -- 0:00:35
      431500 -- [-531.172] (-535.259) (-533.233) (-532.376) * (-533.107) (-534.772) (-530.384) [-532.942] -- 0:00:35
      432000 -- [-531.083] (-534.097) (-535.986) (-535.035) * (-530.673) [-539.391] (-534.983) (-534.782) -- 0:00:35
      432500 -- (-535.409) [-532.358] (-532.287) (-533.818) * [-532.568] (-534.691) (-531.835) (-534.363) -- 0:00:35
      433000 -- [-537.076] (-535.798) (-532.297) (-534.354) * (-536.129) (-533.894) (-531.726) [-533.567] -- 0:00:35
      433500 -- (-538.573) [-531.295] (-531.763) (-535.419) * (-530.028) [-531.945] (-533.480) (-532.780) -- 0:00:35
      434000 -- (-536.486) [-531.972] (-533.819) (-533.956) * (-532.471) (-533.948) (-532.240) [-532.688] -- 0:00:35
      434500 -- (-533.166) [-532.024] (-535.789) (-531.456) * (-533.849) [-533.431] (-533.235) (-538.458) -- 0:00:35
      435000 -- (-530.371) (-533.221) [-533.678] (-532.687) * (-534.897) (-534.691) (-534.302) [-533.318] -- 0:00:35

      Average standard deviation of split frequencies: 0.011324

      435500 -- [-532.336] (-534.255) (-533.497) (-533.362) * (-530.615) (-534.208) [-530.998] (-534.393) -- 0:00:34
      436000 -- (-533.833) (-535.164) (-535.032) [-532.290] * [-531.217] (-532.159) (-531.903) (-533.118) -- 0:00:34
      436500 -- [-531.377] (-535.009) (-532.943) (-534.717) * (-533.128) (-534.670) [-530.085] (-540.893) -- 0:00:34
      437000 -- (-532.248) (-534.105) [-532.178] (-533.640) * (-531.651) (-537.964) (-530.939) [-536.581] -- 0:00:34
      437500 -- [-536.203] (-535.610) (-532.065) (-531.136) * (-534.449) (-535.368) (-532.782) [-534.161] -- 0:00:36
      438000 -- (-533.414) [-530.965] (-534.210) (-531.176) * (-533.665) (-537.293) (-532.237) [-533.691] -- 0:00:35
      438500 -- (-533.530) (-536.848) (-533.502) [-533.354] * (-532.849) (-533.994) (-531.559) [-533.228] -- 0:00:35
      439000 -- (-533.341) [-534.575] (-532.237) (-531.500) * (-533.125) [-532.398] (-531.979) (-532.284) -- 0:00:35
      439500 -- [-533.095] (-534.700) (-535.024) (-531.988) * (-532.332) [-533.672] (-533.326) (-533.016) -- 0:00:35
      440000 -- (-535.785) (-534.227) [-534.267] (-532.761) * [-531.695] (-534.690) (-535.234) (-536.481) -- 0:00:35

      Average standard deviation of split frequencies: 0.011542

      440500 -- (-534.831) (-533.062) (-535.027) [-534.030] * (-533.588) (-533.173) [-535.102] (-535.955) -- 0:00:35
      441000 -- (-533.965) [-531.987] (-535.540) (-532.742) * (-535.092) (-533.621) [-535.137] (-535.107) -- 0:00:35
      441500 -- (-532.293) [-534.703] (-531.162) (-533.181) * (-534.189) [-535.465] (-533.441) (-537.865) -- 0:00:35
      442000 -- (-537.325) (-537.415) [-533.714] (-535.192) * (-532.898) (-534.030) [-534.579] (-531.141) -- 0:00:35
      442500 -- (-532.844) (-534.474) [-533.788] (-532.927) * [-534.182] (-534.790) (-536.978) (-534.181) -- 0:00:35
      443000 -- (-532.854) (-536.709) [-533.714] (-531.603) * (-534.752) (-533.540) (-530.823) [-535.204] -- 0:00:35
      443500 -- (-532.672) (-532.102) [-537.754] (-533.154) * (-533.043) [-533.989] (-533.076) (-533.160) -- 0:00:35
      444000 -- [-534.133] (-533.320) (-537.324) (-530.910) * (-533.421) (-533.524) [-533.356] (-534.916) -- 0:00:35
      444500 -- [-532.767] (-533.731) (-534.426) (-531.757) * (-532.284) (-532.087) (-534.204) [-533.790] -- 0:00:34
      445000 -- (-533.432) [-532.941] (-541.175) (-532.509) * (-534.653) [-532.103] (-532.471) (-535.121) -- 0:00:34

      Average standard deviation of split frequencies: 0.010792

      445500 -- (-533.668) [-533.880] (-536.150) (-533.176) * (-535.799) (-532.247) [-534.076] (-533.306) -- 0:00:34
      446000 -- [-533.687] (-531.058) (-532.370) (-534.154) * (-534.078) [-531.598] (-532.454) (-532.809) -- 0:00:34
      446500 -- (-533.571) (-532.779) [-534.404] (-534.501) * (-536.078) [-533.052] (-532.996) (-532.380) -- 0:00:34
      447000 -- (-532.308) [-531.132] (-532.527) (-533.321) * (-533.474) [-534.345] (-535.857) (-533.325) -- 0:00:34
      447500 -- (-537.682) [-533.098] (-532.563) (-532.879) * (-534.178) [-532.410] (-534.101) (-531.842) -- 0:00:34
      448000 -- (-535.615) [-534.394] (-534.446) (-531.575) * [-534.343] (-535.186) (-534.491) (-533.335) -- 0:00:34
      448500 -- (-533.195) (-535.283) [-533.647] (-533.076) * (-531.246) (-532.525) (-533.229) [-536.104] -- 0:00:34
      449000 -- (-535.032) (-535.372) (-532.596) [-532.257] * (-530.776) (-533.315) [-532.201] (-534.398) -- 0:00:34
      449500 -- [-532.803] (-536.593) (-532.473) (-533.256) * [-531.956] (-533.627) (-531.447) (-534.402) -- 0:00:34
      450000 -- [-533.297] (-533.959) (-532.109) (-530.991) * (-532.369) (-538.035) [-535.900] (-533.524) -- 0:00:34

      Average standard deviation of split frequencies: 0.011231

      450500 -- (-533.972) (-533.744) (-536.006) [-536.360] * (-531.603) (-534.446) [-532.821] (-532.264) -- 0:00:34
      451000 -- (-533.623) [-531.753] (-533.977) (-535.073) * [-532.984] (-530.982) (-533.814) (-534.762) -- 0:00:34
      451500 -- (-533.835) (-530.503) [-533.173] (-533.110) * (-534.512) [-532.568] (-531.488) (-536.234) -- 0:00:34
      452000 -- (-534.600) [-532.997] (-531.783) (-535.118) * (-534.960) (-537.336) [-531.544] (-534.178) -- 0:00:33
      452500 -- [-534.551] (-529.842) (-536.119) (-533.565) * (-533.975) [-537.207] (-534.051) (-536.013) -- 0:00:33
      453000 -- (-535.464) (-531.012) (-532.002) [-533.090] * [-531.850] (-538.656) (-530.743) (-533.892) -- 0:00:33
      453500 -- (-533.638) [-533.520] (-533.352) (-533.637) * (-533.597) (-534.526) (-532.845) [-532.021] -- 0:00:34
      454000 -- (-533.277) (-532.574) [-534.577] (-533.396) * (-533.538) (-532.834) [-539.676] (-535.809) -- 0:00:34
      454500 -- (-538.017) (-535.211) [-532.826] (-533.434) * (-532.900) (-534.633) [-533.091] (-533.858) -- 0:00:34
      455000 -- (-532.237) (-534.645) (-532.492) [-530.518] * (-537.502) [-534.570] (-534.647) (-538.022) -- 0:00:34

      Average standard deviation of split frequencies: 0.010719

      455500 -- (-532.647) [-530.414] (-534.334) (-534.644) * (-532.298) (-534.311) [-537.122] (-533.753) -- 0:00:34
      456000 -- [-533.536] (-535.848) (-536.177) (-530.324) * [-535.841] (-535.373) (-532.702) (-533.533) -- 0:00:34
      456500 -- (-531.373) (-535.817) [-534.806] (-531.233) * (-535.649) (-535.761) [-531.517] (-534.086) -- 0:00:34
      457000 -- (-533.370) (-535.920) [-531.131] (-535.751) * (-539.551) (-534.274) [-533.791] (-536.201) -- 0:00:34
      457500 -- (-537.376) (-533.627) (-533.131) [-532.354] * [-531.520] (-535.534) (-534.632) (-532.803) -- 0:00:34
      458000 -- (-536.009) (-534.295) [-532.249] (-534.650) * (-534.021) (-532.965) (-537.912) [-533.604] -- 0:00:34
      458500 -- (-536.221) (-532.936) (-532.013) [-532.694] * (-534.167) (-533.427) [-531.332] (-534.477) -- 0:00:34
      459000 -- (-533.073) [-532.273] (-532.897) (-532.366) * (-531.925) [-535.248] (-534.119) (-533.353) -- 0:00:34
      459500 -- [-532.036] (-530.793) (-532.950) (-539.675) * (-533.663) [-533.418] (-533.267) (-532.601) -- 0:00:34
      460000 -- [-533.012] (-535.583) (-534.096) (-534.361) * (-533.619) (-534.648) [-535.908] (-538.542) -- 0:00:34

      Average standard deviation of split frequencies: 0.010347

      460500 -- [-533.501] (-533.440) (-538.392) (-532.787) * [-533.452] (-531.253) (-532.440) (-536.402) -- 0:00:33
      461000 -- (-531.908) (-532.411) (-534.407) [-531.677] * [-532.087] (-534.269) (-533.727) (-536.141) -- 0:00:33
      461500 -- (-534.236) (-531.189) (-534.702) [-529.989] * (-535.742) [-530.744] (-534.114) (-536.139) -- 0:00:33
      462000 -- (-537.007) (-531.192) (-538.668) [-533.621] * (-533.988) (-534.336) [-532.795] (-535.923) -- 0:00:33
      462500 -- [-532.545] (-533.401) (-532.990) (-532.461) * [-534.854] (-533.115) (-533.497) (-534.742) -- 0:00:33
      463000 -- [-532.324] (-534.794) (-535.837) (-532.431) * [-532.735] (-532.394) (-535.741) (-533.755) -- 0:00:33
      463500 -- (-536.441) (-530.778) [-534.916] (-532.136) * (-533.566) (-531.803) [-534.305] (-541.087) -- 0:00:33
      464000 -- (-536.345) (-532.985) (-532.486) [-531.833] * (-537.926) (-532.300) (-534.064) [-530.801] -- 0:00:33
      464500 -- (-533.180) [-535.061] (-532.937) (-531.531) * (-532.844) [-535.785] (-532.038) (-534.207) -- 0:00:33
      465000 -- (-532.697) (-533.836) (-533.754) [-531.217] * [-533.839] (-529.993) (-533.897) (-530.525) -- 0:00:33

      Average standard deviation of split frequencies: 0.010060

      465500 -- [-531.607] (-531.815) (-534.530) (-532.562) * (-532.664) [-533.564] (-535.019) (-534.533) -- 0:00:33
      466000 -- (-533.849) (-532.160) (-536.927) [-532.945] * (-531.487) (-532.404) (-532.665) [-535.463] -- 0:00:33
      466500 -- (-532.222) [-533.047] (-532.155) (-530.367) * (-531.275) (-534.325) (-534.416) [-533.126] -- 0:00:33
      467000 -- [-535.169] (-534.866) (-534.269) (-532.569) * [-532.072] (-532.901) (-534.392) (-533.799) -- 0:00:33
      467500 -- (-532.639) (-531.200) (-533.989) [-531.287] * (-537.299) [-532.122] (-536.054) (-534.551) -- 0:00:33
      468000 -- (-532.042) [-533.132] (-534.958) (-533.883) * (-536.122) (-532.667) [-535.826] (-535.850) -- 0:00:32
      468500 -- [-532.519] (-533.520) (-534.665) (-536.788) * (-531.587) (-531.468) (-537.942) [-532.421] -- 0:00:32
      469000 -- (-539.118) [-532.972] (-534.189) (-538.185) * (-534.700) (-533.139) [-533.100] (-533.613) -- 0:00:33
      469500 -- [-531.385] (-537.611) (-533.848) (-536.822) * (-533.060) (-531.753) (-532.480) [-532.406] -- 0:00:33
      470000 -- (-533.477) (-532.090) (-533.694) [-533.769] * (-537.094) [-530.465] (-532.485) (-533.657) -- 0:00:33

      Average standard deviation of split frequencies: 0.010628

      470500 -- (-534.387) (-536.281) [-535.254] (-532.266) * [-531.621] (-531.687) (-534.381) (-534.427) -- 0:00:33
      471000 -- [-533.610] (-532.555) (-536.807) (-533.661) * (-531.815) (-530.400) [-534.337] (-535.451) -- 0:00:33
      471500 -- (-532.092) (-533.364) [-535.042] (-534.070) * (-534.803) (-531.792) (-533.139) [-532.639] -- 0:00:33
      472000 -- (-536.712) (-531.836) [-533.801] (-538.299) * (-531.948) (-537.698) [-533.568] (-532.642) -- 0:00:33
      472500 -- (-532.760) [-532.608] (-535.439) (-537.553) * (-537.015) (-531.598) [-532.291] (-535.449) -- 0:00:33
      473000 -- [-530.948] (-531.535) (-535.424) (-540.774) * [-533.092] (-531.187) (-531.447) (-533.426) -- 0:00:33
      473500 -- (-533.993) [-530.624] (-534.116) (-532.571) * (-534.648) (-531.186) (-531.235) [-531.936] -- 0:00:33
      474000 -- (-536.231) [-532.694] (-534.969) (-536.714) * (-538.743) (-535.736) [-532.892] (-533.034) -- 0:00:33
      474500 -- (-530.176) (-534.240) [-532.771] (-533.788) * (-535.952) (-531.064) [-533.564] (-534.697) -- 0:00:33
      475000 -- (-532.661) [-533.618] (-537.024) (-532.860) * [-533.049] (-534.929) (-532.099) (-532.998) -- 0:00:33

      Average standard deviation of split frequencies: 0.010013

      475500 -- (-534.539) [-533.088] (-540.537) (-531.830) * (-533.023) [-532.778] (-532.092) (-534.984) -- 0:00:33
      476000 -- [-530.645] (-535.757) (-534.579) (-533.202) * (-538.496) (-534.116) (-532.564) [-532.992] -- 0:00:33
      476500 -- (-532.235) [-538.558] (-532.125) (-533.641) * (-532.388) (-535.574) (-533.201) [-531.878] -- 0:00:32
      477000 -- (-532.087) (-538.805) [-531.861] (-533.547) * (-534.241) (-536.299) [-533.311] (-535.337) -- 0:00:32
      477500 -- (-531.357) [-537.825] (-533.063) (-531.117) * [-531.129] (-531.888) (-535.259) (-533.093) -- 0:00:32
      478000 -- (-533.231) (-533.438) (-534.115) [-531.658] * (-532.636) [-533.755] (-532.895) (-537.461) -- 0:00:32
      478500 -- [-532.046] (-532.793) (-532.960) (-532.285) * (-532.136) (-536.094) (-533.321) [-534.915] -- 0:00:32
      479000 -- (-532.452) [-533.036] (-532.378) (-532.740) * [-531.540] (-533.165) (-531.868) (-533.041) -- 0:00:32
      479500 -- (-532.703) (-533.852) [-532.104] (-533.306) * (-532.941) (-532.746) (-533.491) [-536.163] -- 0:00:32
      480000 -- (-533.586) (-534.661) [-534.773] (-531.582) * (-534.282) (-533.697) (-534.043) [-532.571] -- 0:00:32

      Average standard deviation of split frequencies: 0.010189

      480500 -- (-533.228) [-530.557] (-532.974) (-532.138) * (-538.254) [-532.608] (-532.752) (-533.107) -- 0:00:32
      481000 -- [-531.643] (-534.253) (-533.511) (-532.270) * (-538.356) (-533.300) [-537.195] (-534.049) -- 0:00:32
      481500 -- (-533.927) [-534.198] (-537.023) (-537.561) * (-532.147) [-532.715] (-533.436) (-533.133) -- 0:00:32
      482000 -- (-533.610) (-538.545) [-536.430] (-532.952) * (-532.072) (-535.672) (-535.733) [-534.117] -- 0:00:32
      482500 -- (-533.280) [-536.859] (-536.808) (-538.269) * (-532.310) [-531.590] (-535.624) (-535.687) -- 0:00:32
      483000 -- [-535.821] (-534.993) (-534.451) (-535.420) * (-530.560) (-533.449) (-533.475) [-531.347] -- 0:00:32
      483500 -- (-536.608) (-533.976) [-532.540] (-538.066) * (-532.853) (-533.358) [-535.983] (-532.728) -- 0:00:32
      484000 -- (-533.804) [-533.649] (-535.047) (-534.642) * [-531.964] (-532.430) (-534.338) (-533.449) -- 0:00:31
      484500 -- (-538.640) [-532.271] (-534.310) (-534.659) * [-532.185] (-531.110) (-534.569) (-536.003) -- 0:00:31
      485000 -- (-532.768) (-533.658) (-535.762) [-534.197] * (-535.317) (-531.941) (-535.173) [-532.799] -- 0:00:32

      Average standard deviation of split frequencies: 0.010724

      485500 -- (-533.227) [-532.255] (-536.902) (-532.328) * (-534.573) (-533.602) [-534.154] (-532.528) -- 0:00:32
      486000 -- [-533.101] (-532.998) (-533.674) (-531.155) * [-532.847] (-533.676) (-534.684) (-531.156) -- 0:00:32
      486500 -- (-532.844) [-533.655] (-534.727) (-533.508) * [-531.230] (-531.048) (-532.701) (-532.761) -- 0:00:32
      487000 -- (-532.106) (-532.741) (-535.164) [-537.355] * [-532.765] (-536.869) (-532.454) (-532.733) -- 0:00:32
      487500 -- [-532.201] (-533.595) (-532.036) (-532.259) * (-533.771) (-534.098) (-531.361) [-533.078] -- 0:00:32
      488000 -- (-536.590) (-540.276) [-533.638] (-531.893) * (-531.970) (-533.874) (-534.362) [-533.233] -- 0:00:32
      488500 -- (-536.385) (-532.980) (-533.659) [-530.011] * (-532.727) (-533.979) [-532.540] (-533.364) -- 0:00:32
      489000 -- (-535.029) [-533.390] (-534.944) (-531.238) * (-532.439) (-535.436) (-532.880) [-534.957] -- 0:00:32
      489500 -- (-531.291) (-538.336) [-531.501] (-534.038) * [-534.175] (-535.957) (-530.327) (-532.631) -- 0:00:32
      490000 -- (-532.696) (-537.945) (-534.820) [-530.858] * [-531.361] (-532.716) (-532.527) (-535.420) -- 0:00:32

      Average standard deviation of split frequencies: 0.010568

      490500 -- [-535.114] (-532.287) (-535.290) (-530.909) * (-531.320) [-533.873] (-532.744) (-532.053) -- 0:00:32
      491000 -- (-535.811) [-533.367] (-533.976) (-532.519) * (-534.435) (-533.511) (-533.867) [-532.780] -- 0:00:32
      491500 -- (-535.575) (-533.592) (-532.270) [-531.107] * (-533.659) (-533.943) [-532.100] (-532.686) -- 0:00:32
      492000 -- (-533.190) [-534.458] (-532.811) (-534.597) * (-531.509) (-532.754) (-533.754) [-531.954] -- 0:00:32
      492500 -- [-534.851] (-533.533) (-533.039) (-534.885) * (-534.272) (-532.846) (-541.529) [-532.909] -- 0:00:31
      493000 -- [-532.552] (-535.165) (-533.557) (-535.109) * (-533.254) (-531.218) (-540.312) [-533.522] -- 0:00:31
      493500 -- (-536.566) (-534.578) [-533.215] (-533.898) * (-536.524) (-533.302) (-532.559) [-535.049] -- 0:00:31
      494000 -- (-535.049) [-537.696] (-532.506) (-532.583) * (-536.043) [-533.490] (-534.131) (-534.040) -- 0:00:31
      494500 -- [-533.179] (-535.200) (-531.617) (-530.836) * (-533.300) [-531.536] (-534.009) (-536.141) -- 0:00:31
      495000 -- (-530.573) (-531.781) (-532.644) [-531.247] * (-533.611) (-535.511) [-534.360] (-532.983) -- 0:00:31

      Average standard deviation of split frequencies: 0.010287

      495500 -- [-533.440] (-533.703) (-532.982) (-531.746) * (-531.942) [-532.803] (-531.331) (-539.325) -- 0:00:31
      496000 -- (-535.771) (-534.421) [-533.192] (-532.597) * [-536.371] (-532.944) (-532.837) (-535.202) -- 0:00:31
      496500 -- (-536.040) [-532.277] (-534.104) (-533.205) * [-531.187] (-532.916) (-537.401) (-537.107) -- 0:00:31
      497000 -- (-535.477) (-533.070) (-534.799) [-533.265] * (-537.252) (-532.064) [-538.818] (-535.669) -- 0:00:31
      497500 -- [-533.374] (-533.988) (-535.471) (-533.318) * (-531.328) (-533.857) [-533.863] (-532.416) -- 0:00:31
      498000 -- (-533.482) [-532.517] (-533.169) (-532.646) * (-531.047) (-533.738) [-533.006] (-531.847) -- 0:00:31
      498500 -- [-538.542] (-535.409) (-533.099) (-534.642) * [-530.315] (-533.406) (-536.106) (-532.304) -- 0:00:31
      499000 -- (-534.864) (-537.297) [-534.222] (-532.688) * [-537.614] (-535.307) (-531.764) (-532.088) -- 0:00:31
      499500 -- (-533.283) (-533.395) [-532.117] (-534.659) * (-532.852) (-535.814) [-534.745] (-534.949) -- 0:00:31
      500000 -- (-536.218) (-533.077) [-532.592] (-532.930) * (-532.052) (-536.565) [-534.444] (-536.851) -- 0:00:31

      Average standard deviation of split frequencies: 0.009859

      500500 -- [-531.493] (-533.115) (-532.644) (-535.740) * [-531.466] (-533.102) (-534.727) (-532.778) -- 0:00:31
      501000 -- (-531.164) [-534.840] (-534.440) (-531.176) * [-532.085] (-533.097) (-533.575) (-532.740) -- 0:00:31
      501500 -- (-535.259) (-534.276) (-533.433) [-530.618] * (-533.497) (-532.632) (-531.511) [-534.222] -- 0:00:31
      502000 -- (-537.103) [-533.751] (-534.445) (-533.571) * (-534.236) (-535.059) (-530.899) [-534.571] -- 0:00:31
      502500 -- (-536.220) [-532.101] (-532.050) (-533.948) * (-536.482) (-536.598) [-533.510] (-535.967) -- 0:00:31
      503000 -- [-530.604] (-535.370) (-534.737) (-534.496) * (-535.684) [-535.708] (-532.383) (-536.721) -- 0:00:31
      503500 -- (-532.437) (-532.511) (-533.976) [-530.100] * (-534.701) (-533.285) [-534.404] (-531.798) -- 0:00:31
      504000 -- (-531.878) (-540.190) [-534.015] (-533.956) * (-533.300) (-532.335) [-532.063] (-533.871) -- 0:00:31
      504500 -- [-532.392] (-535.073) (-536.135) (-531.373) * [-535.412] (-532.418) (-533.720) (-535.668) -- 0:00:31
      505000 -- (-533.666) (-536.366) (-532.572) [-531.059] * [-536.575] (-532.414) (-532.162) (-535.684) -- 0:00:31

      Average standard deviation of split frequencies: 0.010403

      505500 -- [-534.127] (-538.024) (-532.816) (-533.641) * (-532.906) [-532.511] (-534.954) (-534.532) -- 0:00:31
      506000 -- (-533.459) (-533.325) (-534.731) [-533.009] * (-534.884) [-533.461] (-535.052) (-533.940) -- 0:00:31
      506500 -- [-531.727] (-537.605) (-532.926) (-533.252) * (-538.550) [-534.487] (-532.277) (-534.663) -- 0:00:31
      507000 -- [-532.390] (-536.953) (-532.801) (-534.502) * (-533.219) (-533.383) [-534.806] (-534.882) -- 0:00:31
      507500 -- (-533.311) (-537.112) (-532.099) [-532.817] * [-532.883] (-533.009) (-532.485) (-532.089) -- 0:00:31
      508000 -- (-533.430) (-537.921) [-533.158] (-533.604) * (-532.340) (-536.265) [-532.462] (-533.320) -- 0:00:30
      508500 -- (-531.815) (-534.266) [-532.910] (-532.472) * (-531.709) [-532.685] (-532.073) (-534.393) -- 0:00:30
      509000 -- (-534.308) (-534.201) [-533.787] (-533.002) * (-532.654) [-532.857] (-533.767) (-535.803) -- 0:00:30
      509500 -- (-534.269) (-538.719) (-533.681) [-532.932] * (-533.340) (-533.316) (-532.950) [-535.845] -- 0:00:30
      510000 -- (-533.564) (-533.549) [-532.822] (-532.443) * (-532.658) [-532.687] (-532.503) (-532.863) -- 0:00:30

      Average standard deviation of split frequencies: 0.009448

      510500 -- (-533.347) (-535.414) (-533.717) [-533.643] * [-533.041] (-532.571) (-534.912) (-540.498) -- 0:00:30
      511000 -- [-533.522] (-534.998) (-535.093) (-533.419) * (-531.879) (-533.297) [-532.214] (-533.803) -- 0:00:30
      511500 -- (-533.422) (-530.759) [-536.120] (-533.923) * (-536.042) (-532.200) [-535.022] (-532.936) -- 0:00:30
      512000 -- [-531.818] (-534.265) (-534.001) (-533.072) * [-531.807] (-535.290) (-533.939) (-534.458) -- 0:00:30
      512500 -- [-535.076] (-535.192) (-532.753) (-532.267) * (-534.116) [-535.771] (-533.501) (-535.082) -- 0:00:30
      513000 -- (-534.401) [-532.892] (-533.656) (-533.157) * (-533.133) (-531.837) [-531.541] (-533.766) -- 0:00:30
      513500 -- (-535.063) (-538.880) (-534.904) [-533.500] * [-534.128] (-533.102) (-531.409) (-532.738) -- 0:00:30
      514000 -- (-535.250) (-532.718) [-532.729] (-536.161) * (-532.020) [-532.853] (-531.885) (-531.794) -- 0:00:30
      514500 -- (-533.273) [-535.204] (-536.963) (-533.537) * (-533.868) (-529.880) (-531.306) [-532.638] -- 0:00:30
      515000 -- [-532.729] (-532.796) (-535.883) (-532.378) * (-532.600) [-532.155] (-537.132) (-533.578) -- 0:00:30

      Average standard deviation of split frequencies: 0.010049

      515500 -- (-532.446) (-534.870) (-536.110) [-534.403] * (-530.583) (-532.662) [-534.741] (-535.561) -- 0:00:30
      516000 -- [-534.579] (-539.484) (-533.199) (-533.834) * (-533.384) (-532.124) [-533.800] (-533.211) -- 0:00:30
      516500 -- [-535.354] (-533.593) (-532.793) (-532.455) * (-533.166) (-532.050) (-534.828) [-531.202] -- 0:00:30
      517000 -- [-532.878] (-531.162) (-533.184) (-533.890) * (-533.842) (-531.400) (-540.623) [-533.016] -- 0:00:30
      517500 -- (-532.942) (-538.026) (-533.706) [-536.387] * (-531.761) (-534.010) (-536.413) [-532.957] -- 0:00:30
      518000 -- [-532.908] (-531.575) (-532.940) (-532.734) * [-531.749] (-535.319) (-534.793) (-538.822) -- 0:00:30
      518500 -- (-532.378) (-532.800) (-534.205) [-532.781] * (-532.838) [-533.292] (-535.457) (-535.624) -- 0:00:30
      519000 -- (-533.437) [-534.305] (-535.585) (-533.658) * (-536.020) (-532.558) [-533.885] (-537.058) -- 0:00:30
      519500 -- [-532.480] (-536.872) (-532.665) (-532.954) * (-535.697) (-531.955) [-532.852] (-536.683) -- 0:00:30
      520000 -- (-533.706) (-533.347) (-532.526) [-533.537] * (-532.394) [-531.765] (-532.879) (-534.619) -- 0:00:30

      Average standard deviation of split frequencies: 0.009557

      520500 -- (-532.122) [-533.680] (-533.915) (-532.563) * [-532.469] (-531.275) (-534.174) (-548.565) -- 0:00:30
      521000 -- (-531.650) (-533.277) (-534.934) [-534.161] * [-532.488] (-533.529) (-536.336) (-534.863) -- 0:00:30
      521500 -- (-531.296) (-535.101) (-533.451) [-533.753] * (-530.624) (-533.659) (-535.126) [-531.959] -- 0:00:30
      522000 -- [-533.230] (-533.504) (-534.646) (-533.056) * (-534.530) (-532.475) [-534.580] (-534.623) -- 0:00:30
      522500 -- [-533.700] (-534.246) (-533.149) (-536.051) * (-531.273) [-537.427] (-538.531) (-534.158) -- 0:00:30
      523000 -- (-535.495) [-533.915] (-534.377) (-535.495) * [-533.430] (-537.689) (-531.398) (-535.273) -- 0:00:30
      523500 -- (-536.518) (-532.079) [-532.038] (-532.886) * [-533.869] (-532.361) (-532.397) (-531.941) -- 0:00:30
      524000 -- (-533.036) [-532.839] (-532.852) (-533.089) * [-533.629] (-533.902) (-534.452) (-537.350) -- 0:00:29
      524500 -- (-533.879) [-532.343] (-533.983) (-534.469) * [-532.656] (-536.911) (-532.435) (-533.174) -- 0:00:29
      525000 -- (-537.422) (-532.326) (-532.707) [-532.727] * [-532.465] (-536.572) (-536.585) (-533.341) -- 0:00:29

      Average standard deviation of split frequencies: 0.009460

      525500 -- (-535.298) [-532.399] (-532.011) (-533.695) * (-534.142) [-533.859] (-535.300) (-532.835) -- 0:00:29
      526000 -- (-532.551) (-533.040) [-532.245] (-531.948) * (-534.971) (-535.907) [-535.892] (-530.552) -- 0:00:29
      526500 -- [-534.963] (-531.864) (-529.938) (-533.145) * [-533.206] (-534.032) (-535.544) (-532.976) -- 0:00:29
      527000 -- [-534.160] (-536.308) (-533.047) (-532.406) * (-533.580) (-535.747) [-533.299] (-534.593) -- 0:00:29
      527500 -- (-533.034) (-535.081) [-533.177] (-533.154) * (-535.276) (-534.068) [-532.650] (-536.766) -- 0:00:29
      528000 -- (-534.597) [-531.794] (-532.824) (-530.598) * (-533.726) (-533.219) (-532.835) [-533.737] -- 0:00:29
      528500 -- (-533.258) (-533.649) (-533.470) [-533.496] * (-533.834) (-533.587) [-532.327] (-534.124) -- 0:00:29
      529000 -- (-533.126) (-533.006) (-534.197) [-534.996] * [-534.117] (-530.453) (-531.962) (-534.658) -- 0:00:29
      529500 -- (-533.956) (-533.211) (-532.054) [-533.188] * (-536.007) (-535.651) (-532.295) [-530.225] -- 0:00:29
      530000 -- (-534.609) (-532.193) (-533.979) [-531.848] * (-532.069) (-532.707) (-534.897) [-530.274] -- 0:00:29

      Average standard deviation of split frequencies: 0.009821

      530500 -- (-532.375) (-533.924) [-533.778] (-533.030) * (-534.323) [-532.041] (-535.003) (-532.406) -- 0:00:29
      531000 -- (-532.516) [-534.076] (-534.586) (-534.673) * (-537.803) [-532.265] (-534.343) (-531.548) -- 0:00:29
      531500 -- (-536.096) (-532.819) (-533.938) [-536.562] * (-534.662) [-530.717] (-533.048) (-532.929) -- 0:00:29
      532000 -- [-536.408] (-532.021) (-533.600) (-532.732) * (-536.494) (-532.439) [-533.565] (-533.083) -- 0:00:29
      532500 -- (-537.818) (-535.582) [-534.838] (-532.257) * (-533.022) (-531.966) [-530.474] (-531.776) -- 0:00:29
      533000 -- (-537.461) (-534.254) (-533.535) [-530.982] * (-537.206) (-533.132) (-531.705) [-531.773] -- 0:00:29
      533500 -- [-536.330] (-533.589) (-538.833) (-535.230) * (-534.396) (-534.061) (-536.395) [-532.395] -- 0:00:29
      534000 -- (-535.423) (-533.303) (-536.606) [-535.201] * (-532.331) [-532.812] (-539.446) (-535.348) -- 0:00:29
      534500 -- (-538.985) [-534.718] (-533.735) (-535.021) * (-530.707) [-531.655] (-532.887) (-533.898) -- 0:00:29
      535000 -- [-533.016] (-537.500) (-533.530) (-532.690) * (-531.867) (-532.803) (-532.166) [-535.147] -- 0:00:29

      Average standard deviation of split frequencies: 0.009919

      535500 -- (-533.579) (-533.647) [-534.172] (-531.865) * [-533.287] (-533.578) (-533.895) (-532.339) -- 0:00:29
      536000 -- [-535.757] (-532.350) (-541.733) (-534.818) * (-532.534) [-531.821] (-536.602) (-532.986) -- 0:00:29
      536500 -- (-532.475) (-533.817) [-532.018] (-532.199) * (-531.207) (-532.012) (-532.858) [-531.815] -- 0:00:29
      537000 -- (-534.548) (-534.707) [-533.065] (-531.466) * (-534.127) [-534.055] (-534.476) (-534.495) -- 0:00:29
      537500 -- (-536.084) (-536.419) (-532.220) [-533.978] * [-532.509] (-533.139) (-534.476) (-533.845) -- 0:00:29
      538000 -- (-533.931) [-538.523] (-534.151) (-533.685) * [-532.590] (-532.395) (-533.036) (-533.926) -- 0:00:29
      538500 -- (-537.349) (-534.276) (-537.359) [-531.593] * [-534.541] (-530.341) (-532.313) (-536.496) -- 0:00:29
      539000 -- (-535.575) (-533.759) (-533.984) [-532.789] * (-534.850) (-534.037) [-535.284] (-535.411) -- 0:00:29
      539500 -- (-535.225) (-532.861) [-533.672] (-535.317) * (-536.877) (-532.939) (-533.308) [-533.000] -- 0:00:29
      540000 -- (-533.847) (-532.118) (-532.729) [-533.669] * (-533.913) [-532.028] (-532.101) (-533.547) -- 0:00:28

      Average standard deviation of split frequencies: 0.009785

      540500 -- (-537.088) [-531.310] (-530.446) (-532.242) * (-532.630) (-536.217) (-531.447) [-534.057] -- 0:00:28
      541000 -- [-534.398] (-533.215) (-530.577) (-534.196) * (-532.546) (-532.294) (-538.726) [-536.617] -- 0:00:28
      541500 -- (-533.565) (-534.884) (-531.365) [-531.512] * (-535.098) (-532.018) [-534.181] (-532.070) -- 0:00:28
      542000 -- [-533.291] (-534.347) (-531.134) (-532.277) * (-535.313) (-535.327) (-534.234) [-533.974] -- 0:00:28
      542500 -- (-533.200) [-533.131] (-532.578) (-531.681) * (-534.543) (-534.985) [-533.091] (-537.011) -- 0:00:28
      543000 -- (-532.911) (-534.356) (-533.017) [-532.654] * (-534.088) [-531.579] (-533.731) (-536.922) -- 0:00:28
      543500 -- (-537.548) (-535.658) (-536.702) [-531.642] * (-532.926) [-531.198] (-534.631) (-535.082) -- 0:00:28
      544000 -- (-536.533) [-532.692] (-532.067) (-534.867) * (-532.794) [-531.582] (-532.214) (-533.207) -- 0:00:28
      544500 -- (-535.110) (-533.761) (-535.587) [-532.992] * (-533.083) [-537.384] (-537.130) (-536.152) -- 0:00:28
      545000 -- (-534.125) (-534.754) (-536.871) [-534.660] * (-533.516) (-532.886) [-532.569] (-533.401) -- 0:00:28

      Average standard deviation of split frequencies: 0.009305

      545500 -- (-536.583) [-532.850] (-533.890) (-533.564) * [-533.770] (-531.787) (-532.189) (-535.817) -- 0:00:28
      546000 -- (-533.005) (-532.648) (-532.754) [-533.794] * (-534.528) (-533.621) (-532.382) [-533.897] -- 0:00:28
      546500 -- (-533.535) (-532.584) (-531.879) [-532.665] * (-537.183) (-534.564) [-530.417] (-534.058) -- 0:00:28
      547000 -- (-533.588) [-535.637] (-533.015) (-536.567) * (-536.385) [-531.932] (-532.071) (-532.423) -- 0:00:28
      547500 -- [-532.513] (-532.688) (-535.675) (-533.197) * [-533.273] (-531.101) (-530.131) (-533.257) -- 0:00:28
      548000 -- (-536.660) (-532.635) [-540.186] (-533.404) * (-534.212) (-533.520) [-532.424] (-533.791) -- 0:00:28
      548500 -- (-533.502) (-534.169) (-535.603) [-534.858] * (-533.437) (-533.371) [-532.350] (-532.551) -- 0:00:28
      549000 -- [-532.114] (-531.568) (-531.445) (-533.932) * (-532.009) (-535.528) (-532.947) [-531.182] -- 0:00:28
      549500 -- (-535.513) [-533.982] (-532.539) (-537.111) * (-532.009) [-533.932] (-532.882) (-532.252) -- 0:00:28
      550000 -- (-531.997) [-533.624] (-535.220) (-532.595) * (-533.702) (-537.042) [-531.196] (-535.631) -- 0:00:28

      Average standard deviation of split frequencies: 0.009369

      550500 -- (-530.744) (-532.969) [-534.932] (-532.860) * (-535.621) (-533.023) [-533.165] (-537.894) -- 0:00:28
      551000 -- [-534.226] (-533.421) (-535.050) (-533.675) * (-535.457) [-533.532] (-532.079) (-531.081) -- 0:00:28
      551500 -- [-535.156] (-533.438) (-540.820) (-532.278) * (-535.174) (-534.467) (-532.816) [-534.529] -- 0:00:28
      552000 -- (-534.443) [-533.057] (-533.645) (-538.608) * [-533.028] (-533.585) (-533.007) (-535.592) -- 0:00:28
      552500 -- [-532.861] (-535.124) (-532.963) (-531.817) * (-534.563) [-531.269] (-533.131) (-534.134) -- 0:00:28
      553000 -- [-530.789] (-532.940) (-533.926) (-537.953) * (-531.944) [-532.136] (-534.033) (-533.996) -- 0:00:28
      553500 -- (-533.414) [-531.869] (-532.773) (-538.027) * [-535.200] (-533.117) (-532.750) (-535.658) -- 0:00:28
      554000 -- (-540.341) [-531.544] (-536.192) (-532.054) * (-537.780) (-533.750) (-534.518) [-531.964] -- 0:00:28
      554500 -- (-535.493) [-534.810] (-533.192) (-534.385) * [-532.442] (-533.581) (-531.821) (-534.433) -- 0:00:28
      555000 -- [-532.680] (-534.685) (-532.755) (-534.506) * (-533.020) (-534.186) (-531.456) [-533.069] -- 0:00:28

      Average standard deviation of split frequencies: 0.009373

      555500 -- (-532.805) (-532.941) (-535.586) [-535.839] * [-533.879] (-533.950) (-534.732) (-534.863) -- 0:00:28
      556000 -- (-533.589) [-536.923] (-535.060) (-534.514) * (-535.209) (-535.700) [-532.538] (-535.461) -- 0:00:27
      556500 -- (-534.120) (-531.592) (-535.007) [-532.521] * (-531.459) [-535.691] (-533.852) (-535.931) -- 0:00:27
      557000 -- (-533.971) (-532.482) [-533.324] (-532.850) * (-532.475) (-534.054) (-533.758) [-535.274] -- 0:00:27
      557500 -- (-534.408) (-533.796) [-533.430] (-534.626) * (-534.202) [-532.993] (-533.263) (-534.092) -- 0:00:27
      558000 -- (-531.806) (-534.180) [-533.734] (-533.403) * (-533.789) (-533.852) [-535.988] (-533.234) -- 0:00:27
      558500 -- (-534.336) (-532.291) (-532.009) [-538.315] * [-532.797] (-535.144) (-539.942) (-533.991) -- 0:00:27
      559000 -- (-532.438) (-533.710) (-533.552) [-533.117] * (-533.254) (-536.857) [-536.640] (-532.999) -- 0:00:27
      559500 -- [-532.168] (-533.056) (-530.732) (-537.414) * (-532.892) (-534.006) (-532.640) [-532.641] -- 0:00:27
      560000 -- (-532.166) (-533.617) [-531.120] (-533.128) * (-533.632) (-536.372) (-532.556) [-532.389] -- 0:00:27

      Average standard deviation of split frequencies: 0.009199

      560500 -- (-533.563) [-532.075] (-532.336) (-534.965) * (-536.325) (-532.736) (-536.648) [-531.904] -- 0:00:27
      561000 -- [-532.980] (-532.408) (-534.237) (-533.839) * (-531.659) (-534.554) (-533.922) [-533.921] -- 0:00:27
      561500 -- (-533.090) (-534.550) (-533.133) [-533.345] * (-531.922) (-534.110) [-530.351] (-536.052) -- 0:00:27
      562000 -- [-534.824] (-533.015) (-535.311) (-535.499) * (-534.740) (-533.021) (-531.119) [-531.942] -- 0:00:27
      562500 -- (-533.531) (-535.400) (-534.577) [-533.944] * (-533.968) [-532.667] (-533.400) (-537.279) -- 0:00:27
      563000 -- [-534.996] (-534.389) (-531.021) (-533.917) * [-534.462] (-533.206) (-535.355) (-532.913) -- 0:00:27
      563500 -- [-532.588] (-533.580) (-533.429) (-531.752) * [-534.650] (-535.211) (-530.349) (-534.378) -- 0:00:27
      564000 -- [-538.288] (-533.265) (-534.281) (-532.996) * (-533.473) (-534.038) [-535.434] (-533.045) -- 0:00:27
      564500 -- (-539.610) (-531.684) [-536.292] (-534.376) * (-535.262) (-533.117) (-534.337) [-533.558] -- 0:00:27
      565000 -- (-537.518) (-532.976) (-532.593) [-533.378] * (-538.944) (-531.869) [-530.607] (-535.717) -- 0:00:27

      Average standard deviation of split frequencies: 0.009358

      565500 -- (-533.801) (-537.054) [-532.060] (-532.693) * [-536.065] (-537.219) (-532.694) (-534.069) -- 0:00:27
      566000 -- [-532.241] (-531.101) (-533.592) (-534.164) * (-534.412) (-537.502) [-531.620] (-532.777) -- 0:00:27
      566500 -- (-538.256) [-531.572] (-533.008) (-538.372) * [-533.072] (-534.015) (-534.084) (-532.751) -- 0:00:27
      567000 -- (-535.169) (-533.483) [-531.536] (-532.416) * [-532.850] (-533.011) (-533.066) (-534.412) -- 0:00:27
      567500 -- (-534.292) (-530.989) (-532.679) [-530.721] * (-532.976) (-534.445) [-532.813] (-534.442) -- 0:00:27
      568000 -- (-532.673) [-531.636] (-536.078) (-531.885) * (-534.583) (-537.262) [-531.457] (-533.756) -- 0:00:27
      568500 -- [-534.291] (-531.417) (-531.107) (-536.989) * (-535.466) [-533.296] (-531.756) (-533.418) -- 0:00:27
      569000 -- [-535.866] (-532.023) (-533.240) (-534.065) * [-533.681] (-534.052) (-533.188) (-537.067) -- 0:00:27
      569500 -- [-535.903] (-532.743) (-532.649) (-533.719) * (-534.131) (-536.697) [-531.106] (-534.095) -- 0:00:27
      570000 -- [-530.594] (-532.604) (-532.515) (-532.143) * (-532.540) (-534.112) (-533.574) [-537.703] -- 0:00:27

      Average standard deviation of split frequencies: 0.009378

      570500 -- [-533.135] (-536.079) (-535.817) (-531.064) * [-536.902] (-534.694) (-530.356) (-534.024) -- 0:00:27
      571000 -- (-532.502) [-537.829] (-537.093) (-533.666) * [-531.668] (-534.613) (-533.652) (-531.003) -- 0:00:27
      571500 -- (-532.419) [-532.791] (-532.084) (-536.173) * (-532.072) (-535.006) [-534.138] (-532.864) -- 0:00:26
      572000 -- [-532.648] (-532.752) (-541.160) (-530.925) * (-532.532) (-534.738) (-532.501) [-534.266] -- 0:00:26
      572500 -- (-534.268) [-533.246] (-533.180) (-532.357) * (-532.533) (-534.217) (-533.834) [-533.875] -- 0:00:26
      573000 -- (-532.889) (-536.523) (-531.815) [-533.900] * (-535.188) (-533.491) [-532.983] (-532.983) -- 0:00:26
      573500 -- [-532.308] (-535.462) (-533.528) (-535.026) * (-532.888) (-533.859) [-533.154] (-531.030) -- 0:00:26
      574000 -- (-537.224) [-531.638] (-532.889) (-533.049) * [-532.618] (-536.284) (-533.973) (-532.290) -- 0:00:26
      574500 -- (-535.728) (-532.949) (-534.201) [-532.728] * (-532.880) (-532.617) [-534.843] (-532.101) -- 0:00:26
      575000 -- (-534.212) (-531.631) (-538.449) [-531.268] * (-535.858) (-532.034) (-532.588) [-530.343] -- 0:00:26

      Average standard deviation of split frequencies: 0.009243

      575500 -- [-535.053] (-531.497) (-533.307) (-531.635) * (-532.242) [-535.135] (-535.866) (-531.253) -- 0:00:26
      576000 -- (-536.282) (-532.737) (-532.189) [-531.352] * (-533.072) (-533.723) [-535.344] (-532.959) -- 0:00:26
      576500 -- (-533.661) (-533.443) (-533.186) [-533.402] * (-533.512) (-532.252) [-532.438] (-532.622) -- 0:00:26
      577000 -- (-532.834) [-533.121] (-538.718) (-537.566) * (-532.581) (-532.734) [-533.712] (-533.479) -- 0:00:26
      577500 -- [-535.404] (-534.893) (-542.636) (-536.230) * (-532.309) (-532.312) (-533.549) [-533.070] -- 0:00:26
      578000 -- (-539.240) (-533.941) [-531.890] (-530.910) * (-532.256) (-532.023) (-531.581) [-533.449] -- 0:00:26
      578500 -- (-532.744) (-532.187) (-533.381) [-534.208] * (-533.089) [-529.751] (-531.476) (-532.876) -- 0:00:26
      579000 -- (-537.027) (-532.644) (-535.161) [-535.518] * (-532.988) [-533.282] (-533.387) (-530.456) -- 0:00:26
      579500 -- (-532.649) (-537.442) [-533.376] (-535.325) * (-531.694) (-529.777) [-533.715] (-532.899) -- 0:00:26
      580000 -- (-536.632) (-532.280) (-534.125) [-530.815] * (-540.474) (-530.818) [-533.537] (-534.513) -- 0:00:26

      Average standard deviation of split frequencies: 0.009838

      580500 -- (-534.490) (-534.575) [-532.695] (-532.933) * [-539.282] (-537.028) (-538.101) (-533.405) -- 0:00:26
      581000 -- (-534.970) (-533.380) [-533.456] (-532.518) * (-536.185) (-536.766) [-531.400] (-532.556) -- 0:00:26
      581500 -- [-532.325] (-533.350) (-532.483) (-534.755) * (-533.276) (-533.645) [-532.082] (-531.540) -- 0:00:26
      582000 -- [-533.200] (-533.726) (-532.957) (-533.371) * [-534.114] (-532.205) (-534.884) (-532.062) -- 0:00:26
      582500 -- (-533.309) [-534.974] (-534.402) (-531.665) * (-536.154) (-533.307) (-534.763) [-531.586] -- 0:00:26
      583000 -- (-533.706) (-534.331) [-535.623] (-532.342) * (-534.381) (-534.715) [-531.854] (-536.123) -- 0:00:26
      583500 -- (-533.318) (-533.083) (-533.657) [-530.415] * [-531.840] (-533.483) (-534.848) (-533.257) -- 0:00:26
      584000 -- (-532.832) (-533.064) [-531.961] (-532.128) * [-533.655] (-537.227) (-532.516) (-533.000) -- 0:00:26
      584500 -- (-531.853) (-533.506) (-531.144) [-532.279] * [-535.863] (-536.964) (-535.036) (-535.022) -- 0:00:26
      585000 -- (-533.172) (-537.268) (-532.292) [-533.949] * (-532.174) (-533.897) (-534.641) [-533.224] -- 0:00:26

      Average standard deviation of split frequencies: 0.010268

      585500 -- [-538.437] (-537.880) (-533.188) (-532.176) * [-533.825] (-532.074) (-535.495) (-533.352) -- 0:00:26
      586000 -- (-531.313) (-538.180) (-533.391) [-531.992] * (-534.066) (-532.445) [-533.358] (-535.317) -- 0:00:26
      586500 -- [-533.833] (-537.655) (-533.265) (-532.470) * (-533.595) [-532.642] (-534.611) (-535.174) -- 0:00:26
      587000 -- [-533.354] (-533.028) (-532.168) (-531.435) * (-532.225) [-531.322] (-532.485) (-535.513) -- 0:00:26
      587500 -- (-531.818) (-533.074) [-532.372] (-531.020) * (-532.712) (-531.801) (-534.965) [-537.925] -- 0:00:25
      588000 -- (-536.761) (-533.236) [-533.851] (-533.682) * (-537.634) (-531.995) [-531.999] (-534.535) -- 0:00:25
      588500 -- [-534.988] (-535.510) (-530.976) (-532.318) * (-535.396) [-534.233] (-534.010) (-532.478) -- 0:00:25
      589000 -- (-535.064) [-532.676] (-532.547) (-533.705) * (-533.056) (-534.773) (-534.337) [-532.681] -- 0:00:25
      589500 -- [-535.661] (-533.224) (-531.929) (-530.743) * (-534.373) (-535.731) [-532.997] (-535.270) -- 0:00:25
      590000 -- (-533.450) (-532.638) (-530.210) [-532.530] * (-534.567) (-532.276) (-535.398) [-532.682] -- 0:00:25

      Average standard deviation of split frequencies: 0.010140

      590500 -- [-531.703] (-534.553) (-535.429) (-532.305) * (-533.384) (-531.786) [-536.340] (-534.114) -- 0:00:25
      591000 -- (-530.938) [-534.776] (-533.048) (-533.532) * [-533.299] (-534.313) (-536.444) (-530.246) -- 0:00:25
      591500 -- (-534.428) (-536.798) [-535.746] (-532.225) * (-534.705) [-532.771] (-534.735) (-535.093) -- 0:00:25
      592000 -- (-534.581) (-535.631) [-531.481] (-533.241) * (-532.527) (-532.310) [-539.989] (-534.436) -- 0:00:25
      592500 -- (-533.778) (-536.963) (-535.742) [-531.606] * (-532.752) (-535.384) (-536.752) [-533.538] -- 0:00:25
      593000 -- [-533.606] (-537.136) (-534.862) (-531.963) * [-534.962] (-533.299) (-533.353) (-532.047) -- 0:00:25
      593500 -- [-529.984] (-535.675) (-533.741) (-533.914) * (-538.229) (-531.066) [-534.146] (-531.860) -- 0:00:25
      594000 -- [-533.752] (-544.172) (-534.540) (-535.689) * [-532.329] (-534.599) (-537.431) (-532.413) -- 0:00:25
      594500 -- (-530.740) (-535.579) [-534.207] (-530.975) * (-534.398) [-532.938] (-535.091) (-532.636) -- 0:00:25
      595000 -- (-534.265) (-535.813) (-536.879) [-533.540] * (-535.284) [-530.793] (-532.449) (-533.404) -- 0:00:25

      Average standard deviation of split frequencies: 0.009305

      595500 -- (-532.481) [-539.372] (-536.435) (-534.640) * (-532.993) (-534.898) [-534.580] (-536.233) -- 0:00:25
      596000 -- (-532.265) [-533.366] (-534.434) (-531.869) * [-532.668] (-534.536) (-535.141) (-535.404) -- 0:00:25
      596500 -- (-533.279) (-530.640) (-536.154) [-532.259] * (-533.445) [-534.868] (-532.365) (-535.972) -- 0:00:25
      597000 -- [-532.935] (-534.658) (-536.082) (-533.157) * (-535.565) (-532.444) [-531.821] (-532.352) -- 0:00:25
      597500 -- (-533.749) (-537.032) (-537.191) [-532.192] * (-533.413) (-535.749) (-534.314) [-532.877] -- 0:00:25
      598000 -- (-532.494) [-532.767] (-533.123) (-532.757) * (-534.866) (-532.674) (-531.864) [-535.047] -- 0:00:25
      598500 -- (-533.028) (-532.170) [-533.730] (-535.521) * (-534.991) (-532.252) (-535.081) [-532.314] -- 0:00:25
      599000 -- (-530.879) (-533.516) [-534.612] (-534.442) * (-533.428) (-529.905) [-536.789] (-531.967) -- 0:00:25
      599500 -- [-533.670] (-534.102) (-534.161) (-533.780) * (-533.299) (-532.266) [-531.001] (-532.707) -- 0:00:25
      600000 -- (-534.910) [-534.521] (-532.722) (-533.364) * (-532.616) (-532.766) [-532.995] (-534.103) -- 0:00:25

      Average standard deviation of split frequencies: 0.009371

      600500 -- [-530.937] (-539.826) (-534.150) (-532.114) * [-535.954] (-534.051) (-535.710) (-534.294) -- 0:00:25
      601000 -- [-533.111] (-536.954) (-532.532) (-531.595) * (-535.474) [-532.577] (-532.378) (-533.781) -- 0:00:25
      601500 -- (-532.700) (-534.449) (-533.063) [-533.365] * (-531.691) [-532.811] (-532.949) (-532.928) -- 0:00:25
      602000 -- [-531.592] (-532.320) (-532.439) (-536.750) * (-531.889) (-532.363) [-532.797] (-533.857) -- 0:00:25
      602500 -- [-530.999] (-534.234) (-535.584) (-538.406) * (-532.232) (-533.287) [-533.060] (-531.427) -- 0:00:25
      603000 -- (-531.001) (-533.514) [-531.185] (-536.749) * (-538.906) (-532.701) (-535.749) [-536.320] -- 0:00:25
      603500 -- (-530.938) (-532.496) (-532.666) [-532.500] * (-531.598) (-532.898) [-531.911] (-533.685) -- 0:00:24
      604000 -- (-532.947) [-531.119] (-533.488) (-533.347) * (-532.348) [-530.699] (-533.036) (-532.581) -- 0:00:24
      604500 -- (-533.367) (-533.372) [-535.389] (-535.606) * (-530.093) (-533.239) [-532.246] (-532.464) -- 0:00:24
      605000 -- [-531.199] (-532.930) (-533.986) (-535.103) * (-538.297) (-532.020) (-534.688) [-531.103] -- 0:00:24

      Average standard deviation of split frequencies: 0.009655

      605500 -- (-535.299) [-531.866] (-533.279) (-531.794) * (-535.845) (-531.730) (-534.581) [-531.034] -- 0:00:24
      606000 -- [-531.944] (-536.536) (-535.016) (-534.469) * (-534.989) [-530.095] (-535.125) (-534.945) -- 0:00:24
      606500 -- (-530.336) [-531.262] (-533.674) (-533.362) * (-535.528) [-535.460] (-533.681) (-532.798) -- 0:00:24
      607000 -- [-532.040] (-531.933) (-532.025) (-532.751) * (-536.865) [-533.234] (-532.942) (-533.216) -- 0:00:24
      607500 -- [-532.367] (-531.287) (-534.665) (-536.996) * (-534.009) [-535.743] (-530.179) (-532.475) -- 0:00:24
      608000 -- (-534.713) (-531.747) (-534.748) [-532.352] * (-532.567) (-531.554) (-530.166) [-531.726] -- 0:00:24
      608500 -- [-532.071] (-532.767) (-533.164) (-532.414) * (-537.809) (-536.417) (-531.719) [-533.752] -- 0:00:24
      609000 -- (-536.734) [-534.234] (-535.002) (-535.121) * (-537.196) (-532.501) [-532.593] (-530.710) -- 0:00:24
      609500 -- (-531.574) (-534.750) (-532.998) [-533.143] * (-533.270) (-534.286) (-534.793) [-535.631] -- 0:00:24
      610000 -- (-533.058) [-530.928] (-533.390) (-534.070) * [-531.288] (-532.469) (-533.435) (-534.819) -- 0:00:24

      Average standard deviation of split frequencies: 0.009854

      610500 -- [-532.950] (-532.291) (-541.012) (-533.046) * (-532.788) (-534.803) (-532.346) [-532.136] -- 0:00:24
      611000 -- (-531.384) [-531.063] (-534.752) (-532.000) * [-532.567] (-535.302) (-534.592) (-532.886) -- 0:00:24
      611500 -- (-532.429) (-534.894) (-532.355) [-533.376] * (-533.206) [-533.876] (-533.435) (-534.437) -- 0:00:24
      612000 -- (-536.193) (-532.257) [-534.532] (-537.922) * (-533.156) (-535.978) [-532.227] (-534.404) -- 0:00:24
      612500 -- (-530.266) (-533.323) (-533.073) [-533.911] * (-533.583) (-532.387) (-534.635) [-535.426] -- 0:00:24
      613000 -- (-531.984) [-531.939] (-535.539) (-534.395) * [-534.437] (-537.959) (-532.528) (-531.791) -- 0:00:24
      613500 -- [-532.134] (-535.275) (-533.383) (-532.055) * (-534.641) (-536.654) (-532.932) [-533.721] -- 0:00:24
      614000 -- (-534.487) (-534.320) (-534.031) [-534.757] * (-531.296) (-535.301) (-537.534) [-531.649] -- 0:00:24
      614500 -- (-536.240) (-532.765) [-532.337] (-532.903) * (-535.937) (-533.286) (-532.801) [-534.723] -- 0:00:24
      615000 -- (-536.898) (-531.517) (-534.493) [-532.900] * (-532.871) (-532.918) (-532.262) [-535.658] -- 0:00:24

      Average standard deviation of split frequencies: 0.009318

      615500 -- (-533.731) [-531.064] (-536.572) (-536.539) * [-532.134] (-533.084) (-534.090) (-535.278) -- 0:00:24
      616000 -- (-533.801) (-532.824) (-532.508) [-535.414] * (-533.560) [-532.972] (-532.269) (-542.374) -- 0:00:24
      616500 -- [-533.554] (-533.263) (-532.999) (-533.347) * (-533.368) (-532.258) (-530.958) [-533.341] -- 0:00:24
      617000 -- (-533.267) (-533.112) [-530.884] (-531.796) * (-535.478) (-532.762) [-537.208] (-531.147) -- 0:00:24
      617500 -- (-534.817) [-532.425] (-532.984) (-532.736) * (-534.566) (-531.720) (-534.701) [-532.163] -- 0:00:24
      618000 -- [-533.870] (-532.516) (-533.334) (-531.631) * (-535.045) (-531.247) (-536.404) [-530.867] -- 0:00:24
      618500 -- (-533.311) [-534.857] (-530.708) (-531.776) * (-535.347) (-537.414) [-530.853] (-533.914) -- 0:00:24
      619000 -- (-532.569) (-538.657) (-532.936) [-533.719] * [-534.065] (-534.016) (-536.275) (-535.512) -- 0:00:24
      619500 -- [-533.794] (-535.301) (-532.627) (-534.335) * [-532.008] (-532.030) (-535.688) (-535.251) -- 0:00:23
      620000 -- (-536.808) (-535.354) [-534.759] (-531.914) * (-534.977) (-535.146) [-535.867] (-534.411) -- 0:00:23

      Average standard deviation of split frequencies: 0.009159

      620500 -- (-536.885) (-535.822) [-532.324] (-532.581) * [-533.011] (-532.633) (-533.866) (-535.864) -- 0:00:23
      621000 -- (-532.997) [-533.499] (-533.344) (-533.194) * (-533.204) (-531.667) (-532.502) [-532.578] -- 0:00:23
      621500 -- (-534.719) [-536.200] (-535.730) (-532.142) * (-533.053) [-531.349] (-534.081) (-532.935) -- 0:00:23
      622000 -- [-532.430] (-534.607) (-533.846) (-532.543) * (-534.263) (-535.008) [-530.368] (-536.372) -- 0:00:23
      622500 -- (-533.465) (-531.889) (-532.457) [-532.323] * (-536.188) [-533.778] (-531.767) (-531.845) -- 0:00:23
      623000 -- (-532.191) (-534.841) (-533.006) [-532.619] * (-532.706) [-534.013] (-535.446) (-532.591) -- 0:00:23
      623500 -- (-533.869) (-533.604) [-533.972] (-531.393) * (-536.405) (-531.974) (-536.976) [-535.081] -- 0:00:23
      624000 -- (-535.559) [-533.199] (-532.427) (-534.245) * (-536.641) (-533.161) (-531.195) [-534.943] -- 0:00:23
      624500 -- [-535.223] (-535.407) (-536.740) (-534.490) * (-536.037) (-536.560) [-530.265] (-537.749) -- 0:00:23
      625000 -- (-532.690) [-532.432] (-536.173) (-532.293) * (-530.779) [-533.568] (-530.668) (-532.666) -- 0:00:23

      Average standard deviation of split frequencies: 0.009214

      625500 -- (-531.958) (-534.371) (-535.669) [-538.015] * (-534.830) (-534.355) [-533.292] (-536.608) -- 0:00:23
      626000 -- (-536.706) (-536.501) (-533.695) [-532.498] * (-532.543) [-533.049] (-530.970) (-533.915) -- 0:00:23
      626500 -- (-533.465) (-534.180) (-530.755) [-531.951] * (-534.987) (-536.335) (-532.856) [-533.642] -- 0:00:23
      627000 -- (-530.831) (-533.054) [-531.996] (-532.078) * (-532.694) [-532.706] (-531.979) (-530.653) -- 0:00:23
      627500 -- (-534.583) [-534.875] (-532.744) (-533.101) * (-534.854) (-532.402) (-531.013) [-533.218] -- 0:00:23
      628000 -- (-536.266) (-532.063) (-537.969) [-532.178] * (-534.408) (-531.991) [-530.866] (-532.866) -- 0:00:23
      628500 -- [-532.395] (-531.999) (-535.278) (-533.238) * (-534.483) (-533.906) (-535.509) [-534.568] -- 0:00:23
      629000 -- (-534.706) (-531.803) (-533.203) [-532.160] * (-534.430) (-533.936) (-531.123) [-533.915] -- 0:00:23
      629500 -- (-533.235) (-534.470) (-533.462) [-537.504] * (-533.096) (-532.364) (-532.959) [-532.124] -- 0:00:23
      630000 -- [-534.049] (-535.499) (-533.429) (-534.666) * (-535.153) [-535.116] (-532.179) (-531.922) -- 0:00:23

      Average standard deviation of split frequencies: 0.009102

      630500 -- (-533.122) (-532.975) (-531.664) [-531.269] * (-531.435) (-533.556) [-532.798] (-534.780) -- 0:00:23
      631000 -- (-535.541) [-533.928] (-532.680) (-533.013) * (-532.160) (-535.502) (-533.086) [-532.911] -- 0:00:23
      631500 -- (-533.387) (-534.824) [-533.344] (-532.983) * (-531.803) (-536.460) [-539.973] (-537.734) -- 0:00:23
      632000 -- [-532.777] (-536.701) (-532.102) (-535.304) * (-533.497) (-534.734) (-537.422) [-534.483] -- 0:00:23
      632500 -- [-532.136] (-533.878) (-532.356) (-536.394) * (-533.651) (-534.730) (-535.688) [-531.642] -- 0:00:23
      633000 -- [-531.369] (-533.504) (-533.899) (-535.935) * [-531.515] (-532.644) (-538.506) (-533.374) -- 0:00:23
      633500 -- (-530.348) (-534.135) [-533.831] (-533.397) * (-539.209) (-531.953) (-534.480) [-533.414] -- 0:00:23
      634000 -- [-532.599] (-533.727) (-532.899) (-539.653) * (-532.396) (-534.841) [-536.274] (-531.072) -- 0:00:23
      634500 -- (-532.215) (-535.099) [-533.459] (-532.106) * (-532.170) [-532.060] (-532.789) (-533.759) -- 0:00:23
      635000 -- (-534.919) (-532.507) [-532.113] (-531.704) * (-531.933) [-532.147] (-533.186) (-531.134) -- 0:00:22

      Average standard deviation of split frequencies: 0.009374

      635500 -- (-531.986) (-541.191) [-533.130] (-535.854) * (-532.138) (-533.667) (-535.710) [-530.416] -- 0:00:22
      636000 -- (-534.927) (-539.688) (-532.735) [-532.106] * (-532.893) (-534.919) [-531.161] (-532.734) -- 0:00:22
      636500 -- (-534.720) (-535.014) (-533.711) [-536.009] * (-538.042) (-534.217) (-533.347) [-534.286] -- 0:00:22
      637000 -- [-531.467] (-532.475) (-537.453) (-531.201) * (-530.720) (-532.278) (-534.250) [-531.367] -- 0:00:22
      637500 -- (-533.172) [-532.162] (-531.320) (-532.753) * (-532.402) [-531.414] (-535.091) (-530.257) -- 0:00:22
      638000 -- (-532.788) (-531.520) (-532.358) [-533.886] * (-532.955) (-535.887) [-537.660] (-531.938) -- 0:00:22
      638500 -- (-532.611) [-531.673] (-534.513) (-535.177) * (-532.155) [-535.486] (-535.759) (-531.066) -- 0:00:22
      639000 -- (-531.891) (-533.701) (-532.756) [-533.836] * (-535.980) (-535.239) (-537.105) [-530.505] -- 0:00:22
      639500 -- (-532.902) (-534.213) (-533.048) [-533.395] * (-535.786) (-532.724) (-536.584) [-532.481] -- 0:00:22
      640000 -- (-531.230) [-535.784] (-532.085) (-529.640) * (-538.759) [-532.425] (-536.021) (-532.549) -- 0:00:22

      Average standard deviation of split frequencies: 0.009565

      640500 -- (-530.856) (-531.383) [-532.862] (-533.283) * (-536.337) [-532.292] (-534.065) (-535.997) -- 0:00:22
      641000 -- (-533.699) [-534.106] (-532.933) (-535.104) * (-532.805) (-532.379) (-532.658) [-533.934] -- 0:00:22
      641500 -- [-531.976] (-536.738) (-531.030) (-535.795) * (-538.909) [-531.232] (-531.895) (-535.435) -- 0:00:22
      642000 -- (-531.401) (-541.003) (-533.604) [-537.189] * [-537.001] (-531.926) (-533.085) (-538.878) -- 0:00:22
      642500 -- (-532.467) (-534.837) [-535.652] (-530.603) * [-534.302] (-533.450) (-536.085) (-535.572) -- 0:00:22
      643000 -- (-534.219) (-534.235) (-531.160) [-532.959] * (-530.719) (-535.289) (-534.731) [-532.201] -- 0:00:22
      643500 -- (-531.795) (-532.409) (-533.981) [-532.820] * (-531.841) (-532.968) [-531.476] (-535.737) -- 0:00:22
      644000 -- (-534.326) [-531.923] (-532.681) (-534.765) * (-531.019) (-536.002) [-532.917] (-531.740) -- 0:00:22
      644500 -- [-533.133] (-533.794) (-531.646) (-532.314) * (-532.653) [-532.257] (-535.793) (-534.799) -- 0:00:22
      645000 -- (-532.076) [-532.407] (-531.822) (-533.717) * (-536.703) (-538.786) (-532.081) [-531.147] -- 0:00:22

      Average standard deviation of split frequencies: 0.009143

      645500 -- (-532.698) (-538.612) (-531.158) [-534.209] * (-534.031) [-533.248] (-534.292) (-532.747) -- 0:00:22
      646000 -- (-533.062) (-534.138) [-531.443] (-532.011) * (-533.198) (-534.038) (-535.784) [-533.610] -- 0:00:22
      646500 -- [-533.365] (-533.204) (-533.962) (-532.896) * (-534.773) (-538.082) (-535.596) [-534.593] -- 0:00:22
      647000 -- (-534.336) (-532.328) (-532.968) [-530.666] * [-531.288] (-532.645) (-532.533) (-534.502) -- 0:00:22
      647500 -- (-532.184) (-533.887) (-535.970) [-530.732] * (-537.966) [-530.665] (-533.959) (-535.018) -- 0:00:22
      648000 -- (-533.541) (-533.209) [-533.716] (-537.473) * [-530.674] (-531.935) (-531.669) (-532.803) -- 0:00:22
      648500 -- (-533.419) [-533.875] (-532.734) (-539.487) * (-535.973) (-531.001) (-533.361) [-534.258] -- 0:00:22
      649000 -- (-535.363) [-532.151] (-531.666) (-534.464) * (-536.280) [-533.808] (-536.866) (-531.304) -- 0:00:22
      649500 -- (-532.643) [-533.882] (-532.089) (-531.831) * (-535.471) [-536.495] (-536.097) (-532.775) -- 0:00:22
      650000 -- [-533.619] (-530.695) (-534.559) (-533.012) * (-532.707) (-532.093) [-533.354] (-534.767) -- 0:00:22

      Average standard deviation of split frequencies: 0.009418

      650500 -- [-533.966] (-533.018) (-533.961) (-531.265) * [-533.261] (-537.763) (-540.181) (-535.017) -- 0:00:22
      651000 -- (-536.825) (-532.523) (-533.566) [-532.403] * (-535.306) [-533.036] (-537.724) (-539.053) -- 0:00:21
      651500 -- (-534.791) (-532.826) (-540.478) [-533.150] * (-533.866) [-533.988] (-533.492) (-534.482) -- 0:00:21
      652000 -- (-533.035) (-532.532) [-534.742] (-535.304) * [-531.679] (-533.125) (-534.199) (-534.170) -- 0:00:21
      652500 -- [-530.705] (-535.398) (-532.120) (-534.133) * (-534.046) (-535.481) [-532.966] (-535.477) -- 0:00:21
      653000 -- [-530.872] (-533.800) (-530.259) (-534.264) * (-532.688) (-536.220) [-532.910] (-532.833) -- 0:00:21
      653500 -- (-533.360) [-533.956] (-533.446) (-530.570) * (-533.584) (-534.031) (-533.562) [-533.698] -- 0:00:21
      654000 -- (-530.449) (-533.952) (-531.863) [-532.313] * (-531.163) [-531.516] (-530.925) (-530.843) -- 0:00:21
      654500 -- [-531.255] (-530.123) (-533.350) (-532.640) * (-531.389) (-535.628) (-534.704) [-531.635] -- 0:00:21
      655000 -- (-532.110) (-532.217) (-534.474) [-532.462] * (-533.752) (-532.187) [-532.800] (-532.330) -- 0:00:21

      Average standard deviation of split frequencies: 0.009215

      655500 -- (-533.523) [-531.299] (-532.327) (-532.657) * [-533.320] (-532.027) (-535.703) (-532.766) -- 0:00:21
      656000 -- (-530.811) (-532.748) [-534.808] (-534.422) * (-533.141) (-532.306) [-531.807] (-532.737) -- 0:00:21
      656500 -- (-532.977) [-532.780] (-537.768) (-533.202) * (-534.481) (-532.543) (-531.739) [-535.212] -- 0:00:21
      657000 -- (-531.924) [-535.174] (-532.623) (-530.658) * (-531.828) (-531.803) (-533.007) [-532.541] -- 0:00:21
      657500 -- (-533.774) [-530.178] (-533.885) (-531.222) * [-534.838] (-535.308) (-534.391) (-534.096) -- 0:00:21
      658000 -- [-532.924] (-539.159) (-531.460) (-533.858) * (-530.802) (-532.222) (-537.876) [-531.601] -- 0:00:21
      658500 -- [-534.204] (-530.906) (-534.477) (-532.372) * [-531.805] (-536.027) (-535.222) (-536.240) -- 0:00:21
      659000 -- (-531.409) (-533.086) [-532.480] (-532.873) * (-532.271) (-536.119) [-532.591] (-534.124) -- 0:00:21
      659500 -- [-532.271] (-532.605) (-531.979) (-534.698) * (-533.039) (-530.822) (-531.334) [-532.403] -- 0:00:21
      660000 -- (-536.289) [-533.857] (-534.374) (-532.487) * [-531.047] (-534.913) (-533.009) (-535.131) -- 0:00:21

      Average standard deviation of split frequencies: 0.009360

      660500 -- [-530.434] (-535.197) (-533.406) (-531.743) * (-534.305) (-533.801) [-535.291] (-533.028) -- 0:00:21
      661000 -- (-532.601) (-538.098) (-534.099) [-536.743] * (-532.950) [-533.266] (-536.532) (-534.027) -- 0:00:21
      661500 -- (-532.086) (-532.708) [-531.511] (-533.525) * (-532.209) [-532.532] (-535.235) (-533.690) -- 0:00:21
      662000 -- [-531.450] (-532.778) (-532.120) (-532.279) * (-532.275) [-530.983] (-537.968) (-532.087) -- 0:00:21
      662500 -- (-531.080) (-532.136) [-532.920] (-533.313) * (-533.182) (-536.949) (-532.804) [-532.412] -- 0:00:21
      663000 -- [-531.666] (-536.341) (-533.244) (-533.498) * (-533.689) (-533.493) (-535.938) [-534.509] -- 0:00:21
      663500 -- (-534.571) (-534.593) (-531.946) [-531.537] * (-535.117) [-533.770] (-534.616) (-532.410) -- 0:00:21
      664000 -- [-531.288] (-533.050) (-535.022) (-531.556) * (-532.494) [-536.630] (-535.471) (-533.017) -- 0:00:21
      664500 -- (-533.185) [-532.961] (-533.535) (-534.528) * (-533.449) [-533.068] (-534.211) (-533.009) -- 0:00:21
      665000 -- (-533.952) [-532.447] (-533.358) (-534.831) * (-532.166) [-532.693] (-530.666) (-532.699) -- 0:00:21

      Average standard deviation of split frequencies: 0.009160

      665500 -- (-535.852) (-532.092) [-532.140] (-533.747) * (-532.848) [-533.016] (-536.857) (-534.773) -- 0:00:21
      666000 -- (-535.549) (-532.083) (-536.937) [-531.554] * (-533.671) (-535.639) (-534.747) [-534.208] -- 0:00:21
      666500 -- [-531.547] (-532.352) (-539.129) (-534.095) * (-534.187) (-532.088) [-533.609] (-531.650) -- 0:00:21
      667000 -- [-533.588] (-531.283) (-539.505) (-532.105) * [-532.017] (-531.645) (-535.548) (-532.167) -- 0:00:20
      667500 -- (-532.648) [-533.012] (-534.070) (-532.611) * (-533.005) [-530.537] (-530.985) (-531.073) -- 0:00:20
      668000 -- (-531.670) (-534.250) [-538.527] (-531.466) * (-533.058) (-534.189) (-538.993) [-531.569] -- 0:00:20
      668500 -- [-533.488] (-533.865) (-533.419) (-532.815) * (-536.115) (-534.153) (-538.435) [-532.864] -- 0:00:20
      669000 -- (-533.321) [-533.600] (-534.829) (-534.863) * (-541.229) (-533.050) [-533.895] (-538.623) -- 0:00:20
      669500 -- (-530.279) [-532.646] (-535.528) (-531.116) * (-533.868) (-532.951) [-538.782] (-534.816) -- 0:00:20
      670000 -- (-533.180) (-533.910) (-534.501) [-532.247] * (-532.452) (-533.041) [-533.635] (-535.605) -- 0:00:20

      Average standard deviation of split frequencies: 0.008931

      670500 -- (-533.337) (-535.171) [-534.027] (-530.846) * (-537.031) [-537.351] (-533.087) (-534.708) -- 0:00:20
      671000 -- (-533.518) [-536.295] (-532.482) (-535.172) * (-534.148) (-532.792) (-533.001) [-535.632] -- 0:00:20
      671500 -- (-533.225) (-535.324) [-532.176] (-531.969) * [-534.728] (-532.798) (-532.472) (-532.276) -- 0:00:20
      672000 -- (-533.719) [-531.211] (-538.777) (-536.611) * [-533.463] (-532.412) (-538.058) (-535.961) -- 0:00:20
      672500 -- [-531.910] (-534.572) (-533.310) (-535.666) * [-533.283] (-534.840) (-538.587) (-536.328) -- 0:00:20
      673000 -- (-534.552) [-534.485] (-533.150) (-531.180) * (-534.250) (-531.205) (-535.679) [-534.092] -- 0:00:20
      673500 -- [-532.465] (-536.893) (-536.364) (-533.073) * (-534.016) [-533.318] (-536.008) (-536.131) -- 0:00:20
      674000 -- [-533.450] (-532.947) (-534.355) (-531.284) * [-534.318] (-533.687) (-533.824) (-534.297) -- 0:00:20
      674500 -- (-533.106) (-537.388) [-535.373] (-532.116) * (-532.260) (-533.511) (-534.929) [-532.648] -- 0:00:20
      675000 -- [-532.707] (-533.212) (-534.006) (-532.586) * (-534.618) (-532.902) (-535.907) [-532.780] -- 0:00:20

      Average standard deviation of split frequencies: 0.008286

      675500 -- (-535.578) (-531.706) [-531.427] (-534.885) * (-536.841) (-534.726) (-534.682) [-531.802] -- 0:00:20
      676000 -- (-533.494) [-531.454] (-532.735) (-533.417) * (-531.982) (-534.119) (-535.156) [-532.551] -- 0:00:20
      676500 -- (-531.009) [-531.740] (-532.675) (-533.253) * [-533.714] (-534.261) (-533.723) (-531.840) -- 0:00:20
      677000 -- (-532.002) (-532.125) [-533.631] (-531.277) * (-532.151) (-532.526) [-532.390] (-536.377) -- 0:00:20
      677500 -- [-534.575] (-532.935) (-532.544) (-531.741) * (-537.048) (-537.527) (-532.160) [-534.272] -- 0:00:20
      678000 -- (-533.139) (-532.995) [-533.366] (-531.662) * [-536.196] (-533.334) (-534.017) (-534.297) -- 0:00:20
      678500 -- [-532.631] (-534.802) (-533.072) (-533.163) * (-534.647) (-534.058) (-532.948) [-536.926] -- 0:00:20
      679000 -- (-531.881) [-531.354] (-535.351) (-534.217) * (-533.960) (-532.742) [-533.894] (-537.772) -- 0:00:20
      679500 -- (-531.823) (-532.075) (-535.636) [-530.468] * (-534.457) (-534.239) [-533.055] (-535.120) -- 0:00:20
      680000 -- (-531.296) [-532.578] (-533.648) (-531.900) * [-532.309] (-534.341) (-532.905) (-532.681) -- 0:00:20

      Average standard deviation of split frequencies: 0.008270

      680500 -- [-532.358] (-532.486) (-534.425) (-532.537) * (-533.829) [-534.755] (-533.372) (-532.178) -- 0:00:20
      681000 -- (-532.742) [-531.941] (-533.616) (-532.856) * (-532.734) (-535.531) (-536.845) [-531.401] -- 0:00:20
      681500 -- (-531.997) [-534.427] (-534.792) (-536.299) * (-532.145) (-533.066) (-534.036) [-532.163] -- 0:00:20
      682000 -- (-534.142) (-531.838) [-535.062] (-531.669) * (-532.804) (-531.494) [-529.777] (-534.982) -- 0:00:20
      682500 -- (-533.194) [-530.899] (-535.210) (-532.029) * [-534.926] (-533.830) (-533.897) (-536.711) -- 0:00:20
      683000 -- (-534.589) [-535.644] (-533.807) (-533.214) * (-533.598) [-533.088] (-534.533) (-533.380) -- 0:00:19
      683500 -- (-530.902) [-532.128] (-536.349) (-534.742) * [-533.093] (-535.404) (-533.720) (-535.788) -- 0:00:19
      684000 -- [-531.894] (-532.991) (-536.231) (-533.876) * (-533.344) (-533.608) [-533.192] (-534.263) -- 0:00:19
      684500 -- [-531.017] (-533.151) (-536.011) (-537.249) * (-532.539) [-532.150] (-531.584) (-534.116) -- 0:00:19
      685000 -- [-534.082] (-534.721) (-534.882) (-535.733) * (-532.423) (-534.403) [-535.518] (-533.091) -- 0:00:19

      Average standard deviation of split frequencies: 0.008529

      685500 -- (-533.398) (-536.753) (-532.275) [-532.854] * (-532.722) (-533.153) (-536.275) [-533.527] -- 0:00:19
      686000 -- [-533.284] (-534.552) (-532.629) (-536.004) * (-535.147) (-531.631) [-534.478] (-530.971) -- 0:00:19
      686500 -- (-532.088) (-537.915) [-531.952] (-537.284) * (-536.723) (-533.373) (-532.612) [-535.246] -- 0:00:19
      687000 -- (-532.436) [-532.194] (-534.446) (-533.693) * [-532.687] (-533.861) (-533.867) (-534.234) -- 0:00:19
      687500 -- (-532.796) (-534.108) (-535.861) [-532.627] * (-535.917) (-537.691) (-533.388) [-533.750] -- 0:00:19
      688000 -- (-536.273) (-533.510) (-535.430) [-532.851] * (-534.600) (-534.831) (-532.085) [-534.312] -- 0:00:19
      688500 -- (-536.243) (-534.004) [-532.161] (-532.047) * (-539.900) (-531.260) [-533.159] (-532.835) -- 0:00:19
      689000 -- [-536.478] (-533.663) (-534.294) (-534.017) * (-538.837) [-532.892] (-532.512) (-532.719) -- 0:00:19
      689500 -- (-531.449) [-531.711] (-532.838) (-533.622) * (-535.717) (-532.540) (-536.364) [-534.023] -- 0:00:19
      690000 -- (-534.096) (-532.625) (-531.762) [-531.729] * (-532.358) (-531.657) (-536.639) [-532.514] -- 0:00:19

      Average standard deviation of split frequencies: 0.008712

      690500 -- (-532.567) (-532.233) (-532.216) [-533.925] * (-532.296) [-531.835] (-539.402) (-531.454) -- 0:00:19
      691000 -- (-532.537) [-531.508] (-533.599) (-531.831) * (-533.045) (-533.411) (-532.297) [-533.081] -- 0:00:19
      691500 -- (-533.733) (-530.478) (-532.198) [-532.733] * (-533.879) [-533.059] (-533.120) (-536.548) -- 0:00:19
      692000 -- [-533.019] (-531.226) (-532.450) (-534.492) * (-532.680) [-533.439] (-532.239) (-536.604) -- 0:00:19
      692500 -- (-532.345) (-533.323) (-532.119) [-533.401] * (-533.766) (-532.354) [-534.012] (-537.805) -- 0:00:19
      693000 -- (-532.397) (-531.028) [-531.696] (-533.909) * (-533.737) (-532.945) [-532.235] (-538.068) -- 0:00:19
      693500 -- [-531.491] (-531.947) (-532.805) (-535.283) * (-534.833) (-532.398) [-533.157] (-533.061) -- 0:00:19
      694000 -- (-534.206) (-540.579) (-531.671) [-533.326] * (-532.669) [-531.145] (-531.470) (-532.729) -- 0:00:19
      694500 -- (-533.974) (-533.001) [-535.341] (-534.390) * (-535.785) (-536.220) (-535.761) [-532.547] -- 0:00:19
      695000 -- (-532.824) [-531.713] (-535.439) (-533.719) * (-534.166) (-530.925) [-533.541] (-533.222) -- 0:00:19

      Average standard deviation of split frequencies: 0.008725

      695500 -- (-541.648) [-535.831] (-533.412) (-531.920) * (-533.301) (-532.034) (-534.538) [-532.585] -- 0:00:19
      696000 -- (-536.554) [-532.707] (-532.964) (-532.924) * (-534.620) (-532.128) [-534.614] (-532.175) -- 0:00:19
      696500 -- (-532.007) [-533.375] (-532.451) (-536.006) * (-533.203) [-530.496] (-532.741) (-533.461) -- 0:00:19
      697000 -- [-531.769] (-535.680) (-533.599) (-533.338) * (-534.520) [-534.029] (-532.737) (-535.101) -- 0:00:19
      697500 -- (-533.754) (-536.913) (-533.075) [-533.880] * [-533.770] (-530.843) (-534.151) (-533.738) -- 0:00:19
      698000 -- (-534.544) (-532.691) (-533.898) [-532.527] * [-533.340] (-532.356) (-532.421) (-532.762) -- 0:00:19
      698500 -- [-534.282] (-534.315) (-536.623) (-532.909) * (-532.689) [-530.744] (-534.406) (-533.817) -- 0:00:18
      699000 -- (-530.606) (-539.546) [-531.291] (-537.922) * (-533.466) (-532.153) (-533.837) [-532.348] -- 0:00:18
      699500 -- (-532.422) (-535.034) (-532.383) [-535.651] * (-533.204) (-532.346) [-532.321] (-533.237) -- 0:00:18
      700000 -- (-535.474) (-534.657) (-531.663) [-533.670] * (-538.135) (-535.904) [-533.084] (-531.054) -- 0:00:18

      Average standard deviation of split frequencies: 0.008509

      700500 -- (-530.758) (-531.654) (-534.075) [-534.233] * (-536.129) (-534.926) [-533.936] (-536.892) -- 0:00:18
      701000 -- [-533.210] (-536.200) (-535.673) (-532.861) * (-533.638) (-533.844) (-543.773) [-534.960] -- 0:00:18
      701500 -- (-530.911) (-536.405) (-536.059) [-534.630] * (-532.382) (-536.850) (-535.931) [-530.320] -- 0:00:18
      702000 -- (-532.059) (-535.007) [-531.201] (-534.811) * (-536.161) (-536.513) (-532.821) [-535.097] -- 0:00:18
      702500 -- (-532.345) (-540.536) (-532.656) [-532.943] * (-532.563) (-533.193) [-531.722] (-534.756) -- 0:00:18
      703000 -- (-534.588) (-533.721) (-531.884) [-531.430] * [-533.688] (-533.121) (-534.904) (-532.654) -- 0:00:18
      703500 -- (-533.583) [-532.973] (-532.008) (-532.463) * (-534.097) (-532.998) [-533.867] (-532.829) -- 0:00:18
      704000 -- [-531.170] (-532.511) (-534.239) (-532.845) * (-532.535) [-532.415] (-536.457) (-540.064) -- 0:00:18
      704500 -- [-534.458] (-532.256) (-535.598) (-531.414) * (-534.273) [-531.991] (-541.949) (-537.973) -- 0:00:18
      705000 -- [-532.101] (-531.576) (-532.187) (-533.492) * (-533.362) (-532.328) [-533.146] (-538.865) -- 0:00:18

      Average standard deviation of split frequencies: 0.008287

      705500 -- [-532.071] (-532.695) (-537.691) (-534.163) * [-534.946] (-532.118) (-536.759) (-533.103) -- 0:00:18
      706000 -- (-534.503) [-533.256] (-539.523) (-538.721) * (-535.239) (-534.076) [-532.592] (-533.767) -- 0:00:18
      706500 -- (-533.615) (-532.758) [-532.345] (-535.223) * (-534.128) (-532.223) [-532.223] (-533.769)