--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:09:04 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/rpsQ/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -532.34 -535.40
2 -532.30 -536.54
--------------------------------------
TOTAL -532.32 -536.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.864628 0.085718 0.362501 1.478783 0.834164 1460.78 1480.89 1.000
r(A<->C){all} 0.156066 0.017462 0.000011 0.420224 0.124690 364.48 378.17 1.003
r(A<->G){all} 0.152770 0.018554 0.000002 0.429607 0.114033 281.91 299.65 1.002
r(A<->T){all} 0.166205 0.019661 0.000011 0.447319 0.133537 166.04 202.97 1.003
r(C<->G){all} 0.156334 0.020457 0.000028 0.468683 0.114950 234.46 238.86 1.001
r(C<->T){all} 0.161201 0.022549 0.000116 0.481651 0.113170 154.01 171.12 1.000
r(G<->T){all} 0.207425 0.023196 0.000225 0.498694 0.176712 177.05 264.00 1.006
pi(A){all} 0.265231 0.000498 0.222645 0.308772 0.264508 1302.04 1375.08 1.000
pi(C){all} 0.244884 0.000470 0.201856 0.286048 0.244475 1261.73 1381.36 1.000
pi(G){all} 0.320028 0.000565 0.272011 0.364057 0.319839 1194.70 1347.85 1.000
pi(T){all} 0.169857 0.000374 0.132730 0.207325 0.169341 1196.51 1250.12 1.000
alpha{1,2} 0.349867 0.161262 0.000595 1.129292 0.221040 1273.35 1328.41 1.000
alpha{3} 0.400992 0.217771 0.000135 1.376451 0.233324 1180.95 1256.15 1.000
pinvar{all} 0.990688 0.000063 0.975490 0.999851 0.992888 1468.14 1484.57 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -507.838844
Model 2: PositiveSelection -507.470636
Model 0: one-ratio -507.612393
Model 7: beta -507.838843
Model 8: beta&w>1 -507.468702
Model 0 vs 1 0.4529019999999946
Model 2 vs 1 0.7364159999999629
Model 8 vs 7 0.7402819999999792
>C1
MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C2
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C3
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C4
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C5
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C6
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=127
C1 MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
C2 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C3 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C4 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C5 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C6 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
*********************** **************************
C1 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C2 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C3 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C4 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C5 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C6 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
**************************************************
C1 DRVSLMETRPLSATKRWRLVEILEKAK
C2 DRVSLMETRPLSATKRWRLVEILEKAK
C3 DRVSLMETRPLSATKRWRLVEILEKAK
C4 DRVSLMETRPLSATKRWRLVEILEKAK
C5 DRVSLMETRPLSATKRWRLVEILEKAK
C6 DRVSLMETRPLSATKRWRLVEILEKAK
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 127 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 127 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3810]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3810]--->[3810]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.440 Mb, Max= 30.636 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
C2 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C3 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C4 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C5 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
C6 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
*********************** **************************
C1 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C2 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C3 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C4 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C5 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
C6 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
**************************************************
C1 DRVSLMETRPLSATKRWRLVEILEKAK
C2 DRVSLMETRPLSATKRWRLVEILEKAK
C3 DRVSLMETRPLSATKRWRLVEILEKAK
C4 DRVSLMETRPLSATKRWRLVEILEKAK
C5 DRVSLMETRPLSATKRWRLVEILEKAK
C6 DRVSLMETRPLSATKRWRLVEILEKAK
***************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 99.21 C1 C2 99.21
TOP 1 0 99.21 C2 C1 99.21
BOT 0 2 99.21 C1 C3 99.21
TOP 2 0 99.21 C3 C1 99.21
BOT 0 3 99.21 C1 C4 99.21
TOP 3 0 99.21 C4 C1 99.21
BOT 0 4 99.21 C1 C5 99.21
TOP 4 0 99.21 C5 C1 99.21
BOT 0 5 99.21 C1 C6 99.21
TOP 5 0 99.21 C6 C1 99.21
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.21
AVG 1 C2 * 99.84
AVG 2 C3 * 99.84
AVG 3 C4 * 99.84
AVG 4 C5 * 99.84
AVG 5 C6 * 99.84
TOT TOT * 99.74
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C2 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C3 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C4 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C5 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
C6 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
**************************************************
C1 CACAGCCGCTCCTAAGGGAGTAGCTGTCAAGGGTGGCGTATCAAAAGACA
C2 CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C3 CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C4 CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C5 CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
C6 CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
******************** *****************************
C1 AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C2 AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C3 AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C4 AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C5 AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
C6 AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
**************************************************
C1 ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C2 ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C3 ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C4 ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C5 ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
C6 ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
**************************************************
C1 TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C2 TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C3 TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C4 TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C5 TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
C6 TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
**************************************************
C1 CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C2 CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C3 CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C4 CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C5 CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
C6 CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
**************************************************
C1 GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C2 GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C3 GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C4 GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C5 GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
C6 GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
**************************************************
C1 GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C2 GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C3 GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C4 GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C5 GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
C6 GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
*******************************
>C1
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGTAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C2
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C3
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C4
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C5
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C6
ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC
CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA
AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA
ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT
TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA
CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT
GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG
GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>C1
MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C2
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C3
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C4
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C5
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
>C6
MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
DRVSLMETRPLSATKRWRLVEILEKAK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 381 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788452
Setting output file names to "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1482563601
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0729204141
Seed = 573140179
Swapseed = 1579788452
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -856.097531 -- -24.965149
Chain 2 -- -856.099129 -- -24.965149
Chain 3 -- -856.099129 -- -24.965149
Chain 4 -- -856.099129 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -856.099129 -- -24.965149
Chain 2 -- -856.099129 -- -24.965149
Chain 3 -- -856.097531 -- -24.965149
Chain 4 -- -856.098933 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-856.098] (-856.099) (-856.099) (-856.099) * [-856.099] (-856.099) (-856.098) (-856.099)
500 -- (-539.363) (-536.030) (-538.930) [-543.536] * (-533.200) (-544.833) (-543.841) [-547.861] -- 0:00:00
1000 -- (-536.285) (-537.695) [-534.652] (-541.267) * (-538.790) [-538.396] (-540.213) (-538.432) -- 0:00:00
1500 -- (-536.710) (-532.663) [-534.168] (-533.955) * [-539.122] (-537.376) (-538.199) (-537.119) -- 0:00:00
2000 -- (-537.240) (-539.095) [-534.757] (-540.174) * (-541.091) (-536.365) (-540.709) [-535.943] -- 0:00:00
2500 -- (-543.589) [-533.995] (-542.387) (-539.135) * (-542.253) [-535.936] (-536.237) (-543.570) -- 0:00:00
3000 -- (-541.275) (-543.850) [-544.156] (-540.018) * (-538.131) [-541.516] (-537.768) (-535.081) -- 0:00:00
3500 -- (-546.301) (-543.750) (-539.521) [-539.249] * (-542.919) [-539.178] (-533.047) (-535.749) -- 0:00:00
4000 -- [-533.199] (-543.866) (-544.928) (-540.176) * (-534.232) (-544.120) [-536.537] (-539.447) -- 0:00:00
4500 -- (-539.255) (-533.879) (-533.593) [-534.342] * [-539.243] (-537.908) (-535.223) (-536.309) -- 0:00:00
5000 -- (-540.366) [-542.270] (-531.611) (-538.520) * (-537.336) (-545.235) (-542.471) [-534.648] -- 0:00:00
Average standard deviation of split frequencies: 0.117851
5500 -- (-541.507) (-536.891) (-531.913) [-534.963] * (-537.659) (-536.767) [-537.742] (-536.272) -- 0:00:00
6000 -- (-540.009) [-535.538] (-535.854) (-537.948) * [-532.878] (-540.161) (-536.880) (-544.626) -- 0:00:00
6500 -- [-540.509] (-542.641) (-541.477) (-542.127) * [-537.215] (-542.629) (-542.324) (-540.853) -- 0:00:00
7000 -- (-546.566) [-532.809] (-535.282) (-532.821) * (-548.686) [-535.934] (-548.628) (-535.844) -- 0:00:00
7500 -- [-545.262] (-542.607) (-535.578) (-534.718) * (-544.103) (-542.837) [-543.505] (-542.188) -- 0:00:00
8000 -- (-538.116) (-537.825) [-538.709] (-536.965) * (-541.828) [-532.357] (-537.641) (-533.630) -- 0:00:00
8500 -- (-543.900) [-535.080] (-533.278) (-536.313) * (-535.672) (-539.640) [-532.613] (-550.435) -- 0:00:00
9000 -- (-548.630) (-538.133) [-535.850] (-538.939) * (-533.519) (-541.805) [-539.720] (-539.727) -- 0:00:00
9500 -- [-539.154] (-537.439) (-539.651) (-546.793) * (-537.746) [-535.414] (-540.177) (-547.072) -- 0:00:00
10000 -- (-541.196) [-534.894] (-537.198) (-540.273) * [-537.698] (-537.769) (-532.959) (-546.409) -- 0:00:00
Average standard deviation of split frequencies: 0.092597
10500 -- [-536.193] (-545.754) (-534.081) (-539.838) * [-535.507] (-545.322) (-545.671) (-535.784) -- 0:00:00
11000 -- (-542.580) (-537.844) (-545.628) [-545.734] * [-534.710] (-539.839) (-543.200) (-540.067) -- 0:00:00
11500 -- (-538.875) [-538.420] (-535.623) (-538.773) * (-537.712) [-533.933] (-533.044) (-543.075) -- 0:00:00
12000 -- (-540.686) (-537.402) (-541.105) [-536.327] * (-539.189) (-537.743) (-537.264) [-536.210] -- 0:00:00
12500 -- (-554.682) [-532.649] (-548.919) (-535.171) * (-536.603) (-534.685) [-534.407] (-541.905) -- 0:00:00
13000 -- (-545.511) [-533.927] (-543.510) (-536.780) * (-537.512) (-538.754) [-536.201] (-542.652) -- 0:00:00
13500 -- (-549.477) [-536.606] (-542.351) (-541.277) * [-538.825] (-545.618) (-532.743) (-537.324) -- 0:00:00
14000 -- (-533.191) [-544.391] (-540.668) (-534.962) * (-536.789) (-534.942) (-533.874) [-535.771] -- 0:01:10
14500 -- (-532.566) (-541.993) [-539.965] (-536.399) * (-535.283) [-534.620] (-534.308) (-546.936) -- 0:01:07
15000 -- (-533.315) (-546.164) [-530.814] (-536.191) * (-536.649) (-537.709) (-533.827) [-535.887] -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-534.044) [-537.496] (-543.592) (-541.346) * (-537.426) [-537.553] (-536.074) (-540.261) -- 0:01:03
16000 -- (-532.383) (-542.760) (-549.435) [-542.270] * (-535.989) (-536.421) (-533.504) [-535.759] -- 0:01:01
16500 -- (-534.100) (-536.417) (-537.125) [-532.732] * (-534.596) (-535.520) (-532.848) [-536.978] -- 0:00:59
17000 -- (-533.092) (-535.123) (-533.387) [-532.822] * (-538.013) (-538.257) (-535.219) [-534.448] -- 0:00:57
17500 -- (-535.257) [-532.912] (-532.146) (-536.315) * (-536.189) [-541.640] (-534.661) (-542.005) -- 0:00:56
18000 -- (-535.929) [-540.424] (-538.624) (-534.811) * (-539.685) (-536.387) [-532.335] (-537.759) -- 0:00:54
18500 -- (-538.835) (-535.553) [-542.117] (-533.647) * (-537.840) [-539.436] (-536.672) (-545.447) -- 0:00:53
19000 -- (-536.954) (-546.687) [-533.841] (-533.109) * (-533.962) [-536.240] (-533.703) (-554.680) -- 0:00:51
19500 -- (-535.180) (-535.615) [-532.644] (-536.104) * [-533.092] (-536.135) (-534.748) (-552.768) -- 0:00:50
20000 -- (-532.568) (-533.813) [-532.578] (-533.426) * (-543.166) [-533.497] (-534.914) (-544.636) -- 0:00:49
Average standard deviation of split frequencies: 0.043339
20500 -- (-534.804) (-536.498) (-532.863) [-533.288] * (-536.806) [-532.477] (-536.402) (-535.760) -- 0:00:47
21000 -- (-536.231) (-540.748) [-535.860] (-535.205) * [-541.230] (-536.410) (-534.346) (-532.329) -- 0:00:46
21500 -- (-534.210) [-535.169] (-536.292) (-534.375) * (-544.907) (-537.733) (-533.814) [-533.815] -- 0:00:45
22000 -- (-534.959) (-539.981) [-533.913] (-533.016) * (-542.718) [-537.034] (-533.693) (-534.902) -- 0:00:44
22500 -- (-534.582) [-534.187] (-534.504) (-533.545) * (-539.535) (-540.313) [-534.298] (-531.897) -- 0:00:43
23000 -- (-534.449) (-537.750) [-533.481] (-535.313) * (-539.104) (-535.765) [-533.282] (-533.055) -- 0:00:42
23500 -- (-533.539) [-538.267] (-538.071) (-534.660) * (-538.348) (-540.216) [-532.640] (-537.043) -- 0:00:41
24000 -- (-532.847) (-544.999) [-531.564] (-532.859) * (-534.753) [-539.760] (-532.438) (-534.407) -- 0:00:40
24500 -- (-533.902) [-537.035] (-535.971) (-534.573) * [-537.680] (-536.664) (-533.280) (-536.109) -- 0:00:39
25000 -- (-534.701) (-540.330) (-532.837) [-533.737] * (-539.855) (-542.927) [-534.474] (-532.369) -- 0:00:39
Average standard deviation of split frequencies: 0.037910
25500 -- (-534.569) [-535.314] (-532.610) (-533.212) * (-539.695) (-557.480) (-533.780) [-531.014] -- 0:00:38
26000 -- (-530.785) [-537.025] (-533.267) (-533.408) * [-539.150] (-545.106) (-532.443) (-532.299) -- 0:00:37
26500 -- (-532.101) [-540.800] (-533.559) (-533.772) * (-543.713) (-533.627) (-534.613) [-533.739] -- 0:00:36
27000 -- (-531.647) (-538.050) [-534.138] (-534.745) * (-538.533) (-541.592) [-534.030] (-533.074) -- 0:00:36
27500 -- (-532.416) (-540.515) [-531.941] (-532.591) * [-534.389] (-535.774) (-534.172) (-534.033) -- 0:00:35
28000 -- (-533.195) (-544.916) (-532.023) [-533.384] * [-541.396] (-533.207) (-532.135) (-533.974) -- 0:00:34
28500 -- [-531.857] (-532.226) (-535.748) (-533.543) * (-533.848) (-533.817) [-531.382] (-532.639) -- 0:00:34
29000 -- [-532.672] (-533.294) (-534.204) (-534.836) * [-539.502] (-535.620) (-534.703) (-534.843) -- 0:01:06
29500 -- (-532.644) [-531.668] (-532.726) (-537.878) * [-536.092] (-532.720) (-535.440) (-533.200) -- 0:01:05
30000 -- (-533.975) [-533.077] (-531.761) (-532.711) * (-538.779) (-533.163) (-534.370) [-533.577] -- 0:01:04
Average standard deviation of split frequencies: 0.039198
30500 -- [-531.899] (-534.264) (-535.579) (-540.003) * [-535.043] (-533.720) (-531.855) (-534.128) -- 0:01:03
31000 -- [-530.290] (-533.204) (-536.807) (-533.251) * (-543.851) [-532.499] (-531.655) (-531.635) -- 0:01:02
31500 -- (-535.710) [-530.535] (-534.799) (-533.862) * (-534.992) [-533.875] (-534.965) (-535.240) -- 0:01:01
32000 -- [-531.800] (-538.803) (-536.649) (-535.706) * (-538.104) (-533.578) [-532.755] (-535.987) -- 0:01:00
32500 -- (-535.533) (-532.922) [-533.442] (-534.321) * [-536.782] (-532.702) (-536.013) (-536.467) -- 0:00:59
33000 -- [-535.647] (-534.533) (-532.722) (-534.222) * (-537.974) (-532.524) [-532.486] (-534.622) -- 0:00:58
33500 -- (-540.462) (-530.573) (-539.064) [-534.161] * (-535.729) (-531.743) [-534.421] (-535.988) -- 0:00:57
34000 -- (-540.788) (-531.798) [-532.694] (-532.828) * [-536.925] (-532.909) (-533.172) (-534.103) -- 0:00:56
34500 -- (-533.020) [-532.137] (-534.428) (-531.372) * (-534.953) (-532.656) [-532.939] (-532.262) -- 0:00:55
35000 -- (-535.743) (-531.030) [-533.121] (-530.397) * [-537.412] (-533.656) (-537.698) (-532.138) -- 0:00:55
Average standard deviation of split frequencies: 0.039284
35500 -- (-536.834) (-532.487) (-533.916) [-532.032] * [-539.102] (-532.176) (-532.508) (-534.331) -- 0:00:54
36000 -- (-533.799) (-534.728) [-531.114] (-534.545) * (-540.786) [-532.385] (-533.824) (-536.286) -- 0:00:53
36500 -- (-533.620) (-531.261) (-532.628) [-535.118] * (-544.691) (-531.475) (-534.093) [-534.346] -- 0:00:52
37000 -- [-533.525] (-534.966) (-533.710) (-533.321) * [-540.587] (-534.156) (-535.107) (-533.252) -- 0:00:52
37500 -- (-531.439) (-532.146) [-532.491] (-531.188) * [-533.964] (-535.585) (-534.767) (-531.860) -- 0:00:51
38000 -- [-535.132] (-532.139) (-532.060) (-530.958) * [-531.322] (-532.386) (-531.468) (-531.720) -- 0:00:50
38500 -- (-535.485) (-531.380) [-542.187] (-531.565) * (-534.187) [-533.774] (-532.490) (-533.849) -- 0:00:49
39000 -- (-534.704) [-533.378] (-537.049) (-533.734) * (-533.170) (-534.796) (-533.672) [-535.992] -- 0:00:49
39500 -- (-538.017) (-533.496) [-533.226] (-533.201) * (-531.586) (-536.551) [-534.290] (-531.406) -- 0:00:48
40000 -- (-533.591) (-533.095) (-533.838) [-532.214] * (-532.634) [-531.707] (-532.796) (-532.064) -- 0:00:48
Average standard deviation of split frequencies: 0.043317
40500 -- (-538.501) (-533.598) (-537.421) [-531.722] * [-537.196] (-535.858) (-532.781) (-533.115) -- 0:00:47
41000 -- (-532.497) (-533.561) [-530.492] (-534.810) * [-534.593] (-534.044) (-533.302) (-533.353) -- 0:00:46
41500 -- (-534.059) (-532.119) (-534.485) [-531.208] * [-533.579] (-540.425) (-534.152) (-533.219) -- 0:00:46
42000 -- (-530.227) (-533.313) (-530.486) [-531.970] * [-531.167] (-533.376) (-533.013) (-536.964) -- 0:00:45
42500 -- (-535.751) (-532.018) (-532.396) [-535.170] * (-534.190) (-535.640) [-534.278] (-536.745) -- 0:00:45
43000 -- (-533.883) [-530.988] (-534.396) (-533.758) * (-533.687) (-534.962) [-533.843] (-530.778) -- 0:00:44
43500 -- (-536.228) (-534.348) (-532.478) [-531.207] * (-531.495) [-532.489] (-533.769) (-533.520) -- 0:01:05
44000 -- (-533.254) (-533.691) [-532.860] (-530.721) * [-533.108] (-535.808) (-531.975) (-533.180) -- 0:01:05
44500 -- (-534.619) (-532.731) [-533.506] (-531.248) * (-530.568) (-535.334) (-538.676) [-533.767] -- 0:01:04
45000 -- (-538.008) (-533.126) (-533.348) [-531.139] * (-531.187) (-530.483) [-532.392] (-533.033) -- 0:01:03
Average standard deviation of split frequencies: 0.042456
45500 -- [-532.519] (-535.845) (-533.724) (-531.556) * (-533.395) (-534.179) (-534.906) [-533.707] -- 0:01:02
46000 -- (-531.528) (-532.782) [-533.302] (-531.120) * (-535.415) (-531.090) (-534.639) [-533.521] -- 0:01:02
46500 -- (-534.675) [-532.887] (-532.350) (-532.945) * (-535.019) (-533.055) (-534.022) [-533.067] -- 0:01:01
47000 -- (-533.606) [-533.802] (-538.208) (-533.635) * (-536.533) (-531.887) (-533.164) [-532.166] -- 0:01:00
47500 -- [-536.049] (-531.559) (-541.451) (-533.930) * (-533.305) [-533.082] (-539.400) (-535.026) -- 0:01:00
48000 -- (-533.362) [-532.663] (-531.823) (-535.080) * (-533.558) [-533.505] (-536.472) (-533.467) -- 0:00:59
48500 -- (-537.480) (-536.664) [-532.703] (-533.864) * (-539.814) [-531.708] (-534.038) (-531.500) -- 0:00:58
49000 -- [-535.668] (-534.024) (-534.361) (-532.335) * [-534.108] (-532.693) (-533.433) (-534.145) -- 0:00:58
49500 -- [-533.158] (-535.483) (-533.250) (-533.250) * [-535.135] (-533.602) (-532.893) (-535.935) -- 0:00:57
50000 -- (-533.195) [-533.162] (-534.022) (-533.188) * (-535.628) (-533.009) [-532.551] (-533.383) -- 0:00:57
Average standard deviation of split frequencies: 0.043092
50500 -- (-533.175) [-533.831] (-536.279) (-532.182) * [-533.629] (-533.921) (-533.844) (-533.019) -- 0:00:56
51000 -- [-537.441] (-537.016) (-532.146) (-532.035) * (-532.923) (-533.912) [-533.095] (-532.839) -- 0:00:55
51500 -- (-536.711) (-533.435) (-535.684) [-533.383] * (-533.800) (-533.246) (-532.811) [-533.195] -- 0:00:55
52000 -- (-533.425) [-532.807] (-534.913) (-532.928) * [-534.258] (-534.089) (-533.945) (-534.055) -- 0:00:54
52500 -- (-533.206) (-530.981) [-532.873] (-532.830) * [-533.155] (-534.823) (-533.751) (-534.271) -- 0:00:54
53000 -- (-534.696) [-532.405] (-537.940) (-532.367) * (-530.309) (-534.351) (-531.815) [-534.716] -- 0:00:53
53500 -- (-533.666) (-536.434) [-533.069] (-533.619) * [-531.372] (-533.967) (-533.216) (-533.079) -- 0:00:53
54000 -- (-535.916) (-535.083) (-532.221) [-535.096] * [-533.294] (-533.896) (-536.184) (-542.292) -- 0:00:52
54500 -- (-533.139) (-532.819) [-531.595] (-532.540) * (-533.211) (-532.002) [-531.738] (-535.329) -- 0:00:52
55000 -- (-537.260) (-532.640) [-533.828] (-531.644) * (-534.372) (-534.290) (-532.488) [-532.313] -- 0:00:51
Average standard deviation of split frequencies: 0.030127
55500 -- [-534.345] (-535.379) (-537.986) (-531.149) * (-539.542) [-536.534] (-534.630) (-534.847) -- 0:00:51
56000 -- (-530.932) (-532.914) (-533.425) [-533.290] * (-537.226) (-531.476) [-533.404] (-534.406) -- 0:00:50
56500 -- [-532.218] (-535.831) (-533.678) (-539.001) * (-537.545) (-535.879) [-533.453] (-533.289) -- 0:00:50
57000 -- (-532.439) (-532.631) (-532.724) [-533.947] * (-532.616) (-533.145) [-533.342] (-535.148) -- 0:00:49
57500 -- (-534.157) (-533.179) (-529.868) [-532.942] * (-535.255) (-532.646) [-532.137] (-533.743) -- 0:00:49
58000 -- (-536.514) [-531.523] (-532.783) (-532.086) * (-535.082) [-535.259] (-532.278) (-535.222) -- 0:00:48
58500 -- (-532.719) (-533.893) [-530.472] (-533.903) * (-535.166) (-534.296) (-532.298) [-537.215] -- 0:00:48
59000 -- (-534.767) [-532.583] (-531.260) (-534.024) * [-531.902] (-534.134) (-532.373) (-536.585) -- 0:01:03
59500 -- (-533.753) [-533.565] (-533.997) (-540.634) * (-532.215) [-533.137] (-533.060) (-537.497) -- 0:01:03
60000 -- (-532.874) [-532.014] (-531.331) (-532.472) * [-534.372] (-531.863) (-531.914) (-536.780) -- 0:01:02
Average standard deviation of split frequencies: 0.031470
60500 -- (-533.435) (-533.831) [-532.213] (-531.466) * (-534.383) (-534.444) [-531.639] (-532.952) -- 0:01:02
61000 -- (-534.143) [-534.861] (-529.624) (-532.776) * (-533.356) (-533.199) (-533.917) [-534.388] -- 0:01:01
61500 -- [-535.392] (-534.636) (-532.115) (-534.780) * (-538.255) (-532.957) [-533.643] (-532.594) -- 0:01:01
62000 -- (-533.230) (-534.472) [-533.173] (-536.514) * (-535.707) (-539.807) [-534.259] (-532.167) -- 0:01:00
62500 -- (-535.703) [-535.905] (-531.102) (-532.215) * (-534.069) [-534.944] (-535.125) (-538.924) -- 0:01:00
63000 -- (-537.607) [-534.828] (-534.843) (-532.204) * [-531.020] (-532.666) (-531.576) (-535.789) -- 0:00:59
63500 -- (-534.763) [-531.614] (-535.322) (-531.393) * [-534.950] (-533.692) (-533.039) (-534.779) -- 0:00:58
64000 -- (-532.288) (-533.154) (-533.699) [-532.925] * [-531.348] (-535.077) (-538.122) (-534.334) -- 0:00:58
64500 -- (-532.224) (-541.015) (-531.862) [-531.074] * (-530.811) [-533.368] (-533.432) (-534.841) -- 0:00:58
65000 -- [-535.895] (-531.763) (-531.738) (-537.244) * (-532.248) [-534.947] (-533.844) (-532.046) -- 0:00:57
Average standard deviation of split frequencies: 0.028570
65500 -- (-533.551) [-534.437] (-533.800) (-535.398) * [-533.724] (-533.710) (-531.559) (-534.105) -- 0:00:57
66000 -- (-532.857) [-533.867] (-533.812) (-532.287) * [-531.625] (-535.178) (-532.811) (-532.423) -- 0:00:56
66500 -- (-531.521) (-532.830) (-531.452) [-537.365] * [-533.277] (-535.695) (-534.573) (-534.367) -- 0:00:56
67000 -- (-533.452) [-532.829] (-531.878) (-535.277) * (-532.633) [-533.605] (-535.605) (-537.088) -- 0:00:55
67500 -- (-530.840) [-533.264] (-532.647) (-536.015) * (-536.772) (-536.705) [-532.586] (-533.350) -- 0:00:55
68000 -- (-532.252) [-531.615] (-534.616) (-534.579) * (-535.221) (-536.603) (-536.122) [-532.225] -- 0:00:54
68500 -- (-531.429) [-532.420] (-535.195) (-532.382) * [-533.467] (-534.711) (-537.239) (-535.033) -- 0:00:54
69000 -- (-531.966) [-534.786] (-533.235) (-533.737) * (-530.670) (-532.286) (-539.089) [-536.505] -- 0:00:53
69500 -- (-533.232) [-530.639] (-532.306) (-534.471) * (-532.541) (-535.047) [-533.151] (-535.662) -- 0:00:53
70000 -- (-532.050) [-533.211] (-534.380) (-533.612) * (-531.997) [-533.686] (-534.243) (-534.762) -- 0:00:53
Average standard deviation of split frequencies: 0.028351
70500 -- (-535.272) (-532.673) [-532.855] (-532.313) * (-536.681) [-534.530] (-538.972) (-533.910) -- 0:00:52
71000 -- (-534.272) (-535.738) [-531.250] (-533.943) * (-535.606) [-532.288] (-536.400) (-532.418) -- 0:00:52
71500 -- [-533.800] (-534.447) (-535.101) (-532.471) * [-532.967] (-533.700) (-532.980) (-533.391) -- 0:00:51
72000 -- (-534.061) (-530.794) (-533.549) [-532.345] * (-533.997) (-530.831) (-530.131) [-532.128] -- 0:00:51
72500 -- (-535.991) [-536.884] (-535.529) (-532.834) * (-533.905) (-532.616) [-531.395] (-532.687) -- 0:00:51
73000 -- (-533.140) (-532.288) (-532.420) [-531.701] * (-533.583) [-535.662] (-533.626) (-538.750) -- 0:00:50
73500 -- [-533.208] (-534.520) (-536.031) (-533.442) * [-531.737] (-532.844) (-532.110) (-535.006) -- 0:00:50
74000 -- (-531.856) (-537.304) [-531.805] (-533.380) * (-535.661) (-535.744) (-531.322) [-533.784] -- 0:00:50
74500 -- (-531.595) (-531.320) (-532.767) [-533.850] * [-531.868] (-531.996) (-532.299) (-533.087) -- 0:00:49
75000 -- (-533.194) (-530.543) (-532.588) [-533.053] * (-532.934) (-530.878) (-534.187) [-532.740] -- 0:01:01
Average standard deviation of split frequencies: 0.030393
75500 -- (-531.856) (-531.737) [-534.411] (-532.250) * [-533.322] (-530.782) (-532.639) (-531.628) -- 0:01:01
76000 -- (-533.497) (-534.844) [-533.368] (-531.876) * (-531.019) (-533.522) [-534.176] (-531.372) -- 0:01:00
76500 -- (-534.686) [-531.147] (-532.745) (-532.907) * (-533.526) (-532.887) (-537.040) [-531.408] -- 0:01:00
77000 -- [-532.638] (-535.763) (-534.029) (-531.718) * (-535.922) [-534.104] (-534.072) (-532.097) -- 0:00:59
77500 -- (-532.564) (-537.480) (-537.405) [-532.270] * [-532.724] (-533.930) (-535.163) (-535.716) -- 0:00:59
78000 -- (-534.826) (-532.740) [-530.408] (-533.214) * (-538.541) [-533.506] (-540.248) (-530.406) -- 0:00:59
78500 -- (-535.049) (-533.403) (-530.620) [-533.496] * (-533.122) (-533.579) [-536.392] (-532.791) -- 0:00:58
79000 -- (-533.940) [-531.102] (-532.153) (-532.198) * (-530.025) [-530.906] (-534.257) (-535.817) -- 0:00:58
79500 -- (-531.953) (-535.078) [-531.592] (-534.504) * (-531.594) (-531.899) [-538.722] (-534.622) -- 0:00:57
80000 -- (-533.706) (-536.046) [-532.098] (-536.261) * [-532.878] (-536.296) (-539.941) (-536.327) -- 0:00:57
Average standard deviation of split frequencies: 0.027466
80500 -- (-532.078) [-532.973] (-531.134) (-532.198) * (-535.366) (-532.713) [-533.286] (-534.797) -- 0:00:57
81000 -- (-531.601) (-531.124) [-531.169] (-535.482) * [-533.382] (-537.267) (-534.416) (-531.885) -- 0:00:56
81500 -- (-535.900) (-534.085) [-532.694] (-532.378) * (-533.683) [-531.989] (-533.304) (-533.163) -- 0:00:56
82000 -- [-532.948] (-535.799) (-535.075) (-531.994) * (-535.234) (-532.842) (-534.045) [-534.310] -- 0:00:55
82500 -- (-530.653) (-531.302) [-536.992] (-533.126) * (-531.986) (-535.564) [-534.601] (-538.004) -- 0:00:55
83000 -- (-535.281) (-534.302) (-534.261) [-532.083] * (-534.110) (-532.057) (-535.824) [-537.289] -- 0:00:55
83500 -- (-533.114) (-533.830) (-536.599) [-536.214] * [-532.787] (-534.482) (-538.178) (-531.885) -- 0:00:54
84000 -- (-529.789) (-534.783) (-532.645) [-533.059] * [-534.133] (-532.965) (-535.836) (-535.967) -- 0:00:54
84500 -- (-534.327) [-534.511] (-533.021) (-533.078) * (-537.467) (-531.713) [-534.509] (-531.796) -- 0:00:54
85000 -- (-531.584) [-533.126] (-533.905) (-535.237) * [-534.214] (-537.680) (-533.086) (-536.797) -- 0:00:53
Average standard deviation of split frequencies: 0.020830
85500 -- (-536.487) [-531.728] (-533.393) (-532.156) * [-531.140] (-537.994) (-532.695) (-535.127) -- 0:00:53
86000 -- (-539.501) [-534.165] (-532.426) (-531.583) * (-530.298) (-533.828) [-532.713] (-532.010) -- 0:00:53
86500 -- [-534.032] (-531.792) (-538.481) (-531.694) * (-531.627) [-533.728] (-533.359) (-537.417) -- 0:00:52
87000 -- [-532.972] (-531.918) (-535.488) (-533.499) * (-532.453) [-532.928] (-536.382) (-531.732) -- 0:00:52
87500 -- (-535.005) (-532.342) (-535.068) [-533.742] * (-531.614) (-537.883) (-533.506) [-535.953] -- 0:00:52
88000 -- (-533.102) [-534.653] (-533.471) (-538.724) * (-530.490) [-533.917] (-533.625) (-531.524) -- 0:00:51
88500 -- (-532.662) (-534.733) [-532.707] (-534.564) * [-534.784] (-536.305) (-538.187) (-531.873) -- 0:00:51
89000 -- (-532.065) (-537.518) (-536.452) [-533.688] * (-536.290) (-537.364) [-536.326] (-532.718) -- 0:00:51
89500 -- (-533.126) (-533.652) (-532.502) [-535.372] * (-535.308) [-532.237] (-534.113) (-536.316) -- 0:00:50
90000 -- (-533.076) (-532.174) [-532.041] (-537.497) * (-534.841) (-531.228) [-536.284] (-534.807) -- 0:00:50
Average standard deviation of split frequencies: 0.022283
90500 -- (-538.797) (-535.203) (-533.668) [-533.635] * [-531.646] (-532.714) (-535.455) (-533.760) -- 0:00:50
91000 -- (-533.928) (-535.072) (-531.394) [-534.854] * (-532.552) (-533.330) [-531.846] (-533.089) -- 0:00:59
91500 -- [-535.089] (-534.872) (-533.934) (-533.498) * (-531.820) (-534.259) (-537.468) [-532.745] -- 0:00:59
92000 -- (-536.349) [-530.459] (-538.742) (-534.947) * (-533.279) [-531.132] (-533.456) (-534.003) -- 0:00:59
92500 -- (-533.019) (-539.198) [-532.477] (-535.851) * (-533.406) (-531.197) [-533.085] (-537.108) -- 0:00:58
93000 -- (-536.097) [-534.599] (-531.087) (-533.836) * (-533.641) [-532.486] (-536.827) (-532.534) -- 0:00:58
93500 -- (-533.661) [-536.113] (-532.279) (-536.292) * (-533.417) (-536.993) (-533.594) [-534.140] -- 0:00:58
94000 -- (-536.905) [-535.525] (-533.179) (-535.335) * (-535.133) [-534.264] (-532.743) (-534.226) -- 0:00:57
94500 -- (-536.345) (-533.135) [-536.612] (-534.240) * (-535.056) (-534.320) (-533.626) [-534.542] -- 0:00:57
95000 -- (-532.350) (-531.503) [-531.411] (-536.377) * (-542.155) (-534.775) (-534.105) [-534.846] -- 0:00:57
Average standard deviation of split frequencies: 0.023851
95500 -- [-534.789] (-532.035) (-533.254) (-531.490) * (-536.627) [-538.880] (-533.045) (-534.254) -- 0:00:56
96000 -- (-536.357) (-537.549) (-533.009) [-533.518] * (-532.919) (-531.564) (-532.542) [-532.641] -- 0:00:56
96500 -- (-532.230) [-532.678] (-535.202) (-531.753) * (-532.889) [-530.698] (-531.483) (-533.529) -- 0:00:56
97000 -- (-535.321) [-533.549] (-535.187) (-531.755) * (-532.352) (-531.960) (-532.467) [-532.258] -- 0:00:55
97500 -- (-536.083) (-532.705) (-535.919) [-532.187] * [-533.214] (-531.614) (-533.123) (-531.271) -- 0:00:55
98000 -- (-533.896) (-531.782) (-537.261) [-533.937] * (-532.731) (-530.950) [-532.908] (-532.265) -- 0:00:55
98500 -- (-535.695) [-533.905] (-532.691) (-531.707) * (-534.776) (-531.639) (-533.273) [-532.434] -- 0:00:54
99000 -- (-533.927) [-532.285] (-533.962) (-533.034) * (-533.226) (-534.101) (-532.008) [-532.963] -- 0:00:54
99500 -- (-536.163) [-534.390] (-534.315) (-532.885) * (-533.271) (-531.764) [-533.835] (-532.164) -- 0:00:54
100000 -- (-534.091) (-536.306) (-533.226) [-532.838] * (-531.677) (-535.602) [-534.917] (-534.287) -- 0:00:54
Average standard deviation of split frequencies: 0.025287
100500 -- [-533.093] (-535.746) (-533.331) (-532.244) * (-532.293) (-530.709) (-532.847) [-532.174] -- 0:00:53
101000 -- (-535.523) (-534.561) [-533.792] (-532.841) * (-533.048) [-531.679] (-533.345) (-532.814) -- 0:00:53
101500 -- (-533.566) [-531.814] (-531.707) (-534.508) * [-532.133] (-531.706) (-534.307) (-533.760) -- 0:00:53
102000 -- (-534.894) (-534.296) (-536.319) [-536.315] * (-531.464) (-530.639) [-531.196] (-534.460) -- 0:00:52
102500 -- (-531.177) (-531.441) [-534.323] (-534.049) * (-530.686) (-532.554) [-531.930] (-532.374) -- 0:00:52
103000 -- (-532.548) (-531.209) [-534.792] (-533.374) * (-530.449) (-532.827) [-532.061] (-532.469) -- 0:00:52
103500 -- (-537.951) (-532.531) (-531.562) [-536.514] * (-533.350) [-530.724] (-530.903) (-533.496) -- 0:00:51
104000 -- (-538.649) (-540.530) (-533.775) [-532.127] * (-532.253) [-530.128] (-532.242) (-534.872) -- 0:00:51
104500 -- (-535.131) [-533.683] (-532.409) (-534.789) * (-531.839) (-531.435) [-531.804] (-536.088) -- 0:00:51
105000 -- [-532.303] (-533.821) (-536.837) (-531.318) * (-532.200) [-531.698] (-532.055) (-534.054) -- 0:00:51
Average standard deviation of split frequencies: 0.023045
105500 -- (-530.839) (-534.150) [-531.487] (-532.735) * (-533.362) [-532.570] (-531.752) (-535.969) -- 0:00:50
106000 -- (-532.629) (-534.486) (-535.409) [-533.564] * (-531.322) [-534.388] (-533.947) (-538.537) -- 0:00:50
106500 -- (-537.195) [-534.820] (-532.633) (-533.569) * (-532.751) (-532.668) (-532.668) [-530.784] -- 0:00:58
107000 -- (-531.813) (-533.164) (-540.823) [-533.563] * (-533.928) (-533.299) [-533.234] (-533.562) -- 0:00:58
107500 -- (-535.369) (-533.166) [-533.573] (-534.197) * [-530.672] (-532.339) (-530.173) (-533.747) -- 0:00:58
108000 -- (-533.384) (-534.361) [-534.938] (-536.371) * (-533.689) (-535.356) (-531.679) [-533.864] -- 0:00:57
108500 -- [-536.657] (-534.508) (-538.536) (-539.730) * (-533.679) (-532.343) (-531.538) [-533.131] -- 0:00:57
109000 -- (-530.743) (-532.448) [-534.571] (-539.418) * [-535.647] (-535.204) (-535.338) (-532.882) -- 0:00:57
109500 -- [-530.796] (-533.024) (-534.315) (-531.622) * [-533.672] (-532.161) (-538.850) (-532.841) -- 0:00:56
110000 -- (-533.350) [-532.659] (-534.744) (-532.067) * (-533.923) (-533.004) (-535.976) [-533.637] -- 0:00:56
Average standard deviation of split frequencies: 0.025110
110500 -- [-532.167] (-533.647) (-535.365) (-533.685) * (-533.002) (-531.989) (-535.412) [-531.998] -- 0:00:56
111000 -- [-530.444] (-535.812) (-534.168) (-534.827) * (-533.333) [-532.494] (-533.337) (-533.507) -- 0:00:56
111500 -- (-531.668) (-531.934) (-534.945) [-531.095] * (-534.400) (-533.252) (-531.595) [-532.098] -- 0:00:55
112000 -- [-531.202] (-533.146) (-530.554) (-534.498) * (-534.459) [-531.949] (-531.752) (-533.588) -- 0:00:55
112500 -- (-533.062) (-533.165) (-532.351) [-533.368] * (-536.874) (-533.900) [-532.297] (-530.022) -- 0:00:55
113000 -- (-533.378) (-532.788) (-531.673) [-532.786] * (-534.576) [-533.024] (-536.143) (-534.109) -- 0:00:54
113500 -- (-530.480) [-531.748] (-530.943) (-535.750) * (-534.206) (-534.426) (-535.233) [-532.578] -- 0:00:54
114000 -- (-531.802) (-533.786) (-536.205) [-535.530] * [-533.179] (-533.657) (-534.953) (-534.212) -- 0:00:54
114500 -- [-533.242] (-535.394) (-532.130) (-531.763) * (-532.919) (-533.347) (-535.383) [-531.696] -- 0:00:54
115000 -- [-533.474] (-536.996) (-532.573) (-534.444) * (-532.695) [-533.941] (-535.940) (-532.343) -- 0:00:53
Average standard deviation of split frequencies: 0.023527
115500 -- (-535.607) (-532.322) (-532.245) [-531.733] * [-534.238] (-536.832) (-534.669) (-532.710) -- 0:00:53
116000 -- (-534.898) (-536.036) [-535.238] (-531.752) * (-535.225) (-533.691) [-534.293] (-532.897) -- 0:00:53
116500 -- (-534.235) (-531.539) (-540.632) [-531.358] * (-535.125) (-533.015) (-532.690) [-531.297] -- 0:00:53
117000 -- (-531.823) [-530.909] (-532.357) (-532.351) * [-534.855] (-536.982) (-534.502) (-530.303) -- 0:00:52
117500 -- [-533.857] (-534.053) (-533.899) (-534.043) * (-534.462) (-533.608) [-534.451] (-534.452) -- 0:00:52
118000 -- (-532.285) (-532.234) (-534.797) [-529.161] * (-538.156) (-532.615) (-531.012) [-530.821] -- 0:00:52
118500 -- [-530.573] (-531.878) (-534.003) (-531.055) * (-535.401) [-531.242] (-533.830) (-531.478) -- 0:00:52
119000 -- (-531.061) (-534.663) [-535.497] (-534.681) * (-536.504) (-536.088) (-532.245) [-532.237] -- 0:00:51
119500 -- (-531.197) [-533.885] (-532.942) (-534.426) * [-531.344] (-536.448) (-531.878) (-531.669) -- 0:00:51
120000 -- (-534.997) (-532.666) (-537.170) [-532.873] * (-533.661) (-533.881) [-533.388] (-532.683) -- 0:00:51
Average standard deviation of split frequencies: 0.019122
120500 -- (-533.237) (-533.692) (-535.949) [-533.713] * (-532.526) (-533.008) (-533.107) [-535.225] -- 0:00:51
121000 -- (-532.827) (-534.298) [-535.528] (-533.522) * [-531.737] (-533.181) (-534.100) (-534.212) -- 0:00:50
121500 -- (-535.104) (-534.373) (-535.444) [-531.206] * (-532.414) (-539.534) [-532.160] (-532.155) -- 0:00:50
122000 -- (-535.405) (-534.375) [-533.013] (-532.667) * [-531.932] (-532.675) (-533.967) (-530.053) -- 0:00:50
122500 -- (-533.364) (-533.754) (-532.569) [-533.977] * [-532.999] (-534.273) (-531.748) (-532.411) -- 0:00:57
123000 -- (-532.491) (-532.703) [-533.383] (-537.216) * [-532.978] (-532.679) (-533.694) (-531.119) -- 0:00:57
123500 -- (-532.604) [-536.733] (-532.774) (-530.505) * (-533.060) [-532.072] (-532.548) (-529.477) -- 0:00:56
124000 -- (-533.413) (-533.024) [-532.741] (-532.674) * (-530.990) (-535.694) (-531.969) [-530.848] -- 0:00:56
124500 -- (-537.712) [-532.879] (-533.274) (-532.186) * (-534.358) [-534.683] (-529.828) (-533.830) -- 0:00:56
125000 -- [-533.046] (-536.799) (-538.795) (-537.728) * [-532.653] (-533.525) (-532.831) (-533.993) -- 0:00:56
Average standard deviation of split frequencies: 0.020764
125500 -- (-531.852) [-535.112] (-536.831) (-542.153) * [-533.114] (-533.840) (-531.920) (-533.287) -- 0:00:55
126000 -- (-530.847) (-533.406) [-533.866] (-538.637) * (-531.404) (-534.967) [-535.182] (-537.883) -- 0:00:55
126500 -- (-533.031) (-533.559) [-537.351] (-531.309) * (-532.108) (-533.222) (-532.463) [-532.753] -- 0:00:55
127000 -- (-531.411) (-533.354) (-539.315) [-532.010] * (-533.446) [-532.940] (-531.835) (-532.570) -- 0:00:54
127500 -- (-531.518) (-533.596) (-536.122) [-532.173] * (-536.864) (-533.092) (-531.445) [-533.783] -- 0:00:54
128000 -- [-531.907] (-533.492) (-536.963) (-533.537) * (-532.767) [-531.674] (-532.842) (-534.883) -- 0:00:54
128500 -- [-529.647] (-534.391) (-537.638) (-534.582) * [-532.405] (-533.470) (-535.815) (-531.862) -- 0:00:54
129000 -- (-533.558) [-536.721] (-534.466) (-530.736) * (-531.367) (-534.682) [-532.191] (-534.013) -- 0:00:54
129500 -- (-531.265) (-539.343) [-532.633] (-533.760) * (-533.195) (-533.586) [-531.899] (-534.958) -- 0:00:53
130000 -- [-532.202] (-532.423) (-533.354) (-532.049) * (-533.024) (-533.171) [-529.912] (-533.210) -- 0:00:53
Average standard deviation of split frequencies: 0.018798
130500 -- [-533.690] (-533.629) (-533.792) (-530.633) * (-535.470) (-533.171) (-531.455) [-530.523] -- 0:00:53
131000 -- (-533.960) (-534.288) (-532.263) [-534.606] * (-533.842) (-532.727) [-535.785] (-530.870) -- 0:00:53
131500 -- (-533.702) (-533.756) [-532.201] (-533.052) * (-530.876) (-535.604) (-537.069) [-531.299] -- 0:00:52
132000 -- (-537.093) (-535.739) [-532.812] (-531.535) * (-533.404) [-534.202] (-531.348) (-534.912) -- 0:00:52
132500 -- (-537.532) (-531.936) [-532.525] (-532.432) * (-534.544) (-532.448) (-531.220) [-531.122] -- 0:00:52
133000 -- [-534.867] (-533.498) (-535.280) (-532.734) * (-532.874) [-531.976] (-532.786) (-537.582) -- 0:00:52
133500 -- (-532.495) (-532.297) [-530.909] (-533.372) * (-533.729) [-532.385] (-532.283) (-531.313) -- 0:00:51
134000 -- (-534.593) [-533.737] (-532.261) (-532.000) * (-533.021) (-533.565) [-531.520] (-532.499) -- 0:00:51
134500 -- (-532.986) (-536.833) (-533.699) [-536.355] * (-532.393) (-531.238) [-534.052] (-533.810) -- 0:00:51
135000 -- [-536.179] (-533.872) (-533.178) (-536.260) * (-532.877) (-533.945) (-531.621) [-536.224] -- 0:00:51
Average standard deviation of split frequencies: 0.017513
135500 -- (-531.441) [-534.890] (-531.715) (-535.146) * [-532.332] (-532.411) (-532.572) (-536.085) -- 0:00:51
136000 -- [-533.206] (-543.205) (-534.089) (-532.327) * (-534.248) (-531.440) [-532.155] (-534.232) -- 0:00:50
136500 -- (-531.156) (-539.644) [-534.046] (-533.203) * (-533.644) [-531.100] (-533.157) (-533.939) -- 0:00:50
137000 -- [-531.904] (-534.283) (-533.344) (-531.622) * [-533.757] (-532.369) (-532.733) (-534.875) -- 0:00:50
137500 -- (-540.855) (-534.065) (-533.584) [-533.972] * (-531.809) (-530.925) [-532.401] (-536.024) -- 0:00:50
138000 -- (-534.377) [-533.542] (-531.197) (-530.476) * (-531.777) (-534.358) [-533.387] (-531.977) -- 0:00:56
138500 -- (-534.852) [-532.089] (-531.142) (-531.292) * (-534.284) (-535.991) (-533.692) [-532.387] -- 0:00:55
139000 -- (-531.807) (-534.548) (-533.292) [-530.477] * (-537.981) [-531.401] (-534.082) (-534.200) -- 0:00:55
139500 -- (-530.094) (-534.355) (-535.019) [-531.578] * [-530.964] (-533.015) (-533.709) (-534.442) -- 0:00:55
140000 -- (-532.688) (-534.850) [-532.756] (-535.197) * (-536.322) (-533.118) [-534.345] (-536.939) -- 0:00:55
Average standard deviation of split frequencies: 0.017814
140500 -- (-534.917) [-533.422] (-531.944) (-532.596) * (-534.222) [-532.925] (-535.750) (-539.032) -- 0:00:55
141000 -- (-533.616) (-532.559) (-536.705) [-532.139] * (-533.426) (-532.461) (-535.243) [-534.391] -- 0:00:54
141500 -- (-536.581) (-537.088) (-533.815) [-532.312] * (-533.303) (-532.288) (-535.757) [-533.918] -- 0:00:54
142000 -- [-533.011] (-533.060) (-534.451) (-533.100) * [-539.372] (-532.961) (-531.600) (-534.034) -- 0:00:54
142500 -- [-532.007] (-531.743) (-535.326) (-531.021) * (-538.732) [-533.325] (-532.274) (-533.390) -- 0:00:54
143000 -- (-530.519) (-531.481) (-535.996) [-534.006] * (-536.266) (-531.238) (-533.749) [-532.281] -- 0:00:53
143500 -- (-533.397) (-531.559) (-532.990) [-530.737] * (-531.641) (-530.050) [-533.113] (-538.180) -- 0:00:53
144000 -- (-531.551) [-535.067] (-533.420) (-533.686) * (-531.226) (-532.914) [-536.216] (-536.486) -- 0:00:53
144500 -- (-531.719) [-532.546] (-532.721) (-532.416) * [-534.279] (-530.509) (-535.687) (-533.002) -- 0:00:53
145000 -- (-532.905) (-533.353) [-530.213] (-532.457) * [-533.488] (-530.843) (-531.645) (-532.692) -- 0:00:53
Average standard deviation of split frequencies: 0.016144
145500 -- (-534.960) (-533.224) (-532.730) [-531.730] * (-535.459) [-531.110] (-536.147) (-533.017) -- 0:00:52
146000 -- (-533.923) [-538.889] (-533.701) (-531.806) * (-531.390) (-531.434) [-534.887] (-534.777) -- 0:00:52
146500 -- (-532.042) [-532.863] (-532.439) (-532.441) * (-532.633) [-532.118] (-539.911) (-533.968) -- 0:00:52
147000 -- (-534.257) (-533.578) [-534.821] (-533.916) * (-534.116) (-531.051) (-536.904) [-533.229] -- 0:00:52
147500 -- (-532.048) (-535.085) [-535.463] (-534.338) * (-536.452) (-532.562) [-534.298] (-532.318) -- 0:00:52
148000 -- (-532.557) (-535.362) (-533.722) [-532.963] * (-538.594) (-532.050) [-532.370] (-532.297) -- 0:00:51
148500 -- (-532.036) (-534.970) (-531.880) [-531.692] * (-536.093) [-534.598] (-532.443) (-531.837) -- 0:00:51
149000 -- (-534.295) [-533.881] (-535.561) (-534.606) * (-533.851) [-532.142] (-533.585) (-532.751) -- 0:00:51
149500 -- (-531.732) [-538.956] (-535.234) (-536.979) * [-532.475] (-532.454) (-533.475) (-531.989) -- 0:00:51
150000 -- (-532.908) [-532.570] (-532.875) (-532.990) * (-534.736) [-533.032] (-538.128) (-532.737) -- 0:00:51
Average standard deviation of split frequencies: 0.017620
150500 -- (-531.972) [-532.778] (-533.384) (-532.643) * (-532.486) (-535.308) (-535.284) [-535.381] -- 0:00:50
151000 -- (-534.151) [-531.773] (-531.232) (-535.820) * (-531.881) [-538.488] (-534.521) (-538.144) -- 0:00:50
151500 -- (-533.198) (-536.143) [-532.399] (-531.884) * [-535.442] (-532.373) (-535.237) (-531.228) -- 0:00:50
152000 -- (-532.381) (-531.448) [-534.111] (-535.032) * (-532.543) (-531.188) (-532.662) [-534.942] -- 0:00:50
152500 -- [-534.363] (-531.851) (-535.179) (-534.978) * (-540.009) [-534.636] (-532.926) (-536.093) -- 0:00:50
153000 -- (-530.512) (-531.758) (-532.854) [-534.675] * (-531.217) [-533.813] (-533.159) (-530.552) -- 0:00:49
153500 -- [-532.974] (-532.677) (-535.170) (-535.249) * (-534.087) (-535.127) (-533.971) [-532.356] -- 0:00:49
154000 -- [-533.041] (-531.465) (-532.469) (-532.519) * (-533.815) (-535.405) [-530.977] (-533.313) -- 0:00:54
154500 -- (-538.491) [-534.725] (-531.949) (-532.706) * [-533.983] (-534.857) (-533.871) (-532.096) -- 0:00:54
155000 -- [-534.734] (-539.090) (-532.998) (-531.948) * (-531.406) (-533.213) [-532.622] (-534.248) -- 0:00:54
Average standard deviation of split frequencies: 0.013996
155500 -- (-534.768) (-533.821) [-532.130] (-532.778) * (-531.999) (-532.732) [-533.953] (-530.955) -- 0:00:54
156000 -- (-531.755) (-534.414) (-531.199) [-530.516] * (-535.129) (-537.092) (-534.399) [-532.956] -- 0:00:54
156500 -- (-530.707) [-535.831] (-535.363) (-532.240) * (-539.175) (-534.046) [-532.572] (-533.452) -- 0:00:53
157000 -- (-532.768) (-535.941) [-535.709] (-531.648) * (-538.586) (-532.036) (-532.700) [-531.662] -- 0:00:53
157500 -- (-534.774) (-535.301) (-533.226) [-531.672] * (-537.064) [-532.090] (-536.014) (-531.639) -- 0:00:53
158000 -- (-532.389) [-531.994] (-535.232) (-533.560) * [-533.439] (-532.381) (-533.013) (-530.945) -- 0:00:53
158500 -- [-531.274] (-533.806) (-534.983) (-532.891) * (-532.895) (-537.607) (-534.035) [-531.194] -- 0:00:53
159000 -- (-529.900) [-532.257] (-532.447) (-534.401) * (-532.207) (-532.380) [-533.406] (-531.612) -- 0:00:52
159500 -- [-529.964] (-534.709) (-534.173) (-533.118) * [-532.538] (-533.521) (-534.907) (-532.428) -- 0:00:52
160000 -- (-532.219) (-534.489) [-532.473] (-534.404) * (-533.608) (-534.078) [-534.673] (-530.877) -- 0:00:52
Average standard deviation of split frequencies: 0.013692
160500 -- (-533.122) [-532.396] (-534.670) (-534.407) * (-533.126) [-530.842] (-531.058) (-532.845) -- 0:00:52
161000 -- (-535.370) [-534.236] (-533.350) (-535.527) * (-533.489) (-537.978) (-534.163) [-530.866] -- 0:00:52
161500 -- (-532.539) [-533.047] (-531.700) (-532.553) * (-537.544) [-534.568] (-533.145) (-530.570) -- 0:00:51
162000 -- (-533.129) (-534.738) [-532.790] (-538.048) * (-534.968) [-531.132] (-533.919) (-534.334) -- 0:00:51
162500 -- (-530.558) (-533.970) [-532.943] (-532.981) * (-536.449) (-532.478) (-535.107) [-532.856] -- 0:00:51
163000 -- (-532.788) (-533.545) [-531.847] (-533.086) * (-532.985) [-532.854] (-533.475) (-537.077) -- 0:00:51
163500 -- (-531.372) (-532.938) [-531.923] (-534.257) * (-536.192) (-530.506) [-532.088] (-536.120) -- 0:00:51
164000 -- (-539.168) (-533.047) [-531.296] (-533.502) * (-540.260) (-531.409) (-532.001) [-531.730] -- 0:00:50
164500 -- [-530.631] (-538.167) (-534.613) (-535.581) * (-541.061) (-531.334) (-534.729) [-539.792] -- 0:00:50
165000 -- (-532.641) (-535.139) [-533.157] (-532.890) * (-534.325) (-531.715) (-535.786) [-535.815] -- 0:00:50
Average standard deviation of split frequencies: 0.014199
165500 -- (-533.173) (-536.840) (-534.132) [-534.675] * [-533.101] (-532.639) (-533.525) (-534.614) -- 0:00:50
166000 -- (-532.012) (-533.090) (-535.804) [-533.854] * (-534.272) (-533.810) [-533.328] (-531.265) -- 0:00:50
166500 -- (-531.331) (-532.642) [-534.739] (-536.165) * (-535.824) (-535.265) (-536.526) [-533.940] -- 0:00:50
167000 -- [-532.937] (-533.521) (-534.354) (-532.817) * (-537.359) (-534.081) (-533.320) [-535.930] -- 0:00:49
167500 -- [-530.818] (-532.156) (-533.813) (-534.361) * (-533.808) (-533.926) [-532.192] (-538.378) -- 0:00:49
168000 -- (-535.787) [-532.470] (-533.399) (-535.109) * (-533.530) (-533.483) [-535.733] (-535.724) -- 0:00:49
168500 -- (-534.139) (-533.839) [-532.517] (-538.958) * (-532.539) [-537.619] (-534.751) (-532.573) -- 0:00:49
169000 -- (-534.277) [-534.579] (-533.797) (-533.373) * (-531.491) (-532.619) [-532.599] (-533.213) -- 0:00:49
169500 -- [-532.421] (-532.755) (-535.998) (-532.329) * (-537.276) (-530.025) [-532.977] (-532.825) -- 0:00:53
170000 -- (-535.451) [-531.795] (-536.909) (-534.657) * (-534.220) (-533.144) [-533.311] (-534.465) -- 0:00:53
Average standard deviation of split frequencies: 0.014731
170500 -- [-532.151] (-533.789) (-534.968) (-535.379) * (-534.990) (-533.711) (-533.319) [-534.424] -- 0:00:53
171000 -- (-533.262) [-533.297] (-542.387) (-536.916) * (-534.324) (-533.223) (-533.236) [-530.839] -- 0:00:53
171500 -- (-537.276) [-532.997] (-538.476) (-532.352) * (-533.544) (-532.662) (-535.129) [-531.015] -- 0:00:53
172000 -- (-530.826) (-539.757) [-533.436] (-531.466) * (-534.406) (-532.682) [-533.064] (-530.230) -- 0:00:52
172500 -- (-533.333) (-533.254) (-534.171) [-533.764] * (-534.866) (-534.783) (-531.960) [-530.609] -- 0:00:52
173000 -- [-532.215] (-533.182) (-535.118) (-534.045) * (-532.647) (-533.188) (-535.443) [-530.993] -- 0:00:52
173500 -- (-532.570) [-533.794] (-535.698) (-536.761) * [-533.963] (-532.954) (-536.831) (-532.862) -- 0:00:52
174000 -- (-531.088) (-534.770) [-532.743] (-531.241) * (-534.028) (-532.537) (-533.328) [-531.107] -- 0:00:52
174500 -- (-530.937) [-532.614] (-533.166) (-532.141) * (-532.791) (-533.837) [-531.752] (-533.429) -- 0:00:52
175000 -- (-531.304) [-531.730] (-536.667) (-534.930) * (-533.396) (-535.106) [-534.108] (-533.245) -- 0:00:51
Average standard deviation of split frequencies: 0.013815
175500 -- (-534.141) (-537.582) [-533.846] (-533.973) * (-532.965) (-533.076) [-532.429] (-534.710) -- 0:00:51
176000 -- (-533.463) [-531.652] (-535.030) (-535.687) * (-537.451) (-540.135) [-533.038] (-533.391) -- 0:00:51
176500 -- [-532.538] (-532.796) (-534.023) (-532.173) * [-532.729] (-538.157) (-533.880) (-533.648) -- 0:00:51
177000 -- [-532.882] (-534.090) (-532.800) (-535.145) * (-533.612) (-534.478) (-534.582) [-531.013] -- 0:00:51
177500 -- [-538.042] (-534.323) (-534.931) (-535.179) * (-533.437) [-535.057] (-533.538) (-532.335) -- 0:00:50
178000 -- [-534.165] (-535.312) (-536.229) (-534.019) * (-535.330) [-537.530] (-533.184) (-532.206) -- 0:00:50
178500 -- (-534.014) (-533.135) [-536.079] (-532.461) * (-533.511) (-533.813) (-536.809) [-533.260] -- 0:00:50
179000 -- (-531.181) [-536.351] (-533.490) (-533.284) * (-531.493) (-531.721) (-534.584) [-530.710] -- 0:00:50
179500 -- (-535.506) (-534.335) (-532.843) [-537.121] * (-536.840) (-532.570) (-532.493) [-534.064] -- 0:00:50
180000 -- (-532.336) (-531.501) (-535.185) [-531.968] * (-532.438) (-533.216) [-532.653] (-532.977) -- 0:00:50
Average standard deviation of split frequencies: 0.013046
180500 -- [-531.543] (-531.999) (-535.667) (-530.691) * (-534.036) [-531.762] (-534.328) (-534.919) -- 0:00:49
181000 -- (-536.376) (-533.581) [-535.231] (-533.167) * (-534.596) (-531.196) [-533.229] (-532.318) -- 0:00:49
181500 -- (-537.947) [-532.061] (-535.377) (-532.574) * (-535.993) (-534.384) (-535.618) [-536.278] -- 0:00:49
182000 -- (-531.608) (-537.774) (-535.687) [-531.338] * (-537.716) (-536.679) (-532.423) [-535.137] -- 0:00:49
182500 -- (-532.070) (-535.648) (-532.310) [-533.792] * (-532.136) (-534.178) [-531.581] (-533.793) -- 0:00:49
183000 -- (-532.282) (-534.931) (-534.760) [-532.758] * [-533.687] (-537.070) (-535.288) (-532.612) -- 0:00:49
183500 -- (-534.439) (-535.152) (-534.277) [-532.383] * (-534.879) (-538.328) [-531.636] (-532.399) -- 0:00:48
184000 -- (-532.993) (-534.918) [-533.883] (-532.411) * (-534.408) [-533.709] (-532.044) (-532.839) -- 0:00:48
184500 -- [-534.439] (-533.551) (-534.426) (-536.272) * (-532.804) (-533.391) [-532.347] (-530.834) -- 0:00:48
185000 -- (-534.198) (-530.595) (-532.001) [-530.338] * (-533.547) (-531.518) [-535.331] (-534.127) -- 0:00:48
Average standard deviation of split frequencies: 0.013235
185500 -- (-534.142) (-534.624) [-537.948] (-533.045) * (-534.669) (-531.586) [-534.181] (-533.930) -- 0:00:52
186000 -- [-533.388] (-536.052) (-532.991) (-537.570) * (-532.609) [-531.361] (-533.110) (-533.781) -- 0:00:52
186500 -- (-531.943) [-533.587] (-533.758) (-533.003) * (-533.734) [-532.328] (-532.325) (-536.397) -- 0:00:52
187000 -- [-533.570] (-532.900) (-533.863) (-530.675) * [-532.107] (-532.442) (-534.272) (-534.225) -- 0:00:52
187500 -- (-533.836) (-534.323) (-533.847) [-530.276] * (-532.315) [-531.047] (-531.276) (-529.931) -- 0:00:52
188000 -- (-533.095) (-533.306) (-533.182) [-531.091] * [-534.144] (-530.404) (-535.197) (-531.008) -- 0:00:51
188500 -- [-534.940] (-536.789) (-532.065) (-531.629) * (-533.358) (-531.223) [-536.880] (-534.348) -- 0:00:51
189000 -- (-536.005) (-534.813) [-534.000] (-535.596) * (-538.177) (-532.163) (-533.306) [-532.819] -- 0:00:51
189500 -- (-530.955) (-533.381) [-534.876] (-532.663) * (-533.828) [-532.621] (-536.867) (-531.520) -- 0:00:51
190000 -- [-532.450] (-537.600) (-532.234) (-532.033) * (-533.335) [-532.772] (-534.372) (-533.490) -- 0:00:51
Average standard deviation of split frequencies: 0.014314
190500 -- [-531.327] (-534.098) (-531.692) (-531.720) * (-532.543) [-529.890] (-534.555) (-532.928) -- 0:00:50
191000 -- (-532.438) (-534.877) (-534.346) [-532.531] * (-532.233) (-537.298) [-532.084] (-532.454) -- 0:00:50
191500 -- (-532.100) (-533.368) [-532.256] (-534.004) * (-533.058) (-533.934) (-533.302) [-533.486] -- 0:00:50
192000 -- (-531.723) (-533.846) (-537.471) [-532.223] * (-534.071) (-532.044) (-536.726) [-533.566] -- 0:00:50
192500 -- (-534.091) (-536.343) (-533.592) [-533.602] * (-534.712) [-532.581] (-532.306) (-530.746) -- 0:00:50
193000 -- (-534.332) (-532.341) (-535.303) [-530.571] * [-536.119] (-534.072) (-534.309) (-531.803) -- 0:00:50
193500 -- (-531.843) (-536.138) [-532.108] (-534.249) * [-531.731] (-533.942) (-535.928) (-532.593) -- 0:00:50
194000 -- (-531.660) (-534.089) [-533.615] (-535.013) * (-532.789) [-532.884] (-534.979) (-532.769) -- 0:00:49
194500 -- (-540.047) (-534.258) [-536.084] (-532.347) * [-531.238] (-533.305) (-533.251) (-532.498) -- 0:00:49
195000 -- (-538.250) [-532.922] (-534.197) (-536.035) * [-532.862] (-535.333) (-534.857) (-532.718) -- 0:00:49
Average standard deviation of split frequencies: 0.016301
195500 -- (-531.882) (-536.293) (-537.010) [-531.516] * (-534.160) (-533.461) (-533.913) [-533.807] -- 0:00:49
196000 -- [-531.165] (-537.417) (-534.888) (-533.001) * (-530.741) (-536.527) [-532.902] (-532.862) -- 0:00:49
196500 -- (-532.653) (-536.465) [-533.631] (-535.095) * [-533.502] (-536.837) (-534.334) (-538.262) -- 0:00:49
197000 -- (-534.370) [-533.575] (-536.987) (-532.649) * [-532.304] (-535.281) (-535.057) (-540.962) -- 0:00:48
197500 -- (-537.012) (-536.057) [-531.369] (-534.853) * (-534.075) (-531.773) (-533.102) [-537.914] -- 0:00:48
198000 -- [-531.843] (-533.409) (-530.847) (-537.298) * (-536.898) [-531.733] (-534.083) (-536.709) -- 0:00:48
198500 -- (-532.394) [-534.638] (-531.094) (-540.891) * [-534.066] (-531.929) (-533.925) (-536.941) -- 0:00:48
199000 -- [-531.455] (-534.345) (-533.131) (-537.930) * (-533.945) (-535.650) (-533.451) [-534.778] -- 0:00:48
199500 -- (-534.549) [-533.068] (-535.341) (-537.475) * [-537.686] (-531.183) (-536.851) (-532.913) -- 0:00:48
200000 -- (-531.135) (-532.783) (-534.732) [-532.028] * (-533.376) (-534.534) [-531.334] (-532.854) -- 0:00:48
Average standard deviation of split frequencies: 0.017488
200500 -- [-531.049] (-534.905) (-534.419) (-534.187) * (-532.592) (-532.810) [-532.265] (-531.009) -- 0:00:47
201000 -- [-533.036] (-531.718) (-532.915) (-536.508) * (-535.138) [-530.644] (-535.034) (-537.132) -- 0:00:47
201500 -- (-532.581) [-535.222] (-532.777) (-538.843) * (-532.917) (-533.670) [-534.208] (-535.572) -- 0:00:51
202000 -- [-534.020] (-535.927) (-533.277) (-532.605) * (-530.851) (-532.083) (-532.207) [-536.192] -- 0:00:51
202500 -- (-532.214) [-532.023] (-534.977) (-535.905) * (-534.755) [-531.305] (-532.818) (-532.444) -- 0:00:51
203000 -- (-533.413) [-533.947] (-532.263) (-537.751) * [-533.525] (-532.941) (-531.074) (-533.655) -- 0:00:51
203500 -- (-532.613) (-534.354) [-531.376] (-535.511) * (-540.908) [-531.975] (-535.754) (-532.572) -- 0:00:50
204000 -- (-534.902) [-532.530] (-535.215) (-534.246) * (-534.547) (-534.057) (-532.191) [-533.021] -- 0:00:50
204500 -- [-533.452] (-532.178) (-538.344) (-535.182) * (-534.781) (-532.172) (-532.250) [-534.207] -- 0:00:50
205000 -- (-534.915) [-532.745] (-534.093) (-538.453) * (-533.988) (-533.296) [-530.977] (-531.665) -- 0:00:50
Average standard deviation of split frequencies: 0.017163
205500 -- (-532.617) (-532.205) [-532.406] (-534.260) * (-532.604) (-535.444) (-530.811) [-532.598] -- 0:00:50
206000 -- [-534.313] (-533.861) (-532.278) (-539.515) * [-535.479] (-531.819) (-532.089) (-534.799) -- 0:00:50
206500 -- [-531.175] (-535.272) (-534.470) (-539.049) * (-532.468) (-533.380) [-532.876] (-534.049) -- 0:00:49
207000 -- [-531.463] (-531.298) (-533.486) (-533.056) * (-531.747) (-533.779) [-532.828] (-531.982) -- 0:00:49
207500 -- (-531.338) [-534.496] (-534.941) (-536.457) * (-531.391) [-532.971] (-531.686) (-532.000) -- 0:00:49
208000 -- [-531.484] (-537.061) (-532.155) (-532.879) * (-538.379) (-533.760) [-533.618] (-533.546) -- 0:00:49
208500 -- [-533.978] (-535.676) (-534.405) (-536.485) * [-535.170] (-538.980) (-534.296) (-533.117) -- 0:00:49
209000 -- (-533.572) (-536.061) [-533.755] (-534.737) * (-531.920) [-536.635] (-530.498) (-536.461) -- 0:00:49
209500 -- [-537.048] (-531.117) (-535.533) (-532.677) * [-538.875] (-534.548) (-534.403) (-532.069) -- 0:00:49
210000 -- [-536.461] (-532.200) (-536.755) (-535.064) * (-534.997) (-536.764) (-532.347) [-529.879] -- 0:00:48
Average standard deviation of split frequencies: 0.018274
210500 -- [-532.173] (-533.439) (-534.802) (-532.204) * (-536.032) [-531.910] (-532.998) (-537.856) -- 0:00:48
211000 -- [-531.613] (-534.007) (-534.130) (-531.079) * (-532.702) (-534.819) (-532.534) [-530.735] -- 0:00:48
211500 -- (-530.017) (-533.272) (-533.334) [-532.146] * (-537.345) (-531.040) (-533.238) [-534.314] -- 0:00:48
212000 -- (-532.958) (-535.015) (-537.787) [-533.449] * (-531.402) [-532.249] (-537.467) (-532.909) -- 0:00:48
212500 -- (-536.342) (-533.627) (-534.671) [-535.824] * (-532.320) [-532.863] (-534.720) (-533.945) -- 0:00:48
213000 -- (-530.036) (-534.958) (-532.834) [-531.459] * (-532.791) [-535.581] (-533.237) (-532.471) -- 0:00:48
213500 -- (-531.728) (-532.860) (-532.430) [-534.537] * [-532.734] (-534.010) (-534.728) (-532.548) -- 0:00:47
214000 -- (-538.168) (-533.158) (-532.337) [-533.759] * [-532.121] (-533.878) (-538.723) (-532.822) -- 0:00:47
214500 -- [-532.867] (-535.646) (-534.510) (-538.258) * (-534.922) (-531.754) (-534.715) [-531.626] -- 0:00:47
215000 -- [-533.769] (-535.973) (-533.329) (-534.705) * (-530.305) (-534.873) [-535.404] (-533.224) -- 0:00:47
Average standard deviation of split frequencies: 0.017459
215500 -- (-534.807) (-536.791) [-535.716] (-531.481) * (-531.473) [-532.269] (-534.086) (-532.860) -- 0:00:47
216000 -- [-532.470] (-541.593) (-531.913) (-533.422) * (-533.097) (-534.191) [-531.331] (-537.999) -- 0:00:47
216500 -- (-532.889) (-536.926) [-533.419] (-535.738) * (-532.943) [-533.778] (-537.089) (-531.234) -- 0:00:47
217000 -- [-536.399] (-535.373) (-532.018) (-537.111) * [-531.569] (-533.328) (-534.765) (-536.454) -- 0:00:50
217500 -- (-530.719) [-533.887] (-533.464) (-532.105) * (-531.280) [-533.663] (-531.587) (-533.925) -- 0:00:50
218000 -- (-530.647) (-535.070) [-532.304] (-533.713) * (-534.352) (-532.432) (-534.764) [-531.681] -- 0:00:50
218500 -- (-536.592) (-534.792) [-533.745] (-533.302) * [-531.994] (-536.719) (-531.519) (-532.152) -- 0:00:50
219000 -- [-535.884] (-532.914) (-532.952) (-538.135) * (-532.064) (-536.260) (-535.821) [-530.673] -- 0:00:49
219500 -- (-532.348) (-534.668) (-533.862) [-535.049] * (-531.830) [-537.581] (-534.986) (-535.597) -- 0:00:49
220000 -- (-531.908) (-533.800) (-532.627) [-531.484] * [-531.093] (-535.067) (-533.797) (-533.150) -- 0:00:49
Average standard deviation of split frequencies: 0.018040
220500 -- (-534.754) (-533.241) [-532.152] (-534.000) * [-531.885] (-532.076) (-531.651) (-532.381) -- 0:00:49
221000 -- (-535.198) (-536.207) (-532.901) [-538.426] * (-532.906) (-532.576) (-533.976) [-538.507] -- 0:00:49
221500 -- (-536.698) (-534.241) [-533.111] (-531.788) * (-534.138) (-532.593) [-532.929] (-533.476) -- 0:00:49
222000 -- (-534.088) (-533.451) (-540.342) [-530.953] * (-536.397) (-536.037) [-533.691] (-530.706) -- 0:00:49
222500 -- (-532.709) [-531.885] (-538.590) (-531.818) * (-535.159) (-537.782) [-533.890] (-533.818) -- 0:00:48
223000 -- (-534.076) [-530.583] (-539.257) (-532.196) * (-534.047) (-532.325) [-533.826] (-531.273) -- 0:00:48
223500 -- (-532.504) [-532.793] (-534.515) (-533.678) * [-533.743] (-534.146) (-531.104) (-534.788) -- 0:00:48
224000 -- (-532.371) (-536.009) (-534.090) [-532.443] * (-538.038) [-532.663] (-531.837) (-539.620) -- 0:00:48
224500 -- (-538.537) [-531.047] (-538.358) (-531.707) * (-531.688) [-533.136] (-531.984) (-533.494) -- 0:00:48
225000 -- (-532.614) (-531.260) [-534.573] (-531.076) * [-533.022] (-535.429) (-532.134) (-532.119) -- 0:00:48
Average standard deviation of split frequencies: 0.017675
225500 -- (-533.440) [-533.589] (-540.587) (-531.699) * (-533.339) (-533.455) (-533.396) [-530.946] -- 0:00:48
226000 -- (-533.312) (-533.132) (-533.903) [-532.772] * (-534.041) (-532.045) [-533.292] (-533.622) -- 0:00:47
226500 -- (-534.659) [-532.894] (-534.066) (-533.472) * (-531.633) (-532.804) (-532.004) [-531.939] -- 0:00:47
227000 -- (-537.944) (-532.563) [-532.807] (-534.683) * (-533.864) (-534.404) [-533.411] (-532.294) -- 0:00:47
227500 -- [-534.324] (-534.368) (-534.290) (-535.641) * (-534.568) (-535.524) (-535.663) [-534.110] -- 0:00:47
228000 -- (-534.122) [-532.236] (-534.424) (-535.361) * [-534.781] (-532.884) (-536.035) (-533.486) -- 0:00:47
228500 -- (-535.225) (-534.659) (-534.695) [-532.352] * (-534.626) (-536.642) (-533.428) [-530.326] -- 0:00:47
229000 -- (-531.460) (-535.789) (-534.801) [-532.103] * (-533.342) (-531.120) (-531.035) [-533.586] -- 0:00:47
229500 -- (-534.506) (-534.264) (-532.548) [-531.327] * [-533.415] (-534.388) (-534.317) (-532.231) -- 0:00:47
230000 -- [-533.777] (-534.829) (-533.791) (-533.795) * (-532.463) (-535.423) (-534.066) [-531.798] -- 0:00:46
Average standard deviation of split frequencies: 0.017780
230500 -- [-532.514] (-534.991) (-534.678) (-534.222) * [-532.382] (-536.372) (-531.391) (-532.405) -- 0:00:46
231000 -- [-535.719] (-533.236) (-532.758) (-531.551) * (-532.058) [-536.567] (-531.431) (-534.390) -- 0:00:46
231500 -- (-531.763) (-538.713) [-533.384] (-533.579) * [-532.413] (-534.554) (-531.486) (-533.729) -- 0:00:46
232000 -- (-531.881) [-532.676] (-533.555) (-534.753) * (-532.539) [-534.255] (-532.216) (-532.515) -- 0:00:46
232500 -- (-534.537) [-532.867] (-535.593) (-531.707) * [-534.231] (-533.173) (-536.248) (-532.676) -- 0:00:46
233000 -- [-533.947] (-534.151) (-535.022) (-532.811) * [-531.935] (-533.675) (-534.446) (-533.735) -- 0:00:49
233500 -- (-534.507) (-533.568) [-535.624] (-537.430) * (-534.539) (-532.884) (-534.388) [-534.805] -- 0:00:49
234000 -- (-533.580) (-531.381) [-536.443] (-533.497) * [-531.777] (-532.892) (-532.277) (-532.058) -- 0:00:49
234500 -- (-536.638) (-533.290) (-534.075) [-532.559] * [-531.946] (-532.928) (-532.687) (-531.833) -- 0:00:48
235000 -- (-530.645) (-534.959) (-534.015) [-532.850] * (-533.383) (-535.566) (-532.102) [-531.947] -- 0:00:48
Average standard deviation of split frequencies: 0.018577
235500 -- (-532.635) [-531.734] (-533.342) (-531.253) * (-534.887) (-534.291) [-532.155] (-532.525) -- 0:00:48
236000 -- [-531.961] (-532.774) (-537.617) (-532.977) * (-536.540) (-537.709) (-531.822) [-533.054] -- 0:00:48
236500 -- (-534.408) (-537.447) (-533.965) [-536.041] * [-533.133] (-534.235) (-536.539) (-532.008) -- 0:00:48
237000 -- (-537.829) (-534.032) [-533.791] (-533.929) * [-531.901] (-532.992) (-532.975) (-533.693) -- 0:00:48
237500 -- (-536.254) (-532.243) [-533.518] (-535.698) * (-533.132) (-533.378) [-535.139] (-537.607) -- 0:00:48
238000 -- (-538.087) [-533.692] (-533.168) (-538.155) * (-534.349) (-532.986) [-531.111] (-534.720) -- 0:00:48
238500 -- (-533.859) (-534.159) [-532.624] (-534.955) * [-534.202] (-534.330) (-533.966) (-534.349) -- 0:00:47
239000 -- [-532.675] (-531.917) (-533.223) (-533.518) * (-535.602) (-537.505) [-530.930] (-533.692) -- 0:00:47
239500 -- (-535.273) (-535.675) (-535.622) [-536.093] * (-533.552) (-537.237) (-536.047) [-533.810] -- 0:00:47
240000 -- (-534.305) (-530.670) [-533.455] (-535.511) * (-535.094) [-533.717] (-531.996) (-531.502) -- 0:00:47
Average standard deviation of split frequencies: 0.020349
240500 -- (-532.404) (-537.379) [-533.858] (-535.354) * [-532.186] (-532.457) (-533.490) (-536.501) -- 0:00:47
241000 -- (-532.174) (-533.213) (-534.357) [-533.740] * [-532.385] (-534.082) (-532.130) (-534.222) -- 0:00:47
241500 -- [-533.320] (-533.320) (-533.919) (-536.935) * [-531.743] (-534.359) (-533.285) (-535.520) -- 0:00:47
242000 -- (-533.752) (-532.577) [-534.596] (-535.439) * (-533.404) (-533.687) (-532.083) [-529.776] -- 0:00:46
242500 -- (-535.885) [-533.289] (-538.418) (-533.476) * [-532.918] (-535.008) (-536.646) (-532.720) -- 0:00:46
243000 -- (-532.929) (-536.622) [-533.536] (-533.370) * (-540.424) (-534.724) (-534.605) [-531.691] -- 0:00:46
243500 -- (-533.007) (-536.544) (-537.176) [-533.982] * (-533.916) [-532.256] (-533.722) (-530.559) -- 0:00:46
244000 -- (-536.464) (-532.555) (-533.271) [-535.382] * [-533.045] (-537.425) (-533.169) (-531.568) -- 0:00:46
244500 -- (-534.521) [-532.111] (-537.492) (-532.953) * [-532.091] (-533.456) (-533.216) (-531.355) -- 0:00:46
245000 -- (-533.811) (-532.926) (-532.538) [-532.518] * [-534.857] (-534.020) (-533.408) (-534.365) -- 0:00:46
Average standard deviation of split frequencies: 0.019345
245500 -- (-532.810) [-531.788] (-530.613) (-533.083) * (-532.977) (-536.805) (-534.946) [-531.462] -- 0:00:46
246000 -- [-534.262] (-533.435) (-532.850) (-533.748) * [-534.479] (-534.383) (-534.893) (-533.205) -- 0:00:45
246500 -- (-531.042) (-536.430) [-535.502] (-534.824) * (-536.842) (-533.408) [-532.610] (-534.538) -- 0:00:45
247000 -- (-536.246) (-532.621) (-532.318) [-534.888] * [-536.382] (-532.608) (-533.901) (-532.144) -- 0:00:45
247500 -- [-534.899] (-531.958) (-535.121) (-536.847) * (-533.607) (-536.555) [-535.551] (-532.520) -- 0:00:45
248000 -- [-532.022] (-533.346) (-533.361) (-538.995) * [-532.977] (-532.589) (-534.754) (-532.351) -- 0:00:45
248500 -- (-531.768) [-532.720] (-536.566) (-533.057) * (-534.638) (-533.844) (-534.636) [-531.300] -- 0:00:45
249000 -- [-534.730] (-535.103) (-533.977) (-533.542) * [-532.784] (-537.951) (-533.820) (-534.350) -- 0:00:48
249500 -- (-533.020) (-532.868) (-533.350) [-534.115] * (-532.323) (-535.330) (-533.215) [-531.484] -- 0:00:48
250000 -- (-536.517) (-532.698) (-533.899) [-533.501] * (-540.811) (-535.061) [-532.912] (-533.319) -- 0:00:48
Average standard deviation of split frequencies: 0.020311
250500 -- (-534.104) [-537.372] (-534.213) (-537.686) * (-532.748) [-533.806] (-533.151) (-532.211) -- 0:00:47
251000 -- (-536.882) (-537.172) [-533.763] (-535.515) * [-533.199] (-535.454) (-532.919) (-533.026) -- 0:00:47
251500 -- (-533.248) (-537.137) [-533.948] (-530.984) * [-534.388] (-533.477) (-532.445) (-533.183) -- 0:00:47
252000 -- (-537.176) (-534.815) (-531.100) [-533.999] * (-533.395) (-534.931) (-532.497) [-536.709] -- 0:00:47
252500 -- [-532.596] (-532.677) (-533.124) (-533.628) * [-535.072] (-534.915) (-536.311) (-534.142) -- 0:00:47
253000 -- (-533.585) [-531.837] (-531.275) (-531.396) * (-535.523) (-534.363) (-534.369) [-533.233] -- 0:00:47
253500 -- [-531.931] (-534.817) (-532.231) (-532.905) * (-534.963) (-537.572) [-533.869] (-532.541) -- 0:00:47
254000 -- (-535.407) [-534.318] (-534.006) (-534.665) * (-533.500) (-532.880) [-532.439] (-534.584) -- 0:00:46
254500 -- (-532.292) (-532.402) [-534.677] (-533.067) * (-533.108) (-536.652) (-533.729) [-532.670] -- 0:00:46
255000 -- [-534.510] (-533.442) (-537.603) (-533.922) * [-533.726] (-534.504) (-532.410) (-530.533) -- 0:00:46
Average standard deviation of split frequencies: 0.020256
255500 -- (-534.748) [-530.843] (-539.168) (-531.097) * (-536.507) [-532.535] (-532.396) (-532.704) -- 0:00:46
256000 -- (-533.395) (-534.031) (-532.385) [-534.120] * (-534.604) (-536.224) (-532.938) [-532.105] -- 0:00:46
256500 -- (-533.146) [-533.699] (-532.938) (-533.973) * (-532.675) (-533.579) [-535.371] (-532.100) -- 0:00:46
257000 -- (-532.659) [-533.348] (-532.080) (-535.042) * [-532.032] (-535.776) (-535.283) (-532.451) -- 0:00:46
257500 -- (-533.964) (-532.772) (-535.102) [-531.575] * (-534.478) [-533.210] (-536.280) (-536.150) -- 0:00:46
258000 -- [-533.412] (-536.602) (-535.805) (-531.279) * (-536.142) (-536.350) (-533.869) [-531.344] -- 0:00:46
258500 -- (-533.460) (-531.945) (-534.558) [-531.524] * (-534.053) [-534.984] (-534.783) (-534.194) -- 0:00:45
259000 -- (-535.761) [-530.028] (-534.981) (-532.813) * (-535.149) [-532.414] (-531.273) (-534.643) -- 0:00:45
259500 -- (-532.107) [-532.512] (-536.090) (-538.177) * (-533.234) (-532.819) [-533.305] (-535.422) -- 0:00:45
260000 -- (-532.439) [-532.474] (-536.350) (-532.363) * (-531.711) (-532.934) [-532.756] (-535.299) -- 0:00:45
Average standard deviation of split frequencies: 0.019798
260500 -- (-531.186) (-532.188) (-532.705) [-533.354] * [-533.609] (-532.687) (-532.156) (-538.507) -- 0:00:45
261000 -- [-534.946] (-534.321) (-532.103) (-533.682) * (-533.291) (-532.974) [-532.501] (-532.026) -- 0:00:45
261500 -- (-534.692) (-531.984) (-535.186) [-534.917] * (-533.428) [-533.101] (-533.586) (-530.854) -- 0:00:45
262000 -- (-533.106) [-532.215] (-534.099) (-534.571) * (-534.949) [-533.423] (-534.975) (-532.080) -- 0:00:45
262500 -- (-531.090) (-538.064) [-533.111] (-533.550) * (-530.621) (-531.080) (-532.824) [-534.195] -- 0:00:44
263000 -- (-535.231) (-531.322) (-533.220) [-532.451] * (-531.111) (-532.075) (-533.528) [-531.847] -- 0:00:44
263500 -- (-530.818) (-533.457) (-533.333) [-532.293] * [-533.037] (-532.504) (-533.188) (-532.343) -- 0:00:44
264000 -- (-533.288) (-532.929) (-534.492) [-530.833] * [-535.025] (-535.223) (-536.559) (-532.603) -- 0:00:44
264500 -- (-534.596) (-534.590) (-533.168) [-532.249] * (-534.645) (-531.343) (-534.149) [-530.048] -- 0:00:47
265000 -- [-532.125] (-537.310) (-534.111) (-531.560) * (-536.438) [-533.897] (-532.122) (-531.473) -- 0:00:47
Average standard deviation of split frequencies: 0.020912
265500 -- (-534.577) (-535.786) (-534.243) [-532.717] * (-536.864) (-533.006) (-536.117) [-531.506] -- 0:00:47
266000 -- (-531.530) (-535.365) [-537.697] (-531.694) * (-537.590) (-534.668) (-540.760) [-532.892] -- 0:00:46
266500 -- (-536.655) [-535.940] (-536.744) (-535.271) * (-533.562) [-531.489] (-531.551) (-531.223) -- 0:00:46
267000 -- (-537.253) [-532.553] (-536.706) (-533.671) * (-532.490) (-535.864) [-532.607] (-534.886) -- 0:00:46
267500 -- (-534.947) (-533.600) (-535.626) [-533.413] * (-532.330) (-531.770) [-531.913] (-533.562) -- 0:00:46
268000 -- (-533.986) [-532.999] (-536.426) (-530.818) * [-534.372] (-534.757) (-532.351) (-532.545) -- 0:00:46
268500 -- (-534.151) (-531.192) (-533.642) [-531.382] * [-534.665] (-532.826) (-532.499) (-533.797) -- 0:00:46
269000 -- (-531.777) (-532.651) [-535.640] (-533.936) * [-531.703] (-533.012) (-534.983) (-533.108) -- 0:00:46
269500 -- [-532.709] (-533.278) (-536.038) (-533.735) * (-534.341) (-531.867) (-533.855) [-531.303] -- 0:00:46
270000 -- (-533.003) (-533.326) [-535.375] (-531.598) * (-535.102) [-530.879] (-535.442) (-530.709) -- 0:00:45
Average standard deviation of split frequencies: 0.020551
270500 -- (-531.077) (-541.378) (-534.154) [-532.062] * (-534.550) (-531.663) [-534.361] (-532.749) -- 0:00:45
271000 -- [-532.570] (-541.042) (-537.497) (-531.878) * [-535.655] (-533.650) (-531.956) (-534.212) -- 0:00:45
271500 -- (-533.113) [-534.619] (-531.511) (-532.284) * (-537.466) (-534.122) (-536.203) [-533.012] -- 0:00:45
272000 -- (-532.495) [-534.087] (-534.364) (-532.674) * (-534.601) [-532.979] (-536.507) (-532.892) -- 0:00:45
272500 -- (-532.881) (-537.467) (-533.441) [-533.499] * (-532.947) [-531.761] (-533.239) (-532.939) -- 0:00:45
273000 -- (-532.961) (-534.557) (-535.623) [-530.027] * [-534.911] (-532.853) (-532.901) (-532.309) -- 0:00:45
273500 -- (-532.964) (-531.979) (-535.744) [-532.107] * (-532.782) [-534.544] (-534.233) (-535.029) -- 0:00:45
274000 -- (-533.636) (-536.250) (-535.030) [-532.876] * [-531.926] (-533.645) (-534.395) (-532.062) -- 0:00:45
274500 -- (-537.444) (-533.574) (-533.808) [-537.035] * [-532.555] (-536.874) (-534.484) (-533.852) -- 0:00:44
275000 -- (-534.953) (-534.533) (-533.980) [-533.385] * (-534.261) (-535.749) [-534.133] (-532.904) -- 0:00:44
Average standard deviation of split frequencies: 0.020837
275500 -- [-532.784] (-531.221) (-531.714) (-531.842) * [-534.864] (-537.080) (-533.692) (-532.067) -- 0:00:44
276000 -- (-534.828) [-533.038] (-532.793) (-535.163) * (-537.186) (-534.170) (-534.145) [-534.888] -- 0:00:44
276500 -- (-534.738) (-533.194) (-532.823) [-536.769] * [-535.303] (-534.221) (-534.997) (-532.857) -- 0:00:44
277000 -- (-535.894) (-532.310) (-531.799) [-535.203] * [-534.724] (-538.343) (-532.490) (-534.318) -- 0:00:44
277500 -- [-533.544] (-533.706) (-533.458) (-532.124) * [-532.317] (-531.446) (-532.251) (-532.825) -- 0:00:44
278000 -- (-533.375) (-534.866) [-530.642] (-534.417) * (-532.673) [-535.381] (-533.803) (-533.766) -- 0:00:44
278500 -- (-534.334) (-536.978) [-532.281] (-530.851) * [-532.941] (-533.036) (-537.060) (-533.005) -- 0:00:44
279000 -- (-535.445) (-534.025) [-532.688] (-533.889) * (-535.089) [-532.861] (-533.515) (-531.982) -- 0:00:43
279500 -- (-537.092) [-533.861] (-532.874) (-534.655) * (-534.425) [-533.829] (-537.046) (-532.996) -- 0:00:43
280000 -- (-533.649) [-531.060] (-531.244) (-535.670) * (-531.655) (-530.675) [-533.951] (-534.880) -- 0:00:43
Average standard deviation of split frequencies: 0.020071
280500 -- [-535.841] (-534.270) (-535.336) (-536.461) * (-536.484) (-533.166) (-533.810) [-533.983] -- 0:00:46
281000 -- (-534.091) (-537.348) [-534.389] (-533.248) * (-533.719) [-536.456] (-533.289) (-532.992) -- 0:00:46
281500 -- (-531.491) [-533.000] (-533.556) (-532.544) * (-535.576) (-537.653) (-534.304) [-533.514] -- 0:00:45
282000 -- [-532.204] (-534.744) (-531.786) (-531.048) * [-533.180] (-540.758) (-535.712) (-532.236) -- 0:00:45
282500 -- (-535.973) (-534.020) [-531.554] (-533.767) * (-532.393) [-534.285] (-532.817) (-532.828) -- 0:00:45
283000 -- (-538.765) (-532.003) (-535.332) [-533.532] * [-533.003] (-532.128) (-534.279) (-533.495) -- 0:00:45
283500 -- [-534.396] (-533.625) (-534.126) (-536.607) * [-533.943] (-534.945) (-532.178) (-533.096) -- 0:00:45
284000 -- (-533.899) (-531.863) (-531.202) [-536.425] * (-535.148) [-535.909] (-537.440) (-533.887) -- 0:00:45
284500 -- [-533.091] (-532.757) (-535.836) (-537.930) * (-535.115) (-533.040) [-533.835] (-534.064) -- 0:00:45
285000 -- (-535.220) [-532.902] (-533.494) (-534.600) * (-533.709) [-537.793] (-534.861) (-534.263) -- 0:00:45
Average standard deviation of split frequencies: 0.018790
285500 -- (-533.150) (-532.621) (-533.579) [-533.640] * (-535.157) (-531.777) (-533.123) [-535.374] -- 0:00:45
286000 -- [-534.486] (-538.930) (-535.855) (-531.496) * (-535.529) [-533.445] (-537.202) (-532.413) -- 0:00:44
286500 -- [-533.953] (-533.677) (-535.624) (-534.136) * [-533.390] (-536.398) (-534.135) (-532.116) -- 0:00:44
287000 -- (-535.718) (-533.629) (-533.151) [-534.415] * [-531.831] (-534.019) (-532.116) (-532.453) -- 0:00:44
287500 -- [-531.880] (-533.066) (-532.285) (-533.016) * (-533.531) (-533.529) (-533.717) [-531.718] -- 0:00:44
288000 -- (-531.128) (-535.499) (-534.500) [-534.804] * (-534.634) (-533.364) (-534.010) [-530.265] -- 0:00:44
288500 -- [-532.139] (-535.331) (-533.185) (-531.484) * (-533.671) (-533.681) (-535.792) [-530.714] -- 0:00:44
289000 -- (-533.030) [-531.653] (-533.020) (-533.516) * [-531.708] (-534.007) (-539.635) (-532.178) -- 0:00:44
289500 -- (-535.310) (-532.978) [-533.707] (-538.768) * (-532.417) (-533.250) [-535.821] (-539.921) -- 0:00:44
290000 -- [-534.116] (-534.156) (-532.251) (-532.869) * (-536.269) (-532.791) [-533.880] (-542.324) -- 0:00:44
Average standard deviation of split frequencies: 0.017669
290500 -- (-536.045) (-531.274) [-532.121] (-534.207) * (-534.181) (-533.280) (-537.087) [-531.650] -- 0:00:43
291000 -- (-532.393) [-532.055] (-532.167) (-537.186) * [-533.162] (-533.530) (-532.512) (-536.794) -- 0:00:43
291500 -- (-533.512) (-531.982) [-533.546] (-532.644) * (-530.969) (-535.494) (-533.846) [-533.120] -- 0:00:43
292000 -- [-532.831] (-530.997) (-531.786) (-532.617) * (-533.371) (-538.043) [-533.467] (-532.505) -- 0:00:43
292500 -- (-534.601) (-531.021) [-531.137] (-533.174) * [-532.956] (-533.982) (-534.417) (-532.272) -- 0:00:43
293000 -- (-535.080) (-531.367) [-532.214] (-532.900) * [-531.111] (-533.393) (-532.363) (-531.240) -- 0:00:43
293500 -- [-533.909] (-531.596) (-531.539) (-531.333) * (-532.293) (-532.219) (-534.960) [-532.382] -- 0:00:43
294000 -- (-534.677) (-535.144) (-532.368) [-533.037] * (-532.042) [-530.349] (-537.807) (-535.477) -- 0:00:43
294500 -- (-531.629) (-534.284) (-534.556) [-531.543] * (-532.703) (-532.026) [-534.612] (-533.236) -- 0:00:43
295000 -- (-530.807) (-536.339) (-535.067) [-531.282] * (-532.853) [-533.017] (-536.128) (-532.886) -- 0:00:43
Average standard deviation of split frequencies: 0.017099
295500 -- (-532.710) (-533.417) [-533.981] (-532.916) * (-532.986) (-531.519) [-532.848] (-530.876) -- 0:00:42
296000 -- (-540.197) (-536.259) (-534.718) [-533.821] * (-531.652) (-535.618) (-534.343) [-534.977] -- 0:00:45
296500 -- (-538.104) [-532.047] (-531.732) (-534.889) * (-536.804) (-533.183) (-533.620) [-532.318] -- 0:00:45
297000 -- (-533.465) [-531.754] (-530.133) (-534.132) * [-539.292] (-533.957) (-536.427) (-533.947) -- 0:00:44
297500 -- (-532.727) [-530.417] (-534.852) (-533.616) * (-532.150) (-531.339) (-533.770) [-533.773] -- 0:00:44
298000 -- (-538.035) (-534.758) [-532.711] (-534.346) * (-533.806) (-533.523) (-533.166) [-532.935] -- 0:00:44
298500 -- (-532.875) [-534.615] (-533.939) (-534.272) * (-537.879) (-543.694) (-535.007) [-531.160] -- 0:00:44
299000 -- (-533.109) (-537.097) (-532.907) [-533.591] * [-531.691] (-533.756) (-536.332) (-530.362) -- 0:00:44
299500 -- (-532.365) (-538.677) [-534.379] (-533.754) * (-531.734) (-536.035) (-533.112) [-532.513] -- 0:00:44
300000 -- [-534.576] (-535.428) (-533.566) (-534.671) * (-533.198) [-535.565] (-537.829) (-536.083) -- 0:00:44
Average standard deviation of split frequencies: 0.016999
300500 -- [-533.338] (-531.771) (-533.950) (-539.115) * (-532.323) [-532.172] (-535.384) (-535.876) -- 0:00:44
301000 -- (-532.447) (-532.184) [-534.090] (-532.646) * [-534.677] (-529.939) (-534.273) (-534.725) -- 0:00:44
301500 -- [-533.883] (-533.182) (-534.368) (-534.016) * [-531.068] (-533.133) (-534.747) (-536.467) -- 0:00:44
302000 -- (-532.476) (-533.043) (-534.118) [-535.048] * [-532.256] (-541.416) (-533.424) (-533.649) -- 0:00:43
302500 -- (-532.905) (-534.236) [-532.555] (-532.788) * (-531.715) (-532.787) (-532.638) [-532.952] -- 0:00:43
303000 -- (-533.735) [-534.060] (-534.026) (-532.470) * [-535.384] (-532.188) (-535.162) (-533.815) -- 0:00:43
303500 -- [-533.187] (-533.541) (-534.428) (-533.706) * (-532.524) (-531.978) (-534.328) [-533.578] -- 0:00:43
304000 -- [-533.555] (-535.156) (-532.363) (-536.313) * (-536.450) [-534.001] (-534.763) (-533.983) -- 0:00:43
304500 -- [-533.503] (-534.293) (-539.296) (-535.555) * (-531.336) (-531.220) (-534.611) [-533.977] -- 0:00:43
305000 -- (-532.891) (-533.086) [-536.959] (-539.573) * (-533.305) [-530.810] (-534.168) (-534.925) -- 0:00:43
Average standard deviation of split frequencies: 0.017757
305500 -- [-533.240] (-534.556) (-536.677) (-533.016) * (-532.936) (-531.430) (-535.690) [-533.168] -- 0:00:43
306000 -- (-530.801) (-532.998) [-539.009] (-531.651) * (-534.494) (-531.315) (-536.258) [-535.315] -- 0:00:43
306500 -- (-531.647) (-535.299) [-533.364] (-534.095) * (-532.353) (-532.585) (-535.755) [-532.877] -- 0:00:42
307000 -- [-534.659] (-534.530) (-533.964) (-532.445) * (-534.517) (-534.093) (-532.216) [-534.318] -- 0:00:42
307500 -- (-531.853) [-537.308] (-532.314) (-533.124) * (-534.390) [-533.170] (-536.988) (-534.665) -- 0:00:42
308000 -- (-532.530) [-536.930] (-535.506) (-533.183) * (-533.098) (-534.715) (-533.997) [-533.136] -- 0:00:42
308500 -- [-534.592] (-536.127) (-534.792) (-532.436) * (-533.214) (-532.741) (-534.418) [-531.867] -- 0:00:42
309000 -- (-535.784) (-534.039) [-532.861] (-533.415) * [-532.617] (-532.263) (-537.991) (-532.330) -- 0:00:42
309500 -- (-538.565) (-532.335) (-534.861) [-533.067] * (-533.340) [-535.507] (-533.184) (-534.933) -- 0:00:42
310000 -- [-534.922] (-538.984) (-534.596) (-533.579) * (-533.768) (-532.064) [-534.792] (-534.121) -- 0:00:42
Average standard deviation of split frequencies: 0.017570
310500 -- (-533.869) [-535.495] (-533.979) (-533.226) * (-534.894) [-531.828] (-535.248) (-534.133) -- 0:00:42
311000 -- (-534.012) (-533.444) [-532.108] (-533.298) * (-532.905) (-530.551) [-533.012] (-535.987) -- 0:00:42
311500 -- (-532.877) (-535.757) [-537.622] (-533.348) * (-533.092) (-531.624) [-534.609] (-534.566) -- 0:00:41
312000 -- [-532.191] (-533.005) (-531.804) (-534.306) * (-534.959) (-531.954) [-536.456] (-531.797) -- 0:00:44
312500 -- (-533.754) (-532.934) (-532.344) [-531.778] * (-538.646) (-531.097) (-537.404) [-531.394] -- 0:00:44
313000 -- (-533.834) (-535.206) (-535.265) [-532.196] * (-536.706) [-532.736] (-533.952) (-535.270) -- 0:00:43
313500 -- (-533.451) (-535.063) [-532.678] (-536.125) * (-533.926) (-531.579) (-535.793) [-534.003] -- 0:00:43
314000 -- (-534.765) [-533.047] (-531.737) (-532.062) * (-533.922) (-533.600) (-535.990) [-532.414] -- 0:00:43
314500 -- (-532.981) [-539.761] (-532.461) (-532.682) * [-533.597] (-533.854) (-534.827) (-533.982) -- 0:00:43
315000 -- (-537.712) (-533.725) (-532.708) [-537.472] * (-533.084) (-531.578) (-533.759) [-531.675] -- 0:00:43
Average standard deviation of split frequencies: 0.018215
315500 -- (-534.220) (-535.997) [-532.998] (-534.053) * [-534.866] (-532.884) (-533.314) (-535.988) -- 0:00:43
316000 -- (-534.434) (-533.976) (-530.600) [-535.417] * (-534.883) [-532.545] (-531.038) (-534.365) -- 0:00:43
316500 -- [-534.204] (-534.126) (-533.013) (-537.456) * [-532.032] (-534.258) (-533.542) (-532.314) -- 0:00:43
317000 -- (-535.350) [-532.830] (-534.166) (-539.019) * (-533.764) [-532.501] (-533.145) (-532.281) -- 0:00:43
317500 -- (-532.821) (-534.027) (-532.833) [-534.261] * (-531.699) (-535.345) (-532.208) [-532.927] -- 0:00:42
318000 -- (-534.751) [-532.553] (-534.435) (-533.279) * [-530.285] (-533.029) (-532.014) (-534.484) -- 0:00:42
318500 -- (-532.901) [-533.000] (-535.322) (-532.278) * (-531.959) [-532.379] (-530.850) (-537.045) -- 0:00:42
319000 -- (-532.970) (-533.345) (-530.818) [-534.784] * (-534.806) [-534.558] (-531.851) (-534.476) -- 0:00:42
319500 -- (-533.471) (-535.665) (-534.104) [-536.052] * [-532.274] (-532.209) (-535.213) (-533.923) -- 0:00:42
320000 -- (-535.011) (-532.595) [-532.106] (-531.751) * (-533.863) (-531.789) (-531.679) [-532.785] -- 0:00:42
Average standard deviation of split frequencies: 0.017564
320500 -- (-532.417) (-534.460) (-533.083) [-533.832] * (-532.544) (-529.008) [-534.538] (-535.290) -- 0:00:42
321000 -- (-533.226) (-534.288) [-535.441] (-533.121) * (-534.005) (-532.287) [-533.934] (-536.107) -- 0:00:42
321500 -- [-535.950] (-533.085) (-532.178) (-535.116) * [-536.554] (-533.180) (-532.978) (-533.630) -- 0:00:42
322000 -- (-536.454) (-533.562) [-530.761] (-534.271) * (-534.104) (-534.011) (-534.594) [-533.078] -- 0:00:42
322500 -- [-536.295] (-532.229) (-536.738) (-531.019) * (-535.079) [-530.590] (-537.394) (-530.738) -- 0:00:42
323000 -- (-535.690) (-531.792) [-533.181] (-532.568) * [-534.635] (-531.039) (-533.943) (-535.023) -- 0:00:41
323500 -- [-535.514] (-533.175) (-531.470) (-534.198) * (-531.678) [-534.661] (-532.967) (-534.547) -- 0:00:41
324000 -- (-534.055) (-534.100) [-534.375] (-532.358) * (-533.952) (-531.124) (-531.300) [-532.413] -- 0:00:41
324500 -- (-536.985) [-532.702] (-535.133) (-529.862) * (-533.446) (-531.046) [-533.751] (-532.744) -- 0:00:41
325000 -- (-536.027) (-532.662) (-530.755) [-531.669] * (-535.838) [-533.012] (-539.114) (-534.632) -- 0:00:41
Average standard deviation of split frequencies: 0.017200
325500 -- (-533.369) (-531.988) (-531.600) [-531.692] * (-533.953) [-530.501] (-538.478) (-536.008) -- 0:00:41
326000 -- (-533.617) (-534.616) (-532.190) [-534.378] * [-535.515] (-534.992) (-532.435) (-534.216) -- 0:00:41
326500 -- (-533.587) [-532.372] (-531.358) (-531.686) * (-533.866) (-532.352) [-535.087] (-533.488) -- 0:00:41
327000 -- (-533.569) (-532.562) (-533.896) [-531.481] * (-530.920) (-533.454) (-534.222) [-531.462] -- 0:00:41
327500 -- (-531.935) (-532.872) (-531.627) [-531.389] * (-542.316) [-530.548] (-533.186) (-532.463) -- 0:00:43
328000 -- (-532.828) (-533.717) (-533.277) [-531.835] * (-532.702) (-533.319) [-532.920] (-532.577) -- 0:00:43
328500 -- [-534.138] (-531.296) (-532.181) (-530.643) * (-535.277) (-532.399) [-533.885] (-532.869) -- 0:00:42
329000 -- (-534.441) (-533.552) (-534.602) [-531.931] * [-534.609] (-534.536) (-533.945) (-531.072) -- 0:00:42
329500 -- (-537.446) (-534.528) [-532.602] (-539.524) * [-532.537] (-537.424) (-534.088) (-532.665) -- 0:00:42
330000 -- [-534.946] (-533.999) (-532.659) (-532.331) * (-539.115) [-531.933] (-533.815) (-533.361) -- 0:00:42
Average standard deviation of split frequencies: 0.017257
330500 -- (-532.988) (-533.709) (-537.619) [-531.407] * (-533.711) (-533.548) (-534.781) [-533.902] -- 0:00:42
331000 -- (-532.948) (-531.500) (-536.637) [-533.584] * (-534.239) (-531.576) [-535.241] (-533.453) -- 0:00:42
331500 -- (-533.949) [-533.466] (-535.249) (-533.862) * (-532.529) (-535.618) [-533.665] (-533.104) -- 0:00:42
332000 -- (-534.813) (-539.085) [-532.743] (-532.689) * (-537.686) (-532.973) [-533.395] (-533.510) -- 0:00:42
332500 -- (-531.283) (-534.941) (-531.728) [-531.825] * (-537.738) (-531.115) [-532.572] (-533.041) -- 0:00:42
333000 -- (-536.995) (-532.745) [-533.423] (-534.029) * (-534.314) [-535.879] (-533.300) (-531.372) -- 0:00:42
333500 -- [-531.873] (-531.595) (-534.114) (-534.011) * (-533.182) (-533.699) [-535.871] (-535.663) -- 0:00:41
334000 -- (-535.464) (-531.915) (-532.919) [-533.951] * [-532.175] (-531.738) (-533.676) (-533.632) -- 0:00:41
334500 -- (-532.725) (-531.618) [-532.034] (-535.241) * [-537.465] (-535.192) (-533.879) (-535.742) -- 0:00:41
335000 -- [-530.313] (-531.502) (-534.244) (-536.672) * (-534.062) [-535.808] (-534.203) (-538.417) -- 0:00:41
Average standard deviation of split frequencies: 0.017943
335500 -- [-533.701] (-531.935) (-531.945) (-531.550) * (-535.710) [-532.617] (-532.922) (-533.107) -- 0:00:41
336000 -- [-533.417] (-532.243) (-533.354) (-529.981) * (-532.039) (-536.045) [-532.311] (-535.136) -- 0:00:41
336500 -- (-533.519) (-532.420) [-533.428] (-531.452) * (-532.007) (-533.278) (-532.693) [-534.214] -- 0:00:41
337000 -- [-533.612] (-532.517) (-534.082) (-532.305) * (-532.871) [-532.513] (-537.450) (-533.072) -- 0:00:41
337500 -- [-533.461] (-535.286) (-533.142) (-533.085) * (-532.107) [-535.959] (-534.072) (-535.751) -- 0:00:41
338000 -- [-532.804] (-530.989) (-534.688) (-533.578) * [-534.373] (-534.067) (-533.064) (-534.015) -- 0:00:41
338500 -- (-536.547) (-534.213) (-533.730) [-533.000] * (-537.458) [-533.638] (-536.531) (-533.932) -- 0:00:41
339000 -- (-535.804) [-532.544] (-536.530) (-531.751) * [-532.354] (-536.789) (-534.013) (-534.727) -- 0:00:40
339500 -- (-536.254) (-541.513) [-534.762] (-533.965) * (-533.657) [-534.898] (-536.187) (-536.089) -- 0:00:40
340000 -- (-531.930) [-533.008] (-532.483) (-532.701) * [-533.823] (-533.796) (-532.793) (-535.335) -- 0:00:40
Average standard deviation of split frequencies: 0.017479
340500 -- (-533.534) (-536.152) (-530.280) [-533.794] * (-533.884) [-532.845] (-534.064) (-535.403) -- 0:00:40
341000 -- (-537.906) (-532.641) [-531.579] (-532.825) * [-543.181] (-532.960) (-533.906) (-533.391) -- 0:00:40
341500 -- (-536.160) (-536.597) [-533.968] (-532.803) * (-533.684) [-532.504] (-537.797) (-534.778) -- 0:00:40
342000 -- (-535.386) [-535.354] (-531.586) (-538.311) * [-532.265] (-536.178) (-537.496) (-533.642) -- 0:00:40
342500 -- [-533.530] (-534.522) (-532.706) (-535.236) * (-533.273) (-533.077) (-533.489) [-533.240] -- 0:00:40
343000 -- (-534.871) (-533.020) [-531.625] (-538.357) * (-537.279) [-534.709] (-534.111) (-537.856) -- 0:00:40
343500 -- [-533.093] (-536.794) (-531.892) (-533.700) * (-535.824) (-533.549) (-532.419) [-537.271] -- 0:00:42
344000 -- (-534.221) (-532.780) [-533.262] (-533.031) * (-533.528) (-533.025) (-535.100) [-535.789] -- 0:00:41
344500 -- [-535.146] (-533.607) (-531.529) (-534.913) * [-531.458] (-530.777) (-536.192) (-533.502) -- 0:00:41
345000 -- (-537.075) [-533.902] (-535.778) (-534.423) * [-534.953] (-533.865) (-534.633) (-534.077) -- 0:00:41
Average standard deviation of split frequencies: 0.018214
345500 -- [-532.483] (-536.160) (-535.535) (-535.469) * [-534.505] (-531.965) (-532.733) (-533.537) -- 0:00:41
346000 -- (-532.702) (-535.906) [-533.784] (-534.713) * (-532.442) [-533.788] (-533.844) (-532.945) -- 0:00:41
346500 -- [-534.823] (-532.143) (-533.437) (-537.315) * (-532.051) [-531.037] (-537.483) (-532.132) -- 0:00:41
347000 -- (-532.945) [-532.242] (-531.131) (-533.753) * (-532.826) [-532.125] (-534.413) (-531.897) -- 0:00:41
347500 -- (-534.840) (-532.944) (-533.289) [-533.491] * (-532.643) (-533.172) [-536.088] (-534.751) -- 0:00:41
348000 -- [-536.292] (-530.742) (-535.206) (-535.287) * (-531.011) (-537.282) [-535.232] (-532.656) -- 0:00:41
348500 -- (-533.258) (-535.260) [-533.653] (-533.843) * (-535.138) (-532.735) (-534.158) [-531.958] -- 0:00:41
349000 -- (-533.248) (-534.778) [-532.092] (-532.388) * (-533.694) (-534.724) (-534.675) [-533.477] -- 0:00:41
349500 -- (-533.426) (-537.257) [-532.920] (-533.971) * (-532.580) (-534.969) (-532.331) [-532.385] -- 0:00:40
350000 -- (-536.740) [-531.890] (-535.449) (-531.936) * (-536.098) (-535.466) [-532.248] (-531.766) -- 0:00:40
Average standard deviation of split frequencies: 0.018537
350500 -- (-535.036) [-537.516] (-537.372) (-537.589) * [-534.710] (-534.077) (-535.484) (-531.333) -- 0:00:40
351000 -- (-537.985) (-543.314) [-534.089] (-536.576) * (-539.636) [-532.690] (-532.825) (-535.054) -- 0:00:40
351500 -- (-540.281) (-534.832) [-532.294] (-532.137) * (-537.219) (-533.584) [-532.397] (-533.780) -- 0:00:40
352000 -- [-536.695] (-535.826) (-531.670) (-532.210) * (-535.492) (-535.538) (-531.995) [-531.516] -- 0:00:40
352500 -- (-535.367) (-536.859) (-532.959) [-531.796] * (-534.202) (-533.347) (-532.362) [-534.748] -- 0:00:40
353000 -- (-534.793) (-534.834) [-539.195] (-533.761) * (-533.008) (-533.674) (-532.690) [-532.479] -- 0:00:40
353500 -- [-533.775] (-533.526) (-537.518) (-536.758) * [-533.304] (-534.983) (-532.581) (-533.307) -- 0:00:40
354000 -- (-534.842) (-530.810) [-533.997] (-535.490) * (-533.174) [-534.236] (-532.393) (-532.036) -- 0:00:40
354500 -- [-535.750] (-535.092) (-532.323) (-536.433) * (-533.920) [-533.121] (-530.752) (-534.628) -- 0:00:40
355000 -- [-533.971] (-536.571) (-536.232) (-533.371) * (-533.551) [-532.177] (-531.778) (-535.321) -- 0:00:39
Average standard deviation of split frequencies: 0.017435
355500 -- (-533.745) [-535.058] (-531.581) (-533.113) * [-535.214] (-533.528) (-532.759) (-534.679) -- 0:00:39
356000 -- (-536.452) [-532.540] (-543.043) (-533.572) * [-532.719] (-532.210) (-534.686) (-534.545) -- 0:00:39
356500 -- (-531.733) (-532.882) (-538.575) [-533.008] * [-532.664] (-531.125) (-533.764) (-536.880) -- 0:00:39
357000 -- (-532.852) (-531.769) [-535.840] (-534.881) * [-532.368] (-533.578) (-532.395) (-534.913) -- 0:00:39
357500 -- (-534.898) (-530.480) [-532.789] (-535.425) * (-532.714) (-533.548) [-534.277] (-532.953) -- 0:00:39
358000 -- (-532.670) [-533.082] (-533.245) (-533.551) * [-532.116] (-533.838) (-534.446) (-535.087) -- 0:00:39
358500 -- (-538.710) [-532.629] (-533.763) (-538.186) * (-531.128) [-533.659] (-536.631) (-534.193) -- 0:00:39
359000 -- (-535.297) (-532.346) [-534.393] (-535.024) * [-533.899] (-532.449) (-533.027) (-535.276) -- 0:00:41
359500 -- (-532.053) [-533.215] (-536.230) (-532.836) * [-532.309] (-533.304) (-536.469) (-535.031) -- 0:00:40
360000 -- [-533.171] (-533.747) (-534.516) (-533.909) * (-533.295) [-535.411] (-531.725) (-533.120) -- 0:00:40
Average standard deviation of split frequencies: 0.016048
360500 -- (-531.948) (-531.866) (-534.855) [-536.219] * [-534.791] (-533.605) (-530.871) (-533.914) -- 0:00:40
361000 -- (-533.463) (-533.108) [-538.798] (-534.288) * (-537.713) [-533.154] (-534.321) (-532.829) -- 0:00:40
361500 -- (-532.056) (-531.120) [-532.243] (-533.125) * (-535.732) (-535.081) (-535.004) [-532.441] -- 0:00:40
362000 -- (-533.770) (-533.384) (-531.493) [-532.723] * [-533.027] (-533.110) (-531.664) (-533.253) -- 0:00:40
362500 -- (-533.878) [-533.508] (-532.744) (-535.781) * (-533.163) (-534.972) [-534.313] (-534.444) -- 0:00:40
363000 -- (-532.835) (-531.003) [-533.183] (-533.036) * (-530.952) (-535.059) [-532.425] (-533.730) -- 0:00:40
363500 -- (-532.655) (-532.261) [-531.958] (-533.003) * (-531.044) [-533.944] (-535.925) (-532.847) -- 0:00:40
364000 -- (-532.281) (-535.443) (-532.523) [-536.853] * (-533.548) (-534.240) [-532.444] (-535.009) -- 0:00:40
364500 -- (-532.540) (-532.804) (-532.515) [-532.238] * (-532.240) [-533.488] (-534.723) (-536.584) -- 0:00:40
365000 -- (-532.724) (-534.066) (-532.357) [-531.009] * [-533.842] (-532.518) (-532.628) (-536.011) -- 0:00:40
Average standard deviation of split frequencies: 0.016959
365500 -- (-534.703) (-534.727) [-533.650] (-533.249) * (-532.278) [-531.565] (-533.000) (-532.105) -- 0:00:39
366000 -- (-534.184) [-533.201] (-534.489) (-532.686) * (-532.850) (-531.266) [-532.274] (-533.940) -- 0:00:39
366500 -- [-534.314] (-533.397) (-534.331) (-536.575) * [-533.437] (-532.591) (-532.966) (-533.712) -- 0:00:39
367000 -- (-533.449) (-534.062) [-532.026] (-534.077) * (-534.203) [-532.102] (-534.602) (-532.345) -- 0:00:39
367500 -- (-535.069) [-532.619] (-534.396) (-535.148) * [-532.632] (-534.786) (-537.349) (-532.577) -- 0:00:39
368000 -- (-533.085) [-533.454] (-546.167) (-531.042) * (-532.689) (-535.060) (-533.801) [-531.350] -- 0:00:39
368500 -- (-532.873) (-534.292) [-531.543] (-531.083) * (-531.118) (-532.405) [-534.302] (-533.601) -- 0:00:39
369000 -- (-533.086) (-532.663) [-533.491] (-532.420) * [-531.715] (-534.672) (-535.266) (-531.494) -- 0:00:39
369500 -- (-533.126) (-535.715) (-533.336) [-532.150] * (-532.846) (-535.672) (-535.087) [-533.526] -- 0:00:39
370000 -- (-532.779) (-532.928) (-537.419) [-534.592] * (-533.413) [-535.825] (-535.352) (-533.930) -- 0:00:39
Average standard deviation of split frequencies: 0.015897
370500 -- (-532.675) [-530.379] (-535.087) (-533.604) * (-534.618) (-532.169) [-533.299] (-534.724) -- 0:00:39
371000 -- (-533.447) (-534.900) (-535.419) [-531.811] * (-532.745) (-531.497) (-532.616) [-534.091] -- 0:00:38
371500 -- (-532.690) (-532.832) (-533.428) [-531.792] * (-531.468) (-534.045) [-533.046] (-535.331) -- 0:00:38
372000 -- (-535.863) (-533.214) (-532.598) [-533.546] * (-533.726) (-533.176) [-533.441] (-532.074) -- 0:00:38
372500 -- [-532.438] (-535.631) (-536.340) (-530.260) * [-530.845] (-534.737) (-534.415) (-538.398) -- 0:00:38
373000 -- [-532.554] (-535.795) (-532.901) (-531.903) * (-532.989) (-531.638) [-533.872] (-537.782) -- 0:00:38
373500 -- (-534.093) [-536.065] (-532.141) (-534.583) * (-533.067) (-536.067) (-532.020) [-533.741] -- 0:00:38
374000 -- (-531.724) (-532.573) (-531.865) [-530.393] * (-532.330) (-534.905) [-533.540] (-537.754) -- 0:00:38
374500 -- (-536.364) (-531.418) [-530.936] (-530.786) * [-532.435] (-533.338) (-534.202) (-533.860) -- 0:00:38
375000 -- (-533.660) (-530.575) [-531.757] (-536.093) * [-532.672] (-533.422) (-534.639) (-533.656) -- 0:00:40
Average standard deviation of split frequencies: 0.016020
375500 -- (-532.585) (-533.714) [-533.861] (-536.739) * (-536.782) [-534.215] (-532.630) (-535.061) -- 0:00:39
376000 -- (-535.385) (-535.651) [-533.338] (-531.712) * (-533.626) (-532.576) [-534.481] (-534.603) -- 0:00:39
376500 -- (-533.928) (-532.207) [-533.394] (-532.447) * (-532.705) [-532.804] (-533.225) (-532.980) -- 0:00:39
377000 -- (-532.717) (-532.987) [-532.211] (-534.853) * (-530.852) [-531.433] (-533.756) (-532.108) -- 0:00:39
377500 -- (-536.899) (-534.240) (-532.156) [-532.128] * (-531.457) [-535.379] (-532.369) (-538.539) -- 0:00:39
378000 -- (-533.771) (-534.794) (-532.895) [-535.420] * (-532.604) (-536.068) (-538.263) [-531.994] -- 0:00:39
378500 -- (-533.726) [-532.170] (-532.127) (-537.525) * [-530.752] (-537.296) (-542.585) (-533.806) -- 0:00:39
379000 -- (-536.219) [-532.462] (-531.127) (-536.802) * [-531.222] (-535.462) (-536.434) (-535.730) -- 0:00:39
379500 -- [-533.968] (-534.643) (-533.304) (-533.026) * (-532.193) [-531.323] (-541.570) (-536.332) -- 0:00:39
380000 -- (-536.388) (-535.844) (-532.205) [-533.172] * (-534.175) [-532.620] (-535.011) (-532.944) -- 0:00:39
Average standard deviation of split frequencies: 0.016099
380500 -- (-533.090) (-532.622) [-533.242] (-534.088) * [-532.129] (-538.662) (-534.743) (-532.409) -- 0:00:39
381000 -- (-534.693) [-534.356] (-532.273) (-534.121) * [-531.826] (-534.017) (-534.816) (-532.911) -- 0:00:38
381500 -- (-539.561) (-534.864) [-533.714] (-533.680) * (-532.420) (-535.322) (-533.625) [-535.559] -- 0:00:38
382000 -- (-532.500) (-534.120) [-532.527] (-536.089) * (-532.682) (-534.427) [-537.034] (-535.294) -- 0:00:38
382500 -- (-532.974) [-533.356] (-531.607) (-532.995) * [-533.932] (-531.935) (-535.485) (-532.996) -- 0:00:38
383000 -- (-535.421) (-533.935) (-531.705) [-533.007] * [-530.792] (-534.863) (-532.667) (-533.411) -- 0:00:38
383500 -- (-535.199) [-533.258] (-534.323) (-532.695) * (-533.032) (-532.787) [-533.811] (-533.643) -- 0:00:38
384000 -- (-540.791) (-533.260) [-538.564] (-530.785) * [-532.169] (-531.958) (-533.251) (-534.577) -- 0:00:38
384500 -- (-537.607) (-535.332) [-538.737] (-532.808) * (-535.472) [-533.542] (-535.146) (-532.685) -- 0:00:38
385000 -- (-536.487) [-538.825] (-533.057) (-533.875) * (-531.940) (-536.988) [-534.295] (-535.152) -- 0:00:38
Average standard deviation of split frequencies: 0.015876
385500 -- (-533.076) (-533.235) (-533.840) [-532.654] * (-531.710) [-532.865] (-533.153) (-533.525) -- 0:00:38
386000 -- (-534.243) (-545.754) (-533.982) [-533.831] * (-533.573) (-534.010) (-534.832) [-533.532] -- 0:00:38
386500 -- (-532.256) [-532.694] (-531.518) (-531.961) * (-532.055) (-531.440) [-534.297] (-539.196) -- 0:00:38
387000 -- [-534.764] (-536.933) (-532.356) (-531.481) * (-532.565) (-531.270) [-532.855] (-532.902) -- 0:00:38
387500 -- (-533.497) (-534.050) (-530.962) [-534.086] * (-533.592) (-534.379) (-536.104) [-532.442] -- 0:00:37
388000 -- (-534.578) (-533.795) [-533.165] (-537.286) * [-532.789] (-531.847) (-534.949) (-534.082) -- 0:00:37
388500 -- (-532.770) (-534.958) (-531.412) [-535.443] * (-533.726) [-530.352] (-533.251) (-533.936) -- 0:00:37
389000 -- (-533.829) [-532.961] (-532.288) (-533.687) * [-541.184] (-530.283) (-532.012) (-531.982) -- 0:00:37
389500 -- [-532.506] (-533.204) (-532.344) (-532.709) * (-537.122) [-530.277] (-532.293) (-532.747) -- 0:00:37
390000 -- (-532.009) (-534.146) [-535.986] (-534.761) * (-531.306) (-532.153) [-533.497] (-532.492) -- 0:00:37
Average standard deviation of split frequencies: 0.015955
390500 -- (-533.605) (-532.986) (-537.405) [-532.335] * (-532.061) (-535.473) (-531.963) [-533.476] -- 0:00:39
391000 -- (-538.328) (-533.411) [-534.646] (-533.488) * [-532.425] (-534.278) (-536.641) (-532.989) -- 0:00:38
391500 -- [-533.906] (-535.123) (-532.215) (-533.046) * (-534.394) (-532.828) [-533.384] (-533.076) -- 0:00:38
392000 -- (-533.556) (-533.833) [-533.327] (-533.435) * (-532.676) [-532.289] (-533.356) (-533.061) -- 0:00:38
392500 -- (-534.445) (-540.433) [-534.320] (-535.122) * (-532.284) (-532.901) [-533.491] (-533.717) -- 0:00:38
393000 -- (-536.301) [-534.290] (-534.959) (-537.907) * (-531.495) [-531.801] (-534.849) (-533.146) -- 0:00:38
393500 -- (-534.864) (-532.242) (-539.341) [-532.931] * (-534.263) (-535.137) [-534.322] (-533.632) -- 0:00:38
394000 -- [-532.960] (-534.319) (-531.247) (-532.861) * (-534.132) (-535.175) (-532.694) [-533.007] -- 0:00:38
394500 -- (-534.412) (-534.003) [-532.226] (-534.578) * (-536.761) (-532.876) (-533.013) [-536.563] -- 0:00:38
395000 -- (-535.503) (-533.570) (-532.674) [-534.533] * (-532.690) (-532.864) (-531.753) [-533.859] -- 0:00:38
Average standard deviation of split frequencies: 0.015211
395500 -- [-531.398] (-534.412) (-533.209) (-536.016) * (-534.557) [-532.223] (-533.651) (-532.992) -- 0:00:38
396000 -- [-534.940] (-533.150) (-536.211) (-533.747) * (-534.552) [-531.144] (-531.448) (-533.556) -- 0:00:38
396500 -- [-533.352] (-531.561) (-532.739) (-534.837) * [-530.728] (-531.194) (-533.422) (-532.042) -- 0:00:38
397000 -- [-534.772] (-534.513) (-533.331) (-532.359) * (-533.205) (-536.142) (-533.709) [-533.733] -- 0:00:37
397500 -- (-533.394) (-540.741) [-534.607] (-535.774) * [-534.975] (-535.375) (-533.099) (-537.112) -- 0:00:37
398000 -- (-537.044) [-533.757] (-535.566) (-531.748) * (-532.302) (-532.571) (-532.937) [-532.944] -- 0:00:37
398500 -- (-538.370) (-534.735) (-533.233) [-533.180] * (-531.555) (-533.869) (-532.429) [-535.029] -- 0:00:37
399000 -- [-535.411] (-534.090) (-533.508) (-534.198) * [-531.264] (-534.158) (-532.258) (-534.811) -- 0:00:37
399500 -- (-536.111) (-540.647) [-531.752] (-539.359) * (-531.493) (-532.698) [-533.937] (-533.407) -- 0:00:37
400000 -- [-535.039] (-533.187) (-533.145) (-532.956) * (-531.711) (-534.254) [-531.077] (-535.919) -- 0:00:37
Average standard deviation of split frequencies: 0.015419
400500 -- (-536.849) (-535.141) (-532.878) [-532.497] * (-532.626) (-533.929) (-537.498) [-534.955] -- 0:00:37
401000 -- (-533.939) [-532.734] (-533.259) (-534.641) * (-531.574) [-537.523] (-534.118) (-534.906) -- 0:00:37
401500 -- [-532.519] (-538.144) (-533.490) (-532.204) * (-530.661) [-536.382] (-533.750) (-533.351) -- 0:00:37
402000 -- [-533.628] (-536.764) (-533.445) (-533.904) * (-533.675) [-536.250] (-534.113) (-531.868) -- 0:00:37
402500 -- (-540.174) (-532.473) (-533.227) [-533.141] * (-533.140) (-535.546) [-532.096] (-532.731) -- 0:00:37
403000 -- (-533.102) [-532.325] (-534.584) (-533.506) * (-532.628) [-539.111] (-534.339) (-532.878) -- 0:00:37
403500 -- (-535.091) (-533.415) (-533.593) [-535.580] * [-532.570] (-538.539) (-530.318) (-537.165) -- 0:00:36
404000 -- (-534.595) [-532.869] (-534.177) (-537.284) * (-534.576) (-533.209) (-532.934) [-534.343] -- 0:00:36
404500 -- (-534.362) (-537.961) [-537.768] (-532.153) * (-532.885) (-536.639) [-532.852] (-533.321) -- 0:00:36
405000 -- (-536.999) (-532.771) [-533.151] (-533.392) * (-532.588) [-535.422] (-534.173) (-535.837) -- 0:00:36
Average standard deviation of split frequencies: 0.014972
405500 -- (-532.434) [-533.185] (-534.681) (-537.151) * [-530.358] (-536.034) (-533.976) (-533.739) -- 0:00:36
406000 -- (-536.409) [-530.752] (-533.696) (-533.203) * [-531.357] (-535.086) (-530.324) (-533.513) -- 0:00:38
406500 -- [-534.276] (-531.777) (-532.283) (-532.084) * (-531.401) [-532.573] (-530.875) (-532.811) -- 0:00:37
407000 -- [-532.772] (-533.798) (-533.725) (-531.316) * (-532.094) (-533.304) (-531.305) [-533.158] -- 0:00:37
407500 -- (-533.450) (-532.142) (-535.139) [-535.076] * (-532.248) (-537.870) [-530.563] (-538.841) -- 0:00:37
408000 -- (-535.059) (-530.533) [-534.500] (-533.865) * (-535.206) (-535.185) [-531.552] (-536.355) -- 0:00:37
408500 -- (-535.617) (-533.974) (-535.126) [-535.218] * (-532.890) (-533.769) (-532.718) [-532.838] -- 0:00:37
409000 -- (-533.334) [-532.900] (-535.568) (-534.267) * [-532.150] (-539.008) (-532.297) (-534.209) -- 0:00:37
409500 -- (-534.191) (-533.047) (-535.489) [-535.581] * [-532.625] (-536.755) (-531.851) (-539.858) -- 0:00:37
410000 -- (-535.284) (-530.859) (-532.719) [-533.112] * (-531.920) [-540.616] (-532.400) (-534.900) -- 0:00:37
Average standard deviation of split frequencies: 0.014983
410500 -- (-532.828) (-533.551) (-531.086) [-535.513] * (-534.266) (-535.039) [-532.073] (-532.593) -- 0:00:37
411000 -- (-532.814) (-536.417) (-533.589) [-533.720] * (-532.922) (-533.821) [-529.799] (-535.118) -- 0:00:37
411500 -- (-533.088) (-536.472) [-532.771] (-532.331) * (-534.242) (-533.625) [-530.881] (-532.636) -- 0:00:37
412000 -- (-533.284) [-532.712] (-532.818) (-532.335) * (-534.727) (-533.267) [-532.983] (-531.885) -- 0:00:37
412500 -- (-533.304) (-534.010) (-536.467) [-533.849] * (-534.885) (-533.898) [-531.943] (-533.363) -- 0:00:37
413000 -- [-533.220] (-533.757) (-533.174) (-531.714) * (-535.256) (-533.851) [-531.412] (-532.598) -- 0:00:36
413500 -- (-532.660) (-531.147) [-531.638] (-532.986) * [-531.806] (-533.270) (-530.898) (-532.545) -- 0:00:36
414000 -- (-534.215) (-532.901) (-532.571) [-532.026] * (-534.092) (-532.069) [-530.244] (-538.341) -- 0:00:36
414500 -- (-533.807) [-531.059] (-535.712) (-531.469) * (-537.225) (-532.204) [-531.053] (-534.592) -- 0:00:36
415000 -- (-534.851) (-531.057) [-535.167] (-533.562) * [-533.437] (-533.657) (-530.508) (-535.038) -- 0:00:36
Average standard deviation of split frequencies: 0.013956
415500 -- (-536.473) [-532.371] (-538.244) (-531.495) * (-533.232) (-534.286) [-531.665] (-532.226) -- 0:00:36
416000 -- (-532.008) (-532.144) (-534.736) [-532.917] * (-533.143) [-533.325] (-529.707) (-532.973) -- 0:00:36
416500 -- (-533.427) (-532.620) (-533.749) [-535.118] * (-532.786) (-532.243) [-532.130] (-533.467) -- 0:00:36
417000 -- (-533.629) (-533.192) [-533.918] (-533.188) * (-538.195) (-534.883) (-531.947) [-533.664] -- 0:00:36
417500 -- (-533.145) (-532.151) [-531.563] (-533.826) * [-533.778] (-535.563) (-533.136) (-532.857) -- 0:00:36
418000 -- (-532.949) [-534.217] (-536.670) (-535.504) * (-536.067) (-536.355) [-530.880] (-535.749) -- 0:00:36
418500 -- (-535.069) (-532.357) [-532.024] (-533.601) * (-537.194) [-536.445] (-536.746) (-534.337) -- 0:00:36
419000 -- (-534.790) (-532.296) [-533.064] (-532.811) * [-535.731] (-532.901) (-531.113) (-532.457) -- 0:00:36
419500 -- (-531.612) (-533.614) (-534.403) [-533.435] * [-532.819] (-534.093) (-536.866) (-533.387) -- 0:00:35
420000 -- (-532.376) (-533.628) [-531.359] (-534.798) * (-533.727) (-533.129) [-533.502] (-533.147) -- 0:00:35
Average standard deviation of split frequencies: 0.012799
420500 -- (-533.489) (-533.064) (-536.903) [-534.899] * (-534.762) [-530.937] (-532.225) (-534.414) -- 0:00:35
421000 -- (-533.326) [-532.742] (-531.136) (-532.485) * [-532.743] (-536.212) (-532.477) (-535.881) -- 0:00:35
421500 -- (-531.838) [-533.614] (-533.713) (-533.115) * (-534.832) (-533.592) [-533.328] (-536.446) -- 0:00:37
422000 -- [-536.204] (-535.438) (-532.656) (-535.522) * [-532.620] (-533.817) (-535.598) (-535.839) -- 0:00:36
422500 -- (-534.128) [-534.674] (-531.900) (-534.825) * (-537.768) (-531.714) [-531.144] (-535.381) -- 0:00:36
423000 -- (-532.372) (-535.642) (-533.023) [-534.921] * (-536.215) (-533.604) [-531.405] (-538.586) -- 0:00:36
423500 -- [-532.115] (-531.653) (-536.350) (-535.218) * [-531.400] (-539.242) (-533.691) (-532.952) -- 0:00:36
424000 -- (-532.281) (-534.728) (-532.180) [-531.620] * [-532.062] (-538.382) (-533.175) (-538.671) -- 0:00:36
424500 -- (-535.062) (-531.344) (-536.352) [-534.685] * [-532.937] (-531.592) (-536.755) (-536.652) -- 0:00:36
425000 -- [-534.594] (-533.646) (-535.791) (-533.237) * (-532.718) (-531.240) [-532.303] (-539.567) -- 0:00:36
Average standard deviation of split frequencies: 0.011357
425500 -- (-533.678) [-533.582] (-532.412) (-537.401) * (-532.047) [-537.871] (-532.116) (-534.897) -- 0:00:36
426000 -- (-533.251) [-533.267] (-537.360) (-532.424) * (-532.767) (-533.030) [-530.945] (-535.573) -- 0:00:36
426500 -- [-534.207] (-533.620) (-532.888) (-534.424) * (-532.533) [-532.453] (-532.275) (-533.615) -- 0:00:36
427000 -- (-533.862) (-533.261) [-532.905] (-534.410) * (-535.062) (-533.732) (-533.606) [-531.884] -- 0:00:36
427500 -- [-533.922] (-536.423) (-532.990) (-535.358) * (-532.126) (-533.883) (-530.959) [-537.944] -- 0:00:36
428000 -- (-536.354) [-532.848] (-531.811) (-534.361) * (-535.683) [-534.215] (-531.449) (-534.164) -- 0:00:36
428500 -- (-531.976) [-531.060] (-535.921) (-532.059) * (-535.212) (-535.141) (-534.924) [-533.176] -- 0:00:36
429000 -- (-533.531) [-535.388] (-535.576) (-534.376) * (-533.125) (-534.374) [-531.016] (-535.133) -- 0:00:35
429500 -- (-531.818) (-534.348) (-531.236) [-533.886] * (-531.173) (-538.546) (-531.737) [-533.271] -- 0:00:35
430000 -- [-535.788] (-534.982) (-532.534) (-531.402) * (-531.214) (-536.250) [-530.762] (-535.450) -- 0:00:35
Average standard deviation of split frequencies: 0.010888
430500 -- (-531.339) [-533.382] (-531.686) (-532.300) * (-531.176) (-535.460) [-529.095] (-532.644) -- 0:00:35
431000 -- [-533.605] (-533.732) (-539.257) (-531.730) * [-531.008] (-533.776) (-532.950) (-533.896) -- 0:00:35
431500 -- [-531.172] (-535.259) (-533.233) (-532.376) * (-533.107) (-534.772) (-530.384) [-532.942] -- 0:00:35
432000 -- [-531.083] (-534.097) (-535.986) (-535.035) * (-530.673) [-539.391] (-534.983) (-534.782) -- 0:00:35
432500 -- (-535.409) [-532.358] (-532.287) (-533.818) * [-532.568] (-534.691) (-531.835) (-534.363) -- 0:00:35
433000 -- [-537.076] (-535.798) (-532.297) (-534.354) * (-536.129) (-533.894) (-531.726) [-533.567] -- 0:00:35
433500 -- (-538.573) [-531.295] (-531.763) (-535.419) * (-530.028) [-531.945] (-533.480) (-532.780) -- 0:00:35
434000 -- (-536.486) [-531.972] (-533.819) (-533.956) * (-532.471) (-533.948) (-532.240) [-532.688] -- 0:00:35
434500 -- (-533.166) [-532.024] (-535.789) (-531.456) * (-533.849) [-533.431] (-533.235) (-538.458) -- 0:00:35
435000 -- (-530.371) (-533.221) [-533.678] (-532.687) * (-534.897) (-534.691) (-534.302) [-533.318] -- 0:00:35
Average standard deviation of split frequencies: 0.011324
435500 -- [-532.336] (-534.255) (-533.497) (-533.362) * (-530.615) (-534.208) [-530.998] (-534.393) -- 0:00:34
436000 -- (-533.833) (-535.164) (-535.032) [-532.290] * [-531.217] (-532.159) (-531.903) (-533.118) -- 0:00:34
436500 -- [-531.377] (-535.009) (-532.943) (-534.717) * (-533.128) (-534.670) [-530.085] (-540.893) -- 0:00:34
437000 -- (-532.248) (-534.105) [-532.178] (-533.640) * (-531.651) (-537.964) (-530.939) [-536.581] -- 0:00:34
437500 -- [-536.203] (-535.610) (-532.065) (-531.136) * (-534.449) (-535.368) (-532.782) [-534.161] -- 0:00:36
438000 -- (-533.414) [-530.965] (-534.210) (-531.176) * (-533.665) (-537.293) (-532.237) [-533.691] -- 0:00:35
438500 -- (-533.530) (-536.848) (-533.502) [-533.354] * (-532.849) (-533.994) (-531.559) [-533.228] -- 0:00:35
439000 -- (-533.341) [-534.575] (-532.237) (-531.500) * (-533.125) [-532.398] (-531.979) (-532.284) -- 0:00:35
439500 -- [-533.095] (-534.700) (-535.024) (-531.988) * (-532.332) [-533.672] (-533.326) (-533.016) -- 0:00:35
440000 -- (-535.785) (-534.227) [-534.267] (-532.761) * [-531.695] (-534.690) (-535.234) (-536.481) -- 0:00:35
Average standard deviation of split frequencies: 0.011542
440500 -- (-534.831) (-533.062) (-535.027) [-534.030] * (-533.588) (-533.173) [-535.102] (-535.955) -- 0:00:35
441000 -- (-533.965) [-531.987] (-535.540) (-532.742) * (-535.092) (-533.621) [-535.137] (-535.107) -- 0:00:35
441500 -- (-532.293) [-534.703] (-531.162) (-533.181) * (-534.189) [-535.465] (-533.441) (-537.865) -- 0:00:35
442000 -- (-537.325) (-537.415) [-533.714] (-535.192) * (-532.898) (-534.030) [-534.579] (-531.141) -- 0:00:35
442500 -- (-532.844) (-534.474) [-533.788] (-532.927) * [-534.182] (-534.790) (-536.978) (-534.181) -- 0:00:35
443000 -- (-532.854) (-536.709) [-533.714] (-531.603) * (-534.752) (-533.540) (-530.823) [-535.204] -- 0:00:35
443500 -- (-532.672) (-532.102) [-537.754] (-533.154) * (-533.043) [-533.989] (-533.076) (-533.160) -- 0:00:35
444000 -- [-534.133] (-533.320) (-537.324) (-530.910) * (-533.421) (-533.524) [-533.356] (-534.916) -- 0:00:35
444500 -- [-532.767] (-533.731) (-534.426) (-531.757) * (-532.284) (-532.087) (-534.204) [-533.790] -- 0:00:34
445000 -- (-533.432) [-532.941] (-541.175) (-532.509) * (-534.653) [-532.103] (-532.471) (-535.121) -- 0:00:34
Average standard deviation of split frequencies: 0.010792
445500 -- (-533.668) [-533.880] (-536.150) (-533.176) * (-535.799) (-532.247) [-534.076] (-533.306) -- 0:00:34
446000 -- [-533.687] (-531.058) (-532.370) (-534.154) * (-534.078) [-531.598] (-532.454) (-532.809) -- 0:00:34
446500 -- (-533.571) (-532.779) [-534.404] (-534.501) * (-536.078) [-533.052] (-532.996) (-532.380) -- 0:00:34
447000 -- (-532.308) [-531.132] (-532.527) (-533.321) * (-533.474) [-534.345] (-535.857) (-533.325) -- 0:00:34
447500 -- (-537.682) [-533.098] (-532.563) (-532.879) * (-534.178) [-532.410] (-534.101) (-531.842) -- 0:00:34
448000 -- (-535.615) [-534.394] (-534.446) (-531.575) * [-534.343] (-535.186) (-534.491) (-533.335) -- 0:00:34
448500 -- (-533.195) (-535.283) [-533.647] (-533.076) * (-531.246) (-532.525) (-533.229) [-536.104] -- 0:00:34
449000 -- (-535.032) (-535.372) (-532.596) [-532.257] * (-530.776) (-533.315) [-532.201] (-534.398) -- 0:00:34
449500 -- [-532.803] (-536.593) (-532.473) (-533.256) * [-531.956] (-533.627) (-531.447) (-534.402) -- 0:00:34
450000 -- [-533.297] (-533.959) (-532.109) (-530.991) * (-532.369) (-538.035) [-535.900] (-533.524) -- 0:00:34
Average standard deviation of split frequencies: 0.011231
450500 -- (-533.972) (-533.744) (-536.006) [-536.360] * (-531.603) (-534.446) [-532.821] (-532.264) -- 0:00:34
451000 -- (-533.623) [-531.753] (-533.977) (-535.073) * [-532.984] (-530.982) (-533.814) (-534.762) -- 0:00:34
451500 -- (-533.835) (-530.503) [-533.173] (-533.110) * (-534.512) [-532.568] (-531.488) (-536.234) -- 0:00:34
452000 -- (-534.600) [-532.997] (-531.783) (-535.118) * (-534.960) (-537.336) [-531.544] (-534.178) -- 0:00:33
452500 -- [-534.551] (-529.842) (-536.119) (-533.565) * (-533.975) [-537.207] (-534.051) (-536.013) -- 0:00:33
453000 -- (-535.464) (-531.012) (-532.002) [-533.090] * [-531.850] (-538.656) (-530.743) (-533.892) -- 0:00:33
453500 -- (-533.638) [-533.520] (-533.352) (-533.637) * (-533.597) (-534.526) (-532.845) [-532.021] -- 0:00:34
454000 -- (-533.277) (-532.574) [-534.577] (-533.396) * (-533.538) (-532.834) [-539.676] (-535.809) -- 0:00:34
454500 -- (-538.017) (-535.211) [-532.826] (-533.434) * (-532.900) (-534.633) [-533.091] (-533.858) -- 0:00:34
455000 -- (-532.237) (-534.645) (-532.492) [-530.518] * (-537.502) [-534.570] (-534.647) (-538.022) -- 0:00:34
Average standard deviation of split frequencies: 0.010719
455500 -- (-532.647) [-530.414] (-534.334) (-534.644) * (-532.298) (-534.311) [-537.122] (-533.753) -- 0:00:34
456000 -- [-533.536] (-535.848) (-536.177) (-530.324) * [-535.841] (-535.373) (-532.702) (-533.533) -- 0:00:34
456500 -- (-531.373) (-535.817) [-534.806] (-531.233) * (-535.649) (-535.761) [-531.517] (-534.086) -- 0:00:34
457000 -- (-533.370) (-535.920) [-531.131] (-535.751) * (-539.551) (-534.274) [-533.791] (-536.201) -- 0:00:34
457500 -- (-537.376) (-533.627) (-533.131) [-532.354] * [-531.520] (-535.534) (-534.632) (-532.803) -- 0:00:34
458000 -- (-536.009) (-534.295) [-532.249] (-534.650) * (-534.021) (-532.965) (-537.912) [-533.604] -- 0:00:34
458500 -- (-536.221) (-532.936) (-532.013) [-532.694] * (-534.167) (-533.427) [-531.332] (-534.477) -- 0:00:34
459000 -- (-533.073) [-532.273] (-532.897) (-532.366) * (-531.925) [-535.248] (-534.119) (-533.353) -- 0:00:34
459500 -- [-532.036] (-530.793) (-532.950) (-539.675) * (-533.663) [-533.418] (-533.267) (-532.601) -- 0:00:34
460000 -- [-533.012] (-535.583) (-534.096) (-534.361) * (-533.619) (-534.648) [-535.908] (-538.542) -- 0:00:34
Average standard deviation of split frequencies: 0.010347
460500 -- [-533.501] (-533.440) (-538.392) (-532.787) * [-533.452] (-531.253) (-532.440) (-536.402) -- 0:00:33
461000 -- (-531.908) (-532.411) (-534.407) [-531.677] * [-532.087] (-534.269) (-533.727) (-536.141) -- 0:00:33
461500 -- (-534.236) (-531.189) (-534.702) [-529.989] * (-535.742) [-530.744] (-534.114) (-536.139) -- 0:00:33
462000 -- (-537.007) (-531.192) (-538.668) [-533.621] * (-533.988) (-534.336) [-532.795] (-535.923) -- 0:00:33
462500 -- [-532.545] (-533.401) (-532.990) (-532.461) * [-534.854] (-533.115) (-533.497) (-534.742) -- 0:00:33
463000 -- [-532.324] (-534.794) (-535.837) (-532.431) * [-532.735] (-532.394) (-535.741) (-533.755) -- 0:00:33
463500 -- (-536.441) (-530.778) [-534.916] (-532.136) * (-533.566) (-531.803) [-534.305] (-541.087) -- 0:00:33
464000 -- (-536.345) (-532.985) (-532.486) [-531.833] * (-537.926) (-532.300) (-534.064) [-530.801] -- 0:00:33
464500 -- (-533.180) [-535.061] (-532.937) (-531.531) * (-532.844) [-535.785] (-532.038) (-534.207) -- 0:00:33
465000 -- (-532.697) (-533.836) (-533.754) [-531.217] * [-533.839] (-529.993) (-533.897) (-530.525) -- 0:00:33
Average standard deviation of split frequencies: 0.010060
465500 -- [-531.607] (-531.815) (-534.530) (-532.562) * (-532.664) [-533.564] (-535.019) (-534.533) -- 0:00:33
466000 -- (-533.849) (-532.160) (-536.927) [-532.945] * (-531.487) (-532.404) (-532.665) [-535.463] -- 0:00:33
466500 -- (-532.222) [-533.047] (-532.155) (-530.367) * (-531.275) (-534.325) (-534.416) [-533.126] -- 0:00:33
467000 -- [-535.169] (-534.866) (-534.269) (-532.569) * [-532.072] (-532.901) (-534.392) (-533.799) -- 0:00:33
467500 -- (-532.639) (-531.200) (-533.989) [-531.287] * (-537.299) [-532.122] (-536.054) (-534.551) -- 0:00:33
468000 -- (-532.042) [-533.132] (-534.958) (-533.883) * (-536.122) (-532.667) [-535.826] (-535.850) -- 0:00:32
468500 -- [-532.519] (-533.520) (-534.665) (-536.788) * (-531.587) (-531.468) (-537.942) [-532.421] -- 0:00:32
469000 -- (-539.118) [-532.972] (-534.189) (-538.185) * (-534.700) (-533.139) [-533.100] (-533.613) -- 0:00:33
469500 -- [-531.385] (-537.611) (-533.848) (-536.822) * (-533.060) (-531.753) (-532.480) [-532.406] -- 0:00:33
470000 -- (-533.477) (-532.090) (-533.694) [-533.769] * (-537.094) [-530.465] (-532.485) (-533.657) -- 0:00:33
Average standard deviation of split frequencies: 0.010628
470500 -- (-534.387) (-536.281) [-535.254] (-532.266) * [-531.621] (-531.687) (-534.381) (-534.427) -- 0:00:33
471000 -- [-533.610] (-532.555) (-536.807) (-533.661) * (-531.815) (-530.400) [-534.337] (-535.451) -- 0:00:33
471500 -- (-532.092) (-533.364) [-535.042] (-534.070) * (-534.803) (-531.792) (-533.139) [-532.639] -- 0:00:33
472000 -- (-536.712) (-531.836) [-533.801] (-538.299) * (-531.948) (-537.698) [-533.568] (-532.642) -- 0:00:33
472500 -- (-532.760) [-532.608] (-535.439) (-537.553) * (-537.015) (-531.598) [-532.291] (-535.449) -- 0:00:33
473000 -- [-530.948] (-531.535) (-535.424) (-540.774) * [-533.092] (-531.187) (-531.447) (-533.426) -- 0:00:33
473500 -- (-533.993) [-530.624] (-534.116) (-532.571) * (-534.648) (-531.186) (-531.235) [-531.936] -- 0:00:33
474000 -- (-536.231) [-532.694] (-534.969) (-536.714) * (-538.743) (-535.736) [-532.892] (-533.034) -- 0:00:33
474500 -- (-530.176) (-534.240) [-532.771] (-533.788) * (-535.952) (-531.064) [-533.564] (-534.697) -- 0:00:33
475000 -- (-532.661) [-533.618] (-537.024) (-532.860) * [-533.049] (-534.929) (-532.099) (-532.998) -- 0:00:33
Average standard deviation of split frequencies: 0.010013
475500 -- (-534.539) [-533.088] (-540.537) (-531.830) * (-533.023) [-532.778] (-532.092) (-534.984) -- 0:00:33
476000 -- [-530.645] (-535.757) (-534.579) (-533.202) * (-538.496) (-534.116) (-532.564) [-532.992] -- 0:00:33
476500 -- (-532.235) [-538.558] (-532.125) (-533.641) * (-532.388) (-535.574) (-533.201) [-531.878] -- 0:00:32
477000 -- (-532.087) (-538.805) [-531.861] (-533.547) * (-534.241) (-536.299) [-533.311] (-535.337) -- 0:00:32
477500 -- (-531.357) [-537.825] (-533.063) (-531.117) * [-531.129] (-531.888) (-535.259) (-533.093) -- 0:00:32
478000 -- (-533.231) (-533.438) (-534.115) [-531.658] * (-532.636) [-533.755] (-532.895) (-537.461) -- 0:00:32
478500 -- [-532.046] (-532.793) (-532.960) (-532.285) * (-532.136) (-536.094) (-533.321) [-534.915] -- 0:00:32
479000 -- (-532.452) [-533.036] (-532.378) (-532.740) * [-531.540] (-533.165) (-531.868) (-533.041) -- 0:00:32
479500 -- (-532.703) (-533.852) [-532.104] (-533.306) * (-532.941) (-532.746) (-533.491) [-536.163] -- 0:00:32
480000 -- (-533.586) (-534.661) [-534.773] (-531.582) * (-534.282) (-533.697) (-534.043) [-532.571] -- 0:00:32
Average standard deviation of split frequencies: 0.010189
480500 -- (-533.228) [-530.557] (-532.974) (-532.138) * (-538.254) [-532.608] (-532.752) (-533.107) -- 0:00:32
481000 -- [-531.643] (-534.253) (-533.511) (-532.270) * (-538.356) (-533.300) [-537.195] (-534.049) -- 0:00:32
481500 -- (-533.927) [-534.198] (-537.023) (-537.561) * (-532.147) [-532.715] (-533.436) (-533.133) -- 0:00:32
482000 -- (-533.610) (-538.545) [-536.430] (-532.952) * (-532.072) (-535.672) (-535.733) [-534.117] -- 0:00:32
482500 -- (-533.280) [-536.859] (-536.808) (-538.269) * (-532.310) [-531.590] (-535.624) (-535.687) -- 0:00:32
483000 -- [-535.821] (-534.993) (-534.451) (-535.420) * (-530.560) (-533.449) (-533.475) [-531.347] -- 0:00:32
483500 -- (-536.608) (-533.976) [-532.540] (-538.066) * (-532.853) (-533.358) [-535.983] (-532.728) -- 0:00:32
484000 -- (-533.804) [-533.649] (-535.047) (-534.642) * [-531.964] (-532.430) (-534.338) (-533.449) -- 0:00:31
484500 -- (-538.640) [-532.271] (-534.310) (-534.659) * [-532.185] (-531.110) (-534.569) (-536.003) -- 0:00:31
485000 -- (-532.768) (-533.658) (-535.762) [-534.197] * (-535.317) (-531.941) (-535.173) [-532.799] -- 0:00:32
Average standard deviation of split frequencies: 0.010724
485500 -- (-533.227) [-532.255] (-536.902) (-532.328) * (-534.573) (-533.602) [-534.154] (-532.528) -- 0:00:32
486000 -- [-533.101] (-532.998) (-533.674) (-531.155) * [-532.847] (-533.676) (-534.684) (-531.156) -- 0:00:32
486500 -- (-532.844) [-533.655] (-534.727) (-533.508) * [-531.230] (-531.048) (-532.701) (-532.761) -- 0:00:32
487000 -- (-532.106) (-532.741) (-535.164) [-537.355] * [-532.765] (-536.869) (-532.454) (-532.733) -- 0:00:32
487500 -- [-532.201] (-533.595) (-532.036) (-532.259) * (-533.771) (-534.098) (-531.361) [-533.078] -- 0:00:32
488000 -- (-536.590) (-540.276) [-533.638] (-531.893) * (-531.970) (-533.874) (-534.362) [-533.233] -- 0:00:32
488500 -- (-536.385) (-532.980) (-533.659) [-530.011] * (-532.727) (-533.979) [-532.540] (-533.364) -- 0:00:32
489000 -- (-535.029) [-533.390] (-534.944) (-531.238) * (-532.439) (-535.436) (-532.880) [-534.957] -- 0:00:32
489500 -- (-531.291) (-538.336) [-531.501] (-534.038) * [-534.175] (-535.957) (-530.327) (-532.631) -- 0:00:32
490000 -- (-532.696) (-537.945) (-534.820) [-530.858] * [-531.361] (-532.716) (-532.527) (-535.420) -- 0:00:32
Average standard deviation of split frequencies: 0.010568
490500 -- [-535.114] (-532.287) (-535.290) (-530.909) * (-531.320) [-533.873] (-532.744) (-532.053) -- 0:00:32
491000 -- (-535.811) [-533.367] (-533.976) (-532.519) * (-534.435) (-533.511) (-533.867) [-532.780] -- 0:00:32
491500 -- (-535.575) (-533.592) (-532.270) [-531.107] * (-533.659) (-533.943) [-532.100] (-532.686) -- 0:00:32
492000 -- (-533.190) [-534.458] (-532.811) (-534.597) * (-531.509) (-532.754) (-533.754) [-531.954] -- 0:00:32
492500 -- [-534.851] (-533.533) (-533.039) (-534.885) * (-534.272) (-532.846) (-541.529) [-532.909] -- 0:00:31
493000 -- [-532.552] (-535.165) (-533.557) (-535.109) * (-533.254) (-531.218) (-540.312) [-533.522] -- 0:00:31
493500 -- (-536.566) (-534.578) [-533.215] (-533.898) * (-536.524) (-533.302) (-532.559) [-535.049] -- 0:00:31
494000 -- (-535.049) [-537.696] (-532.506) (-532.583) * (-536.043) [-533.490] (-534.131) (-534.040) -- 0:00:31
494500 -- [-533.179] (-535.200) (-531.617) (-530.836) * (-533.300) [-531.536] (-534.009) (-536.141) -- 0:00:31
495000 -- (-530.573) (-531.781) (-532.644) [-531.247] * (-533.611) (-535.511) [-534.360] (-532.983) -- 0:00:31
Average standard deviation of split frequencies: 0.010287
495500 -- [-533.440] (-533.703) (-532.982) (-531.746) * (-531.942) [-532.803] (-531.331) (-539.325) -- 0:00:31
496000 -- (-535.771) (-534.421) [-533.192] (-532.597) * [-536.371] (-532.944) (-532.837) (-535.202) -- 0:00:31
496500 -- (-536.040) [-532.277] (-534.104) (-533.205) * [-531.187] (-532.916) (-537.401) (-537.107) -- 0:00:31
497000 -- (-535.477) (-533.070) (-534.799) [-533.265] * (-537.252) (-532.064) [-538.818] (-535.669) -- 0:00:31
497500 -- [-533.374] (-533.988) (-535.471) (-533.318) * (-531.328) (-533.857) [-533.863] (-532.416) -- 0:00:31
498000 -- (-533.482) [-532.517] (-533.169) (-532.646) * (-531.047) (-533.738) [-533.006] (-531.847) -- 0:00:31
498500 -- [-538.542] (-535.409) (-533.099) (-534.642) * [-530.315] (-533.406) (-536.106) (-532.304) -- 0:00:31
499000 -- (-534.864) (-537.297) [-534.222] (-532.688) * [-537.614] (-535.307) (-531.764) (-532.088) -- 0:00:31
499500 -- (-533.283) (-533.395) [-532.117] (-534.659) * (-532.852) (-535.814) [-534.745] (-534.949) -- 0:00:31
500000 -- (-536.218) (-533.077) [-532.592] (-532.930) * (-532.052) (-536.565) [-534.444] (-536.851) -- 0:00:31
Average standard deviation of split frequencies: 0.009859
500500 -- [-531.493] (-533.115) (-532.644) (-535.740) * [-531.466] (-533.102) (-534.727) (-532.778) -- 0:00:31
501000 -- (-531.164) [-534.840] (-534.440) (-531.176) * [-532.085] (-533.097) (-533.575) (-532.740) -- 0:00:31
501500 -- (-535.259) (-534.276) (-533.433) [-530.618] * (-533.497) (-532.632) (-531.511) [-534.222] -- 0:00:31
502000 -- (-537.103) [-533.751] (-534.445) (-533.571) * (-534.236) (-535.059) (-530.899) [-534.571] -- 0:00:31
502500 -- (-536.220) [-532.101] (-532.050) (-533.948) * (-536.482) (-536.598) [-533.510] (-535.967) -- 0:00:31
503000 -- [-530.604] (-535.370) (-534.737) (-534.496) * (-535.684) [-535.708] (-532.383) (-536.721) -- 0:00:31
503500 -- (-532.437) (-532.511) (-533.976) [-530.100] * (-534.701) (-533.285) [-534.404] (-531.798) -- 0:00:31
504000 -- (-531.878) (-540.190) [-534.015] (-533.956) * (-533.300) (-532.335) [-532.063] (-533.871) -- 0:00:31
504500 -- [-532.392] (-535.073) (-536.135) (-531.373) * [-535.412] (-532.418) (-533.720) (-535.668) -- 0:00:31
505000 -- (-533.666) (-536.366) (-532.572) [-531.059] * [-536.575] (-532.414) (-532.162) (-535.684) -- 0:00:31
Average standard deviation of split frequencies: 0.010403
505500 -- [-534.127] (-538.024) (-532.816) (-533.641) * (-532.906) [-532.511] (-534.954) (-534.532) -- 0:00:31
506000 -- (-533.459) (-533.325) (-534.731) [-533.009] * (-534.884) [-533.461] (-535.052) (-533.940) -- 0:00:31
506500 -- [-531.727] (-537.605) (-532.926) (-533.252) * (-538.550) [-534.487] (-532.277) (-534.663) -- 0:00:31
507000 -- [-532.390] (-536.953) (-532.801) (-534.502) * (-533.219) (-533.383) [-534.806] (-534.882) -- 0:00:31
507500 -- (-533.311) (-537.112) (-532.099) [-532.817] * [-532.883] (-533.009) (-532.485) (-532.089) -- 0:00:31
508000 -- (-533.430) (-537.921) [-533.158] (-533.604) * (-532.340) (-536.265) [-532.462] (-533.320) -- 0:00:30
508500 -- (-531.815) (-534.266) [-532.910] (-532.472) * (-531.709) [-532.685] (-532.073) (-534.393) -- 0:00:30
509000 -- (-534.308) (-534.201) [-533.787] (-533.002) * (-532.654) [-532.857] (-533.767) (-535.803) -- 0:00:30
509500 -- (-534.269) (-538.719) (-533.681) [-532.932] * (-533.340) (-533.316) (-532.950) [-535.845] -- 0:00:30
510000 -- (-533.564) (-533.549) [-532.822] (-532.443) * (-532.658) [-532.687] (-532.503) (-532.863) -- 0:00:30
Average standard deviation of split frequencies: 0.009448
510500 -- (-533.347) (-535.414) (-533.717) [-533.643] * [-533.041] (-532.571) (-534.912) (-540.498) -- 0:00:30
511000 -- [-533.522] (-534.998) (-535.093) (-533.419) * (-531.879) (-533.297) [-532.214] (-533.803) -- 0:00:30
511500 -- (-533.422) (-530.759) [-536.120] (-533.923) * (-536.042) (-532.200) [-535.022] (-532.936) -- 0:00:30
512000 -- [-531.818] (-534.265) (-534.001) (-533.072) * [-531.807] (-535.290) (-533.939) (-534.458) -- 0:00:30
512500 -- [-535.076] (-535.192) (-532.753) (-532.267) * (-534.116) [-535.771] (-533.501) (-535.082) -- 0:00:30
513000 -- (-534.401) [-532.892] (-533.656) (-533.157) * (-533.133) (-531.837) [-531.541] (-533.766) -- 0:00:30
513500 -- (-535.063) (-538.880) (-534.904) [-533.500] * [-534.128] (-533.102) (-531.409) (-532.738) -- 0:00:30
514000 -- (-535.250) (-532.718) [-532.729] (-536.161) * (-532.020) [-532.853] (-531.885) (-531.794) -- 0:00:30
514500 -- (-533.273) [-535.204] (-536.963) (-533.537) * (-533.868) (-529.880) (-531.306) [-532.638] -- 0:00:30
515000 -- [-532.729] (-532.796) (-535.883) (-532.378) * (-532.600) [-532.155] (-537.132) (-533.578) -- 0:00:30
Average standard deviation of split frequencies: 0.010049
515500 -- (-532.446) (-534.870) (-536.110) [-534.403] * (-530.583) (-532.662) [-534.741] (-535.561) -- 0:00:30
516000 -- [-534.579] (-539.484) (-533.199) (-533.834) * (-533.384) (-532.124) [-533.800] (-533.211) -- 0:00:30
516500 -- [-535.354] (-533.593) (-532.793) (-532.455) * (-533.166) (-532.050) (-534.828) [-531.202] -- 0:00:30
517000 -- [-532.878] (-531.162) (-533.184) (-533.890) * (-533.842) (-531.400) (-540.623) [-533.016] -- 0:00:30
517500 -- (-532.942) (-538.026) (-533.706) [-536.387] * (-531.761) (-534.010) (-536.413) [-532.957] -- 0:00:30
518000 -- [-532.908] (-531.575) (-532.940) (-532.734) * [-531.749] (-535.319) (-534.793) (-538.822) -- 0:00:30
518500 -- (-532.378) (-532.800) (-534.205) [-532.781] * (-532.838) [-533.292] (-535.457) (-535.624) -- 0:00:30
519000 -- (-533.437) [-534.305] (-535.585) (-533.658) * (-536.020) (-532.558) [-533.885] (-537.058) -- 0:00:30
519500 -- [-532.480] (-536.872) (-532.665) (-532.954) * (-535.697) (-531.955) [-532.852] (-536.683) -- 0:00:30
520000 -- (-533.706) (-533.347) (-532.526) [-533.537] * (-532.394) [-531.765] (-532.879) (-534.619) -- 0:00:30
Average standard deviation of split frequencies: 0.009557
520500 -- (-532.122) [-533.680] (-533.915) (-532.563) * [-532.469] (-531.275) (-534.174) (-548.565) -- 0:00:30
521000 -- (-531.650) (-533.277) (-534.934) [-534.161] * [-532.488] (-533.529) (-536.336) (-534.863) -- 0:00:30
521500 -- (-531.296) (-535.101) (-533.451) [-533.753] * (-530.624) (-533.659) (-535.126) [-531.959] -- 0:00:30
522000 -- [-533.230] (-533.504) (-534.646) (-533.056) * (-534.530) (-532.475) [-534.580] (-534.623) -- 0:00:30
522500 -- [-533.700] (-534.246) (-533.149) (-536.051) * (-531.273) [-537.427] (-538.531) (-534.158) -- 0:00:30
523000 -- (-535.495) [-533.915] (-534.377) (-535.495) * [-533.430] (-537.689) (-531.398) (-535.273) -- 0:00:30
523500 -- (-536.518) (-532.079) [-532.038] (-532.886) * [-533.869] (-532.361) (-532.397) (-531.941) -- 0:00:30
524000 -- (-533.036) [-532.839] (-532.852) (-533.089) * [-533.629] (-533.902) (-534.452) (-537.350) -- 0:00:29
524500 -- (-533.879) [-532.343] (-533.983) (-534.469) * [-532.656] (-536.911) (-532.435) (-533.174) -- 0:00:29
525000 -- (-537.422) (-532.326) (-532.707) [-532.727] * [-532.465] (-536.572) (-536.585) (-533.341) -- 0:00:29
Average standard deviation of split frequencies: 0.009460
525500 -- (-535.298) [-532.399] (-532.011) (-533.695) * (-534.142) [-533.859] (-535.300) (-532.835) -- 0:00:29
526000 -- (-532.551) (-533.040) [-532.245] (-531.948) * (-534.971) (-535.907) [-535.892] (-530.552) -- 0:00:29
526500 -- [-534.963] (-531.864) (-529.938) (-533.145) * [-533.206] (-534.032) (-535.544) (-532.976) -- 0:00:29
527000 -- [-534.160] (-536.308) (-533.047) (-532.406) * (-533.580) (-535.747) [-533.299] (-534.593) -- 0:00:29
527500 -- (-533.034) (-535.081) [-533.177] (-533.154) * (-535.276) (-534.068) [-532.650] (-536.766) -- 0:00:29
528000 -- (-534.597) [-531.794] (-532.824) (-530.598) * (-533.726) (-533.219) (-532.835) [-533.737] -- 0:00:29
528500 -- (-533.258) (-533.649) (-533.470) [-533.496] * (-533.834) (-533.587) [-532.327] (-534.124) -- 0:00:29
529000 -- (-533.126) (-533.006) (-534.197) [-534.996] * [-534.117] (-530.453) (-531.962) (-534.658) -- 0:00:29
529500 -- (-533.956) (-533.211) (-532.054) [-533.188] * (-536.007) (-535.651) (-532.295) [-530.225] -- 0:00:29
530000 -- (-534.609) (-532.193) (-533.979) [-531.848] * (-532.069) (-532.707) (-534.897) [-530.274] -- 0:00:29
Average standard deviation of split frequencies: 0.009821
530500 -- (-532.375) (-533.924) [-533.778] (-533.030) * (-534.323) [-532.041] (-535.003) (-532.406) -- 0:00:29
531000 -- (-532.516) [-534.076] (-534.586) (-534.673) * (-537.803) [-532.265] (-534.343) (-531.548) -- 0:00:29
531500 -- (-536.096) (-532.819) (-533.938) [-536.562] * (-534.662) [-530.717] (-533.048) (-532.929) -- 0:00:29
532000 -- [-536.408] (-532.021) (-533.600) (-532.732) * (-536.494) (-532.439) [-533.565] (-533.083) -- 0:00:29
532500 -- (-537.818) (-535.582) [-534.838] (-532.257) * (-533.022) (-531.966) [-530.474] (-531.776) -- 0:00:29
533000 -- (-537.461) (-534.254) (-533.535) [-530.982] * (-537.206) (-533.132) (-531.705) [-531.773] -- 0:00:29
533500 -- [-536.330] (-533.589) (-538.833) (-535.230) * (-534.396) (-534.061) (-536.395) [-532.395] -- 0:00:29
534000 -- (-535.423) (-533.303) (-536.606) [-535.201] * (-532.331) [-532.812] (-539.446) (-535.348) -- 0:00:29
534500 -- (-538.985) [-534.718] (-533.735) (-535.021) * (-530.707) [-531.655] (-532.887) (-533.898) -- 0:00:29
535000 -- [-533.016] (-537.500) (-533.530) (-532.690) * (-531.867) (-532.803) (-532.166) [-535.147] -- 0:00:29
Average standard deviation of split frequencies: 0.009919
535500 -- (-533.579) (-533.647) [-534.172] (-531.865) * [-533.287] (-533.578) (-533.895) (-532.339) -- 0:00:29
536000 -- [-535.757] (-532.350) (-541.733) (-534.818) * (-532.534) [-531.821] (-536.602) (-532.986) -- 0:00:29
536500 -- (-532.475) (-533.817) [-532.018] (-532.199) * (-531.207) (-532.012) (-532.858) [-531.815] -- 0:00:29
537000 -- (-534.548) (-534.707) [-533.065] (-531.466) * (-534.127) [-534.055] (-534.476) (-534.495) -- 0:00:29
537500 -- (-536.084) (-536.419) (-532.220) [-533.978] * [-532.509] (-533.139) (-534.476) (-533.845) -- 0:00:29
538000 -- (-533.931) [-538.523] (-534.151) (-533.685) * [-532.590] (-532.395) (-533.036) (-533.926) -- 0:00:29
538500 -- (-537.349) (-534.276) (-537.359) [-531.593] * [-534.541] (-530.341) (-532.313) (-536.496) -- 0:00:29
539000 -- (-535.575) (-533.759) (-533.984) [-532.789] * (-534.850) (-534.037) [-535.284] (-535.411) -- 0:00:29
539500 -- (-535.225) (-532.861) [-533.672] (-535.317) * (-536.877) (-532.939) (-533.308) [-533.000] -- 0:00:29
540000 -- (-533.847) (-532.118) (-532.729) [-533.669] * (-533.913) [-532.028] (-532.101) (-533.547) -- 0:00:28
Average standard deviation of split frequencies: 0.009785
540500 -- (-537.088) [-531.310] (-530.446) (-532.242) * (-532.630) (-536.217) (-531.447) [-534.057] -- 0:00:28
541000 -- [-534.398] (-533.215) (-530.577) (-534.196) * (-532.546) (-532.294) (-538.726) [-536.617] -- 0:00:28
541500 -- (-533.565) (-534.884) (-531.365) [-531.512] * (-535.098) (-532.018) [-534.181] (-532.070) -- 0:00:28
542000 -- [-533.291] (-534.347) (-531.134) (-532.277) * (-535.313) (-535.327) (-534.234) [-533.974] -- 0:00:28
542500 -- (-533.200) [-533.131] (-532.578) (-531.681) * (-534.543) (-534.985) [-533.091] (-537.011) -- 0:00:28
543000 -- (-532.911) (-534.356) (-533.017) [-532.654] * (-534.088) [-531.579] (-533.731) (-536.922) -- 0:00:28
543500 -- (-537.548) (-535.658) (-536.702) [-531.642] * (-532.926) [-531.198] (-534.631) (-535.082) -- 0:00:28
544000 -- (-536.533) [-532.692] (-532.067) (-534.867) * (-532.794) [-531.582] (-532.214) (-533.207) -- 0:00:28
544500 -- (-535.110) (-533.761) (-535.587) [-532.992] * (-533.083) [-537.384] (-537.130) (-536.152) -- 0:00:28
545000 -- (-534.125) (-534.754) (-536.871) [-534.660] * (-533.516) (-532.886) [-532.569] (-533.401) -- 0:00:28
Average standard deviation of split frequencies: 0.009305
545500 -- (-536.583) [-532.850] (-533.890) (-533.564) * [-533.770] (-531.787) (-532.189) (-535.817) -- 0:00:28
546000 -- (-533.005) (-532.648) (-532.754) [-533.794] * (-534.528) (-533.621) (-532.382) [-533.897] -- 0:00:28
546500 -- (-533.535) (-532.584) (-531.879) [-532.665] * (-537.183) (-534.564) [-530.417] (-534.058) -- 0:00:28
547000 -- (-533.588) [-535.637] (-533.015) (-536.567) * (-536.385) [-531.932] (-532.071) (-532.423) -- 0:00:28
547500 -- [-532.513] (-532.688) (-535.675) (-533.197) * [-533.273] (-531.101) (-530.131) (-533.257) -- 0:00:28
548000 -- (-536.660) (-532.635) [-540.186] (-533.404) * (-534.212) (-533.520) [-532.424] (-533.791) -- 0:00:28
548500 -- (-533.502) (-534.169) (-535.603) [-534.858] * (-533.437) (-533.371) [-532.350] (-532.551) -- 0:00:28
549000 -- [-532.114] (-531.568) (-531.445) (-533.932) * (-532.009) (-535.528) (-532.947) [-531.182] -- 0:00:28
549500 -- (-535.513) [-533.982] (-532.539) (-537.111) * (-532.009) [-533.932] (-532.882) (-532.252) -- 0:00:28
550000 -- (-531.997) [-533.624] (-535.220) (-532.595) * (-533.702) (-537.042) [-531.196] (-535.631) -- 0:00:28
Average standard deviation of split frequencies: 0.009369
550500 -- (-530.744) (-532.969) [-534.932] (-532.860) * (-535.621) (-533.023) [-533.165] (-537.894) -- 0:00:28
551000 -- [-534.226] (-533.421) (-535.050) (-533.675) * (-535.457) [-533.532] (-532.079) (-531.081) -- 0:00:28
551500 -- [-535.156] (-533.438) (-540.820) (-532.278) * (-535.174) (-534.467) (-532.816) [-534.529] -- 0:00:28
552000 -- (-534.443) [-533.057] (-533.645) (-538.608) * [-533.028] (-533.585) (-533.007) (-535.592) -- 0:00:28
552500 -- [-532.861] (-535.124) (-532.963) (-531.817) * (-534.563) [-531.269] (-533.131) (-534.134) -- 0:00:28
553000 -- [-530.789] (-532.940) (-533.926) (-537.953) * (-531.944) [-532.136] (-534.033) (-533.996) -- 0:00:28
553500 -- (-533.414) [-531.869] (-532.773) (-538.027) * [-535.200] (-533.117) (-532.750) (-535.658) -- 0:00:28
554000 -- (-540.341) [-531.544] (-536.192) (-532.054) * (-537.780) (-533.750) (-534.518) [-531.964] -- 0:00:28
554500 -- (-535.493) [-534.810] (-533.192) (-534.385) * [-532.442] (-533.581) (-531.821) (-534.433) -- 0:00:28
555000 -- [-532.680] (-534.685) (-532.755) (-534.506) * (-533.020) (-534.186) (-531.456) [-533.069] -- 0:00:28
Average standard deviation of split frequencies: 0.009373
555500 -- (-532.805) (-532.941) (-535.586) [-535.839] * [-533.879] (-533.950) (-534.732) (-534.863) -- 0:00:28
556000 -- (-533.589) [-536.923] (-535.060) (-534.514) * (-535.209) (-535.700) [-532.538] (-535.461) -- 0:00:27
556500 -- (-534.120) (-531.592) (-535.007) [-532.521] * (-531.459) [-535.691] (-533.852) (-535.931) -- 0:00:27
557000 -- (-533.971) (-532.482) [-533.324] (-532.850) * (-532.475) (-534.054) (-533.758) [-535.274] -- 0:00:27
557500 -- (-534.408) (-533.796) [-533.430] (-534.626) * (-534.202) [-532.993] (-533.263) (-534.092) -- 0:00:27
558000 -- (-531.806) (-534.180) [-533.734] (-533.403) * (-533.789) (-533.852) [-535.988] (-533.234) -- 0:00:27
558500 -- (-534.336) (-532.291) (-532.009) [-538.315] * [-532.797] (-535.144) (-539.942) (-533.991) -- 0:00:27
559000 -- (-532.438) (-533.710) (-533.552) [-533.117] * (-533.254) (-536.857) [-536.640] (-532.999) -- 0:00:27
559500 -- [-532.168] (-533.056) (-530.732) (-537.414) * (-532.892) (-534.006) (-532.640) [-532.641] -- 0:00:27
560000 -- (-532.166) (-533.617) [-531.120] (-533.128) * (-533.632) (-536.372) (-532.556) [-532.389] -- 0:00:27
Average standard deviation of split frequencies: 0.009199
560500 -- (-533.563) [-532.075] (-532.336) (-534.965) * (-536.325) (-532.736) (-536.648) [-531.904] -- 0:00:27
561000 -- [-532.980] (-532.408) (-534.237) (-533.839) * (-531.659) (-534.554) (-533.922) [-533.921] -- 0:00:27
561500 -- (-533.090) (-534.550) (-533.133) [-533.345] * (-531.922) (-534.110) [-530.351] (-536.052) -- 0:00:27
562000 -- [-534.824] (-533.015) (-535.311) (-535.499) * (-534.740) (-533.021) (-531.119) [-531.942] -- 0:00:27
562500 -- (-533.531) (-535.400) (-534.577) [-533.944] * (-533.968) [-532.667] (-533.400) (-537.279) -- 0:00:27
563000 -- [-534.996] (-534.389) (-531.021) (-533.917) * [-534.462] (-533.206) (-535.355) (-532.913) -- 0:00:27
563500 -- [-532.588] (-533.580) (-533.429) (-531.752) * [-534.650] (-535.211) (-530.349) (-534.378) -- 0:00:27
564000 -- [-538.288] (-533.265) (-534.281) (-532.996) * (-533.473) (-534.038) [-535.434] (-533.045) -- 0:00:27
564500 -- (-539.610) (-531.684) [-536.292] (-534.376) * (-535.262) (-533.117) (-534.337) [-533.558] -- 0:00:27
565000 -- (-537.518) (-532.976) (-532.593) [-533.378] * (-538.944) (-531.869) [-530.607] (-535.717) -- 0:00:27
Average standard deviation of split frequencies: 0.009358
565500 -- (-533.801) (-537.054) [-532.060] (-532.693) * [-536.065] (-537.219) (-532.694) (-534.069) -- 0:00:27
566000 -- [-532.241] (-531.101) (-533.592) (-534.164) * (-534.412) (-537.502) [-531.620] (-532.777) -- 0:00:27
566500 -- (-538.256) [-531.572] (-533.008) (-538.372) * [-533.072] (-534.015) (-534.084) (-532.751) -- 0:00:27
567000 -- (-535.169) (-533.483) [-531.536] (-532.416) * [-532.850] (-533.011) (-533.066) (-534.412) -- 0:00:27
567500 -- (-534.292) (-530.989) (-532.679) [-530.721] * (-532.976) (-534.445) [-532.813] (-534.442) -- 0:00:27
568000 -- (-532.673) [-531.636] (-536.078) (-531.885) * (-534.583) (-537.262) [-531.457] (-533.756) -- 0:00:27
568500 -- [-534.291] (-531.417) (-531.107) (-536.989) * (-535.466) [-533.296] (-531.756) (-533.418) -- 0:00:27
569000 -- [-535.866] (-532.023) (-533.240) (-534.065) * [-533.681] (-534.052) (-533.188) (-537.067) -- 0:00:27
569500 -- [-535.903] (-532.743) (-532.649) (-533.719) * (-534.131) (-536.697) [-531.106] (-534.095) -- 0:00:27
570000 -- [-530.594] (-532.604) (-532.515) (-532.143) * (-532.540) (-534.112) (-533.574) [-537.703] -- 0:00:27
Average standard deviation of split frequencies: 0.009378
570500 -- [-533.135] (-536.079) (-535.817) (-531.064) * [-536.902] (-534.694) (-530.356) (-534.024) -- 0:00:27
571000 -- (-532.502) [-537.829] (-537.093) (-533.666) * [-531.668] (-534.613) (-533.652) (-531.003) -- 0:00:27
571500 -- (-532.419) [-532.791] (-532.084) (-536.173) * (-532.072) (-535.006) [-534.138] (-532.864) -- 0:00:26
572000 -- [-532.648] (-532.752) (-541.160) (-530.925) * (-532.532) (-534.738) (-532.501) [-534.266] -- 0:00:26
572500 -- (-534.268) [-533.246] (-533.180) (-532.357) * (-532.533) (-534.217) (-533.834) [-533.875] -- 0:00:26
573000 -- (-532.889) (-536.523) (-531.815) [-533.900] * (-535.188) (-533.491) [-532.983] (-532.983) -- 0:00:26
573500 -- [-532.308] (-535.462) (-533.528) (-535.026) * (-532.888) (-533.859) [-533.154] (-531.030) -- 0:00:26
574000 -- (-537.224) [-531.638] (-532.889) (-533.049) * [-532.618] (-536.284) (-533.973) (-532.290) -- 0:00:26
574500 -- (-535.728) (-532.949) (-534.201) [-532.728] * (-532.880) (-532.617) [-534.843] (-532.101) -- 0:00:26
575000 -- (-534.212) (-531.631) (-538.449) [-531.268] * (-535.858) (-532.034) (-532.588) [-530.343] -- 0:00:26
Average standard deviation of split frequencies: 0.009243
575500 -- [-535.053] (-531.497) (-533.307) (-531.635) * (-532.242) [-535.135] (-535.866) (-531.253) -- 0:00:26
576000 -- (-536.282) (-532.737) (-532.189) [-531.352] * (-533.072) (-533.723) [-535.344] (-532.959) -- 0:00:26
576500 -- (-533.661) (-533.443) (-533.186) [-533.402] * (-533.512) (-532.252) [-532.438] (-532.622) -- 0:00:26
577000 -- (-532.834) [-533.121] (-538.718) (-537.566) * (-532.581) (-532.734) [-533.712] (-533.479) -- 0:00:26
577500 -- [-535.404] (-534.893) (-542.636) (-536.230) * (-532.309) (-532.312) (-533.549) [-533.070] -- 0:00:26
578000 -- (-539.240) (-533.941) [-531.890] (-530.910) * (-532.256) (-532.023) (-531.581) [-533.449] -- 0:00:26
578500 -- (-532.744) (-532.187) (-533.381) [-534.208] * (-533.089) [-529.751] (-531.476) (-532.876) -- 0:00:26
579000 -- (-537.027) (-532.644) (-535.161) [-535.518] * (-532.988) [-533.282] (-533.387) (-530.456) -- 0:00:26
579500 -- (-532.649) (-537.442) [-533.376] (-535.325) * (-531.694) (-529.777) [-533.715] (-532.899) -- 0:00:26
580000 -- (-536.632) (-532.280) (-534.125) [-530.815] * (-540.474) (-530.818) [-533.537] (-534.513) -- 0:00:26
Average standard deviation of split frequencies: 0.009838
580500 -- (-534.490) (-534.575) [-532.695] (-532.933) * [-539.282] (-537.028) (-538.101) (-533.405) -- 0:00:26
581000 -- (-534.970) (-533.380) [-533.456] (-532.518) * (-536.185) (-536.766) [-531.400] (-532.556) -- 0:00:26
581500 -- [-532.325] (-533.350) (-532.483) (-534.755) * (-533.276) (-533.645) [-532.082] (-531.540) -- 0:00:26
582000 -- [-533.200] (-533.726) (-532.957) (-533.371) * [-534.114] (-532.205) (-534.884) (-532.062) -- 0:00:26
582500 -- (-533.309) [-534.974] (-534.402) (-531.665) * (-536.154) (-533.307) (-534.763) [-531.586] -- 0:00:26
583000 -- (-533.706) (-534.331) [-535.623] (-532.342) * (-534.381) (-534.715) [-531.854] (-536.123) -- 0:00:26
583500 -- (-533.318) (-533.083) (-533.657) [-530.415] * [-531.840] (-533.483) (-534.848) (-533.257) -- 0:00:26
584000 -- (-532.832) (-533.064) [-531.961] (-532.128) * [-533.655] (-537.227) (-532.516) (-533.000) -- 0:00:26
584500 -- (-531.853) (-533.506) (-531.144) [-532.279] * [-535.863] (-536.964) (-535.036) (-535.022) -- 0:00:26
585000 -- (-533.172) (-537.268) (-532.292) [-533.949] * (-532.174) (-533.897) (-534.641) [-533.224] -- 0:00:26
Average standard deviation of split frequencies: 0.010268
585500 -- [-538.437] (-537.880) (-533.188) (-532.176) * [-533.825] (-532.074) (-535.495) (-533.352) -- 0:00:26
586000 -- (-531.313) (-538.180) (-533.391) [-531.992] * (-534.066) (-532.445) [-533.358] (-535.317) -- 0:00:26
586500 -- [-533.833] (-537.655) (-533.265) (-532.470) * (-533.595) [-532.642] (-534.611) (-535.174) -- 0:00:26
587000 -- [-533.354] (-533.028) (-532.168) (-531.435) * (-532.225) [-531.322] (-532.485) (-535.513) -- 0:00:26
587500 -- (-531.818) (-533.074) [-532.372] (-531.020) * (-532.712) (-531.801) (-534.965) [-537.925] -- 0:00:25
588000 -- (-536.761) (-533.236) [-533.851] (-533.682) * (-537.634) (-531.995) [-531.999] (-534.535) -- 0:00:25
588500 -- [-534.988] (-535.510) (-530.976) (-532.318) * (-535.396) [-534.233] (-534.010) (-532.478) -- 0:00:25
589000 -- (-535.064) [-532.676] (-532.547) (-533.705) * (-533.056) (-534.773) (-534.337) [-532.681] -- 0:00:25
589500 -- [-535.661] (-533.224) (-531.929) (-530.743) * (-534.373) (-535.731) [-532.997] (-535.270) -- 0:00:25
590000 -- (-533.450) (-532.638) (-530.210) [-532.530] * (-534.567) (-532.276) (-535.398) [-532.682] -- 0:00:25
Average standard deviation of split frequencies: 0.010140
590500 -- [-531.703] (-534.553) (-535.429) (-532.305) * (-533.384) (-531.786) [-536.340] (-534.114) -- 0:00:25
591000 -- (-530.938) [-534.776] (-533.048) (-533.532) * [-533.299] (-534.313) (-536.444) (-530.246) -- 0:00:25
591500 -- (-534.428) (-536.798) [-535.746] (-532.225) * (-534.705) [-532.771] (-534.735) (-535.093) -- 0:00:25
592000 -- (-534.581) (-535.631) [-531.481] (-533.241) * (-532.527) (-532.310) [-539.989] (-534.436) -- 0:00:25
592500 -- (-533.778) (-536.963) (-535.742) [-531.606] * (-532.752) (-535.384) (-536.752) [-533.538] -- 0:00:25
593000 -- [-533.606] (-537.136) (-534.862) (-531.963) * [-534.962] (-533.299) (-533.353) (-532.047) -- 0:00:25
593500 -- [-529.984] (-535.675) (-533.741) (-533.914) * (-538.229) (-531.066) [-534.146] (-531.860) -- 0:00:25
594000 -- [-533.752] (-544.172) (-534.540) (-535.689) * [-532.329] (-534.599) (-537.431) (-532.413) -- 0:00:25
594500 -- (-530.740) (-535.579) [-534.207] (-530.975) * (-534.398) [-532.938] (-535.091) (-532.636) -- 0:00:25
595000 -- (-534.265) (-535.813) (-536.879) [-533.540] * (-535.284) [-530.793] (-532.449) (-533.404) -- 0:00:25
Average standard deviation of split frequencies: 0.009305
595500 -- (-532.481) [-539.372] (-536.435) (-534.640) * (-532.993) (-534.898) [-534.580] (-536.233) -- 0:00:25
596000 -- (-532.265) [-533.366] (-534.434) (-531.869) * [-532.668] (-534.536) (-535.141) (-535.404) -- 0:00:25
596500 -- (-533.279) (-530.640) (-536.154) [-532.259] * (-533.445) [-534.868] (-532.365) (-535.972) -- 0:00:25
597000 -- [-532.935] (-534.658) (-536.082) (-533.157) * (-535.565) (-532.444) [-531.821] (-532.352) -- 0:00:25
597500 -- (-533.749) (-537.032) (-537.191) [-532.192] * (-533.413) (-535.749) (-534.314) [-532.877] -- 0:00:25
598000 -- (-532.494) [-532.767] (-533.123) (-532.757) * (-534.866) (-532.674) (-531.864) [-535.047] -- 0:00:25
598500 -- (-533.028) (-532.170) [-533.730] (-535.521) * (-534.991) (-532.252) (-535.081) [-532.314] -- 0:00:25
599000 -- (-530.879) (-533.516) [-534.612] (-534.442) * (-533.428) (-529.905) [-536.789] (-531.967) -- 0:00:25
599500 -- [-533.670] (-534.102) (-534.161) (-533.780) * (-533.299) (-532.266) [-531.001] (-532.707) -- 0:00:25
600000 -- (-534.910) [-534.521] (-532.722) (-533.364) * (-532.616) (-532.766) [-532.995] (-534.103) -- 0:00:25
Average standard deviation of split frequencies: 0.009371
600500 -- [-530.937] (-539.826) (-534.150) (-532.114) * [-535.954] (-534.051) (-535.710) (-534.294) -- 0:00:25
601000 -- [-533.111] (-536.954) (-532.532) (-531.595) * (-535.474) [-532.577] (-532.378) (-533.781) -- 0:00:25
601500 -- (-532.700) (-534.449) (-533.063) [-533.365] * (-531.691) [-532.811] (-532.949) (-532.928) -- 0:00:25
602000 -- [-531.592] (-532.320) (-532.439) (-536.750) * (-531.889) (-532.363) [-532.797] (-533.857) -- 0:00:25
602500 -- [-530.999] (-534.234) (-535.584) (-538.406) * (-532.232) (-533.287) [-533.060] (-531.427) -- 0:00:25
603000 -- (-531.001) (-533.514) [-531.185] (-536.749) * (-538.906) (-532.701) (-535.749) [-536.320] -- 0:00:25
603500 -- (-530.938) (-532.496) (-532.666) [-532.500] * (-531.598) (-532.898) [-531.911] (-533.685) -- 0:00:24
604000 -- (-532.947) [-531.119] (-533.488) (-533.347) * (-532.348) [-530.699] (-533.036) (-532.581) -- 0:00:24
604500 -- (-533.367) (-533.372) [-535.389] (-535.606) * (-530.093) (-533.239) [-532.246] (-532.464) -- 0:00:24
605000 -- [-531.199] (-532.930) (-533.986) (-535.103) * (-538.297) (-532.020) (-534.688) [-531.103] -- 0:00:24
Average standard deviation of split frequencies: 0.009655
605500 -- (-535.299) [-531.866] (-533.279) (-531.794) * (-535.845) (-531.730) (-534.581) [-531.034] -- 0:00:24
606000 -- [-531.944] (-536.536) (-535.016) (-534.469) * (-534.989) [-530.095] (-535.125) (-534.945) -- 0:00:24
606500 -- (-530.336) [-531.262] (-533.674) (-533.362) * (-535.528) [-535.460] (-533.681) (-532.798) -- 0:00:24
607000 -- [-532.040] (-531.933) (-532.025) (-532.751) * (-536.865) [-533.234] (-532.942) (-533.216) -- 0:00:24
607500 -- [-532.367] (-531.287) (-534.665) (-536.996) * (-534.009) [-535.743] (-530.179) (-532.475) -- 0:00:24
608000 -- (-534.713) (-531.747) (-534.748) [-532.352] * (-532.567) (-531.554) (-530.166) [-531.726] -- 0:00:24
608500 -- [-532.071] (-532.767) (-533.164) (-532.414) * (-537.809) (-536.417) (-531.719) [-533.752] -- 0:00:24
609000 -- (-536.734) [-534.234] (-535.002) (-535.121) * (-537.196) (-532.501) [-532.593] (-530.710) -- 0:00:24
609500 -- (-531.574) (-534.750) (-532.998) [-533.143] * (-533.270) (-534.286) (-534.793) [-535.631] -- 0:00:24
610000 -- (-533.058) [-530.928] (-533.390) (-534.070) * [-531.288] (-532.469) (-533.435) (-534.819) -- 0:00:24
Average standard deviation of split frequencies: 0.009854
610500 -- [-532.950] (-532.291) (-541.012) (-533.046) * (-532.788) (-534.803) (-532.346) [-532.136] -- 0:00:24
611000 -- (-531.384) [-531.063] (-534.752) (-532.000) * [-532.567] (-535.302) (-534.592) (-532.886) -- 0:00:24
611500 -- (-532.429) (-534.894) (-532.355) [-533.376] * (-533.206) [-533.876] (-533.435) (-534.437) -- 0:00:24
612000 -- (-536.193) (-532.257) [-534.532] (-537.922) * (-533.156) (-535.978) [-532.227] (-534.404) -- 0:00:24
612500 -- (-530.266) (-533.323) (-533.073) [-533.911] * (-533.583) (-532.387) (-534.635) [-535.426] -- 0:00:24
613000 -- (-531.984) [-531.939] (-535.539) (-534.395) * [-534.437] (-537.959) (-532.528) (-531.791) -- 0:00:24
613500 -- [-532.134] (-535.275) (-533.383) (-532.055) * (-534.641) (-536.654) (-532.932) [-533.721] -- 0:00:24
614000 -- (-534.487) (-534.320) (-534.031) [-534.757] * (-531.296) (-535.301) (-537.534) [-531.649] -- 0:00:24
614500 -- (-536.240) (-532.765) [-532.337] (-532.903) * (-535.937) (-533.286) (-532.801) [-534.723] -- 0:00:24
615000 -- (-536.898) (-531.517) (-534.493) [-532.900] * (-532.871) (-532.918) (-532.262) [-535.658] -- 0:00:24
Average standard deviation of split frequencies: 0.009318
615500 -- (-533.731) [-531.064] (-536.572) (-536.539) * [-532.134] (-533.084) (-534.090) (-535.278) -- 0:00:24
616000 -- (-533.801) (-532.824) (-532.508) [-535.414] * (-533.560) [-532.972] (-532.269) (-542.374) -- 0:00:24
616500 -- [-533.554] (-533.263) (-532.999) (-533.347) * (-533.368) (-532.258) (-530.958) [-533.341] -- 0:00:24
617000 -- (-533.267) (-533.112) [-530.884] (-531.796) * (-535.478) (-532.762) [-537.208] (-531.147) -- 0:00:24
617500 -- (-534.817) [-532.425] (-532.984) (-532.736) * (-534.566) (-531.720) (-534.701) [-532.163] -- 0:00:24
618000 -- [-533.870] (-532.516) (-533.334) (-531.631) * (-535.045) (-531.247) (-536.404) [-530.867] -- 0:00:24
618500 -- (-533.311) [-534.857] (-530.708) (-531.776) * (-535.347) (-537.414) [-530.853] (-533.914) -- 0:00:24
619000 -- (-532.569) (-538.657) (-532.936) [-533.719] * [-534.065] (-534.016) (-536.275) (-535.512) -- 0:00:24
619500 -- [-533.794] (-535.301) (-532.627) (-534.335) * [-532.008] (-532.030) (-535.688) (-535.251) -- 0:00:23
620000 -- (-536.808) (-535.354) [-534.759] (-531.914) * (-534.977) (-535.146) [-535.867] (-534.411) -- 0:00:23
Average standard deviation of split frequencies: 0.009159
620500 -- (-536.885) (-535.822) [-532.324] (-532.581) * [-533.011] (-532.633) (-533.866) (-535.864) -- 0:00:23
621000 -- (-532.997) [-533.499] (-533.344) (-533.194) * (-533.204) (-531.667) (-532.502) [-532.578] -- 0:00:23
621500 -- (-534.719) [-536.200] (-535.730) (-532.142) * (-533.053) [-531.349] (-534.081) (-532.935) -- 0:00:23
622000 -- [-532.430] (-534.607) (-533.846) (-532.543) * (-534.263) (-535.008) [-530.368] (-536.372) -- 0:00:23
622500 -- (-533.465) (-531.889) (-532.457) [-532.323] * (-536.188) [-533.778] (-531.767) (-531.845) -- 0:00:23
623000 -- (-532.191) (-534.841) (-533.006) [-532.619] * (-532.706) [-534.013] (-535.446) (-532.591) -- 0:00:23
623500 -- (-533.869) (-533.604) [-533.972] (-531.393) * (-536.405) (-531.974) (-536.976) [-535.081] -- 0:00:23
624000 -- (-535.559) [-533.199] (-532.427) (-534.245) * (-536.641) (-533.161) (-531.195) [-534.943] -- 0:00:23
624500 -- [-535.223] (-535.407) (-536.740) (-534.490) * (-536.037) (-536.560) [-530.265] (-537.749) -- 0:00:23
625000 -- (-532.690) [-532.432] (-536.173) (-532.293) * (-530.779) [-533.568] (-530.668) (-532.666) -- 0:00:23
Average standard deviation of split frequencies: 0.009214
625500 -- (-531.958) (-534.371) (-535.669) [-538.015] * (-534.830) (-534.355) [-533.292] (-536.608) -- 0:00:23
626000 -- (-536.706) (-536.501) (-533.695) [-532.498] * (-532.543) [-533.049] (-530.970) (-533.915) -- 0:00:23
626500 -- (-533.465) (-534.180) (-530.755) [-531.951] * (-534.987) (-536.335) (-532.856) [-533.642] -- 0:00:23
627000 -- (-530.831) (-533.054) [-531.996] (-532.078) * (-532.694) [-532.706] (-531.979) (-530.653) -- 0:00:23
627500 -- (-534.583) [-534.875] (-532.744) (-533.101) * (-534.854) (-532.402) (-531.013) [-533.218] -- 0:00:23
628000 -- (-536.266) (-532.063) (-537.969) [-532.178] * (-534.408) (-531.991) [-530.866] (-532.866) -- 0:00:23
628500 -- [-532.395] (-531.999) (-535.278) (-533.238) * (-534.483) (-533.906) (-535.509) [-534.568] -- 0:00:23
629000 -- (-534.706) (-531.803) (-533.203) [-532.160] * (-534.430) (-533.936) (-531.123) [-533.915] -- 0:00:23
629500 -- (-533.235) (-534.470) (-533.462) [-537.504] * (-533.096) (-532.364) (-532.959) [-532.124] -- 0:00:23
630000 -- [-534.049] (-535.499) (-533.429) (-534.666) * (-535.153) [-535.116] (-532.179) (-531.922) -- 0:00:23
Average standard deviation of split frequencies: 0.009102
630500 -- (-533.122) (-532.975) (-531.664) [-531.269] * (-531.435) (-533.556) [-532.798] (-534.780) -- 0:00:23
631000 -- (-535.541) [-533.928] (-532.680) (-533.013) * (-532.160) (-535.502) (-533.086) [-532.911] -- 0:00:23
631500 -- (-533.387) (-534.824) [-533.344] (-532.983) * (-531.803) (-536.460) [-539.973] (-537.734) -- 0:00:23
632000 -- [-532.777] (-536.701) (-532.102) (-535.304) * (-533.497) (-534.734) (-537.422) [-534.483] -- 0:00:23
632500 -- [-532.136] (-533.878) (-532.356) (-536.394) * (-533.651) (-534.730) (-535.688) [-531.642] -- 0:00:23
633000 -- [-531.369] (-533.504) (-533.899) (-535.935) * [-531.515] (-532.644) (-538.506) (-533.374) -- 0:00:23
633500 -- (-530.348) (-534.135) [-533.831] (-533.397) * (-539.209) (-531.953) (-534.480) [-533.414] -- 0:00:23
634000 -- [-532.599] (-533.727) (-532.899) (-539.653) * (-532.396) (-534.841) [-536.274] (-531.072) -- 0:00:23
634500 -- (-532.215) (-535.099) [-533.459] (-532.106) * (-532.170) [-532.060] (-532.789) (-533.759) -- 0:00:23
635000 -- (-534.919) (-532.507) [-532.113] (-531.704) * (-531.933) [-532.147] (-533.186) (-531.134) -- 0:00:22
Average standard deviation of split frequencies: 0.009374
635500 -- (-531.986) (-541.191) [-533.130] (-535.854) * (-532.138) (-533.667) (-535.710) [-530.416] -- 0:00:22
636000 -- (-534.927) (-539.688) (-532.735) [-532.106] * (-532.893) (-534.919) [-531.161] (-532.734) -- 0:00:22
636500 -- (-534.720) (-535.014) (-533.711) [-536.009] * (-538.042) (-534.217) (-533.347) [-534.286] -- 0:00:22
637000 -- [-531.467] (-532.475) (-537.453) (-531.201) * (-530.720) (-532.278) (-534.250) [-531.367] -- 0:00:22
637500 -- (-533.172) [-532.162] (-531.320) (-532.753) * (-532.402) [-531.414] (-535.091) (-530.257) -- 0:00:22
638000 -- (-532.788) (-531.520) (-532.358) [-533.886] * (-532.955) (-535.887) [-537.660] (-531.938) -- 0:00:22
638500 -- (-532.611) [-531.673] (-534.513) (-535.177) * (-532.155) [-535.486] (-535.759) (-531.066) -- 0:00:22
639000 -- (-531.891) (-533.701) (-532.756) [-533.836] * (-535.980) (-535.239) (-537.105) [-530.505] -- 0:00:22
639500 -- (-532.902) (-534.213) (-533.048) [-533.395] * (-535.786) (-532.724) (-536.584) [-532.481] -- 0:00:22
640000 -- (-531.230) [-535.784] (-532.085) (-529.640) * (-538.759) [-532.425] (-536.021) (-532.549) -- 0:00:22
Average standard deviation of split frequencies: 0.009565
640500 -- (-530.856) (-531.383) [-532.862] (-533.283) * (-536.337) [-532.292] (-534.065) (-535.997) -- 0:00:22
641000 -- (-533.699) [-534.106] (-532.933) (-535.104) * (-532.805) (-532.379) (-532.658) [-533.934] -- 0:00:22
641500 -- [-531.976] (-536.738) (-531.030) (-535.795) * (-538.909) [-531.232] (-531.895) (-535.435) -- 0:00:22
642000 -- (-531.401) (-541.003) (-533.604) [-537.189] * [-537.001] (-531.926) (-533.085) (-538.878) -- 0:00:22
642500 -- (-532.467) (-534.837) [-535.652] (-530.603) * [-534.302] (-533.450) (-536.085) (-535.572) -- 0:00:22
643000 -- (-534.219) (-534.235) (-531.160) [-532.959] * (-530.719) (-535.289) (-534.731) [-532.201] -- 0:00:22
643500 -- (-531.795) (-532.409) (-533.981) [-532.820] * (-531.841) (-532.968) [-531.476] (-535.737) -- 0:00:22
644000 -- (-534.326) [-531.923] (-532.681) (-534.765) * (-531.019) (-536.002) [-532.917] (-531.740) -- 0:00:22
644500 -- [-533.133] (-533.794) (-531.646) (-532.314) * (-532.653) [-532.257] (-535.793) (-534.799) -- 0:00:22
645000 -- (-532.076) [-532.407] (-531.822) (-533.717) * (-536.703) (-538.786) (-532.081) [-531.147] -- 0:00:22
Average standard deviation of split frequencies: 0.009143
645500 -- (-532.698) (-538.612) (-531.158) [-534.209] * (-534.031) [-533.248] (-534.292) (-532.747) -- 0:00:22
646000 -- (-533.062) (-534.138) [-531.443] (-532.011) * (-533.198) (-534.038) (-535.784) [-533.610] -- 0:00:22
646500 -- [-533.365] (-533.204) (-533.962) (-532.896) * (-534.773) (-538.082) (-535.596) [-534.593] -- 0:00:22
647000 -- (-534.336) (-532.328) (-532.968) [-530.666] * [-531.288] (-532.645) (-532.533) (-534.502) -- 0:00:22
647500 -- (-532.184) (-533.887) (-535.970) [-530.732] * (-537.966) [-530.665] (-533.959) (-535.018) -- 0:00:22
648000 -- (-533.541) (-533.209) [-533.716] (-537.473) * [-530.674] (-531.935) (-531.669) (-532.803) -- 0:00:22
648500 -- (-533.419) [-533.875] (-532.734) (-539.487) * (-535.973) (-531.001) (-533.361) [-534.258] -- 0:00:22
649000 -- (-535.363) [-532.151] (-531.666) (-534.464) * (-536.280) [-533.808] (-536.866) (-531.304) -- 0:00:22
649500 -- (-532.643) [-533.882] (-532.089) (-531.831) * (-535.471) [-536.495] (-536.097) (-532.775) -- 0:00:22
650000 -- [-533.619] (-530.695) (-534.559) (-533.012) * (-532.707) (-532.093) [-533.354] (-534.767) -- 0:00:22
Average standard deviation of split frequencies: 0.009418
650500 -- [-533.966] (-533.018) (-533.961) (-531.265) * [-533.261] (-537.763) (-540.181) (-535.017) -- 0:00:22
651000 -- (-536.825) (-532.523) (-533.566) [-532.403] * (-535.306) [-533.036] (-537.724) (-539.053) -- 0:00:21
651500 -- (-534.791) (-532.826) (-540.478) [-533.150] * (-533.866) [-533.988] (-533.492) (-534.482) -- 0:00:21
652000 -- (-533.035) (-532.532) [-534.742] (-535.304) * [-531.679] (-533.125) (-534.199) (-534.170) -- 0:00:21
652500 -- [-530.705] (-535.398) (-532.120) (-534.133) * (-534.046) (-535.481) [-532.966] (-535.477) -- 0:00:21
653000 -- [-530.872] (-533.800) (-530.259) (-534.264) * (-532.688) (-536.220) [-532.910] (-532.833) -- 0:00:21
653500 -- (-533.360) [-533.956] (-533.446) (-530.570) * (-533.584) (-534.031) (-533.562) [-533.698] -- 0:00:21
654000 -- (-530.449) (-533.952) (-531.863) [-532.313] * (-531.163) [-531.516] (-530.925) (-530.843) -- 0:00:21
654500 -- [-531.255] (-530.123) (-533.350) (-532.640) * (-531.389) (-535.628) (-534.704) [-531.635] -- 0:00:21
655000 -- (-532.110) (-532.217) (-534.474) [-532.462] * (-533.752) (-532.187) [-532.800] (-532.330) -- 0:00:21
Average standard deviation of split frequencies: 0.009215
655500 -- (-533.523) [-531.299] (-532.327) (-532.657) * [-533.320] (-532.027) (-535.703) (-532.766) -- 0:00:21
656000 -- (-530.811) (-532.748) [-534.808] (-534.422) * (-533.141) (-532.306) [-531.807] (-532.737) -- 0:00:21
656500 -- (-532.977) [-532.780] (-537.768) (-533.202) * (-534.481) (-532.543) (-531.739) [-535.212] -- 0:00:21
657000 -- (-531.924) [-535.174] (-532.623) (-530.658) * (-531.828) (-531.803) (-533.007) [-532.541] -- 0:00:21
657500 -- (-533.774) [-530.178] (-533.885) (-531.222) * [-534.838] (-535.308) (-534.391) (-534.096) -- 0:00:21
658000 -- [-532.924] (-539.159) (-531.460) (-533.858) * (-530.802) (-532.222) (-537.876) [-531.601] -- 0:00:21
658500 -- [-534.204] (-530.906) (-534.477) (-532.372) * [-531.805] (-536.027) (-535.222) (-536.240) -- 0:00:21
659000 -- (-531.409) (-533.086) [-532.480] (-532.873) * (-532.271) (-536.119) [-532.591] (-534.124) -- 0:00:21
659500 -- [-532.271] (-532.605) (-531.979) (-534.698) * (-533.039) (-530.822) (-531.334) [-532.403] -- 0:00:21
660000 -- (-536.289) [-533.857] (-534.374) (-532.487) * [-531.047] (-534.913) (-533.009) (-535.131) -- 0:00:21
Average standard deviation of split frequencies: 0.009360
660500 -- [-530.434] (-535.197) (-533.406) (-531.743) * (-534.305) (-533.801) [-535.291] (-533.028) -- 0:00:21
661000 -- (-532.601) (-538.098) (-534.099) [-536.743] * (-532.950) [-533.266] (-536.532) (-534.027) -- 0:00:21
661500 -- (-532.086) (-532.708) [-531.511] (-533.525) * (-532.209) [-532.532] (-535.235) (-533.690) -- 0:00:21
662000 -- [-531.450] (-532.778) (-532.120) (-532.279) * (-532.275) [-530.983] (-537.968) (-532.087) -- 0:00:21
662500 -- (-531.080) (-532.136) [-532.920] (-533.313) * (-533.182) (-536.949) (-532.804) [-532.412] -- 0:00:21
663000 -- [-531.666] (-536.341) (-533.244) (-533.498) * (-533.689) (-533.493) (-535.938) [-534.509] -- 0:00:21
663500 -- (-534.571) (-534.593) (-531.946) [-531.537] * (-535.117) [-533.770] (-534.616) (-532.410) -- 0:00:21
664000 -- [-531.288] (-533.050) (-535.022) (-531.556) * (-532.494) [-536.630] (-535.471) (-533.017) -- 0:00:21
664500 -- (-533.185) [-532.961] (-533.535) (-534.528) * (-533.449) [-533.068] (-534.211) (-533.009) -- 0:00:21
665000 -- (-533.952) [-532.447] (-533.358) (-534.831) * (-532.166) [-532.693] (-530.666) (-532.699) -- 0:00:21
Average standard deviation of split frequencies: 0.009160
665500 -- (-535.852) (-532.092) [-532.140] (-533.747) * (-532.848) [-533.016] (-536.857) (-534.773) -- 0:00:21
666000 -- (-535.549) (-532.083) (-536.937) [-531.554] * (-533.671) (-535.639) (-534.747) [-534.208] -- 0:00:21
666500 -- [-531.547] (-532.352) (-539.129) (-534.095) * (-534.187) (-532.088) [-533.609] (-531.650) -- 0:00:21
667000 -- [-533.588] (-531.283) (-539.505) (-532.105) * [-532.017] (-531.645) (-535.548) (-532.167) -- 0:00:20
667500 -- (-532.648) [-533.012] (-534.070) (-532.611) * (-533.005) [-530.537] (-530.985) (-531.073) -- 0:00:20
668000 -- (-531.670) (-534.250) [-538.527] (-531.466) * (-533.058) (-534.189) (-538.993) [-531.569] -- 0:00:20
668500 -- [-533.488] (-533.865) (-533.419) (-532.815) * (-536.115) (-534.153) (-538.435) [-532.864] -- 0:00:20
669000 -- (-533.321) [-533.600] (-534.829) (-534.863) * (-541.229) (-533.050) [-533.895] (-538.623) -- 0:00:20
669500 -- (-530.279) [-532.646] (-535.528) (-531.116) * (-533.868) (-532.951) [-538.782] (-534.816) -- 0:00:20
670000 -- (-533.180) (-533.910) (-534.501) [-532.247] * (-532.452) (-533.041) [-533.635] (-535.605) -- 0:00:20
Average standard deviation of split frequencies: 0.008931
670500 -- (-533.337) (-535.171) [-534.027] (-530.846) * (-537.031) [-537.351] (-533.087) (-534.708) -- 0:00:20
671000 -- (-533.518) [-536.295] (-532.482) (-535.172) * (-534.148) (-532.792) (-533.001) [-535.632] -- 0:00:20
671500 -- (-533.225) (-535.324) [-532.176] (-531.969) * [-534.728] (-532.798) (-532.472) (-532.276) -- 0:00:20
672000 -- (-533.719) [-531.211] (-538.777) (-536.611) * [-533.463] (-532.412) (-538.058) (-535.961) -- 0:00:20
672500 -- [-531.910] (-534.572) (-533.310) (-535.666) * [-533.283] (-534.840) (-538.587) (-536.328) -- 0:00:20
673000 -- (-534.552) [-534.485] (-533.150) (-531.180) * (-534.250) (-531.205) (-535.679) [-534.092] -- 0:00:20
673500 -- [-532.465] (-536.893) (-536.364) (-533.073) * (-534.016) [-533.318] (-536.008) (-536.131) -- 0:00:20
674000 -- [-533.450] (-532.947) (-534.355) (-531.284) * [-534.318] (-533.687) (-533.824) (-534.297) -- 0:00:20
674500 -- (-533.106) (-537.388) [-535.373] (-532.116) * (-532.260) (-533.511) (-534.929) [-532.648] -- 0:00:20
675000 -- [-532.707] (-533.212) (-534.006) (-532.586) * (-534.618) (-532.902) (-535.907) [-532.780] -- 0:00:20
Average standard deviation of split frequencies: 0.008286
675500 -- (-535.578) (-531.706) [-531.427] (-534.885) * (-536.841) (-534.726) (-534.682) [-531.802] -- 0:00:20
676000 -- (-533.494) [-531.454] (-532.735) (-533.417) * (-531.982) (-534.119) (-535.156) [-532.551] -- 0:00:20
676500 -- (-531.009) [-531.740] (-532.675) (-533.253) * [-533.714] (-534.261) (-533.723) (-531.840) -- 0:00:20
677000 -- (-532.002) (-532.125) [-533.631] (-531.277) * (-532.151) (-532.526) [-532.390] (-536.377) -- 0:00:20
677500 -- [-534.575] (-532.935) (-532.544) (-531.741) * (-537.048) (-537.527) (-532.160) [-534.272] -- 0:00:20
678000 -- (-533.139) (-532.995) [-533.366] (-531.662) * [-536.196] (-533.334) (-534.017) (-534.297) -- 0:00:20
678500 -- [-532.631] (-534.802) (-533.072) (-533.163) * (-534.647) (-534.058) (-532.948) [-536.926] -- 0:00:20
679000 -- (-531.881) [-531.354] (-535.351) (-534.217) * (-533.960) (-532.742) [-533.894] (-537.772) -- 0:00:20
679500 -- (-531.823) (-532.075) (-535.636) [-530.468] * (-534.457) (-534.239) [-533.055] (-535.120) -- 0:00:20
680000 -- (-531.296) [-532.578] (-533.648) (-531.900) * [-532.309] (-534.341) (-532.905) (-532.681) -- 0:00:20
Average standard deviation of split frequencies: 0.008270
680500 -- [-532.358] (-532.486) (-534.425) (-532.537) * (-533.829) [-534.755] (-533.372) (-532.178) -- 0:00:20
681000 -- (-532.742) [-531.941] (-533.616) (-532.856) * (-532.734) (-535.531) (-536.845) [-531.401] -- 0:00:20
681500 -- (-531.997) [-534.427] (-534.792) (-536.299) * (-532.145) (-533.066) (-534.036) [-532.163] -- 0:00:20
682000 -- (-534.142) (-531.838) [-535.062] (-531.669) * (-532.804) (-531.494) [-529.777] (-534.982) -- 0:00:20
682500 -- (-533.194) [-530.899] (-535.210) (-532.029) * [-534.926] (-533.830) (-533.897) (-536.711) -- 0:00:20
683000 -- (-534.589) [-535.644] (-533.807) (-533.214) * (-533.598) [-533.088] (-534.533) (-533.380) -- 0:00:19
683500 -- (-530.902) [-532.128] (-536.349) (-534.742) * [-533.093] (-535.404) (-533.720) (-535.788) -- 0:00:19
684000 -- [-531.894] (-532.991) (-536.231) (-533.876) * (-533.344) (-533.608) [-533.192] (-534.263) -- 0:00:19
684500 -- [-531.017] (-533.151) (-536.011) (-537.249) * (-532.539) [-532.150] (-531.584) (-534.116) -- 0:00:19
685000 -- [-534.082] (-534.721) (-534.882) (-535.733) * (-532.423) (-534.403) [-535.518] (-533.091) -- 0:00:19
Average standard deviation of split frequencies: 0.008529
685500 -- (-533.398) (-536.753) (-532.275) [-532.854] * (-532.722) (-533.153) (-536.275) [-533.527] -- 0:00:19
686000 -- [-533.284] (-534.552) (-532.629) (-536.004) * (-535.147) (-531.631) [-534.478] (-530.971) -- 0:00:19
686500 -- (-532.088) (-537.915) [-531.952] (-537.284) * (-536.723) (-533.373) (-532.612) [-535.246] -- 0:00:19
687000 -- (-532.436) [-532.194] (-534.446) (-533.693) * [-532.687] (-533.861) (-533.867) (-534.234) -- 0:00:19
687500 -- (-532.796) (-534.108) (-535.861) [-532.627] * (-535.917) (-537.691) (-533.388) [-533.750] -- 0:00:19
688000 -- (-536.273) (-533.510) (-535.430) [-532.851] * (-534.600) (-534.831) (-532.085) [-534.312] -- 0:00:19
688500 -- (-536.243) (-534.004) [-532.161] (-532.047) * (-539.900) (-531.260) [-533.159] (-532.835) -- 0:00:19
689000 -- [-536.478] (-533.663) (-534.294) (-534.017) * (-538.837) [-532.892] (-532.512) (-532.719) -- 0:00:19
689500 -- (-531.449) [-531.711] (-532.838) (-533.622) * (-535.717) (-532.540) (-536.364) [-534.023] -- 0:00:19
690000 -- (-534.096) (-532.625) (-531.762) [-531.729] * (-532.358) (-531.657) (-536.639) [-532.514] -- 0:00:19
Average standard deviation of split frequencies: 0.008712
690500 -- (-532.567) (-532.233) (-532.216) [-533.925] * (-532.296) [-531.835] (-539.402) (-531.454) -- 0:00:19
691000 -- (-532.537) [-531.508] (-533.599) (-531.831) * (-533.045) (-533.411) (-532.297) [-533.081] -- 0:00:19
691500 -- (-533.733) (-530.478) (-532.198) [-532.733] * (-533.879) [-533.059] (-533.120) (-536.548) -- 0:00:19
692000 -- [-533.019] (-531.226) (-532.450) (-534.492) * (-532.680) [-533.439] (-532.239) (-536.604) -- 0:00:19
692500 -- (-532.345) (-533.323) (-532.119) [-533.401] * (-533.766) (-532.354) [-534.012] (-537.805) -- 0:00:19
693000 -- (-532.397) (-531.028) [-531.696] (-533.909) * (-533.737) (-532.945) [-532.235] (-538.068) -- 0:00:19
693500 -- [-531.491] (-531.947) (-532.805) (-535.283) * (-534.833) (-532.398) [-533.157] (-533.061) -- 0:00:19
694000 -- (-534.206) (-540.579) (-531.671) [-533.326] * (-532.669) [-531.145] (-531.470) (-532.729) -- 0:00:19
694500 -- (-533.974) (-533.001) [-535.341] (-534.390) * (-535.785) (-536.220) (-535.761) [-532.547] -- 0:00:19
695000 -- (-532.824) [-531.713] (-535.439) (-533.719) * (-534.166) (-530.925) [-533.541] (-533.222) -- 0:00:19
Average standard deviation of split frequencies: 0.008725
695500 -- (-541.648) [-535.831] (-533.412) (-531.920) * (-533.301) (-532.034) (-534.538) [-532.585] -- 0:00:19
696000 -- (-536.554) [-532.707] (-532.964) (-532.924) * (-534.620) (-532.128) [-534.614] (-532.175) -- 0:00:19
696500 -- (-532.007) [-533.375] (-532.451) (-536.006) * (-533.203) [-530.496] (-532.741) (-533.461) -- 0:00:19
697000 -- [-531.769] (-535.680) (-533.599) (-533.338) * (-534.520) [-534.029] (-532.737) (-535.101) -- 0:00:19
697500 -- (-533.754) (-536.913) (-533.075) [-533.880] * [-533.770] (-530.843) (-534.151) (-533.738) -- 0:00:19
698000 -- (-534.544) (-532.691) (-533.898) [-532.527] * [-533.340] (-532.356) (-532.421) (-532.762) -- 0:00:19
698500 -- [-534.282] (-534.315) (-536.623) (-532.909) * (-532.689) [-530.744] (-534.406) (-533.817) -- 0:00:18
699000 -- (-530.606) (-539.546) [-531.291] (-537.922) * (-533.466) (-532.153) (-533.837) [-532.348] -- 0:00:18
699500 -- (-532.422) (-535.034) (-532.383) [-535.651] * (-533.204) (-532.346) [-532.321] (-533.237) -- 0:00:18
700000 -- (-535.474) (-534.657) (-531.663) [-533.670] * (-538.135) (-535.904) [-533.084] (-531.054) -- 0:00:18
Average standard deviation of split frequencies: 0.008509
700500 -- (-530.758) (-531.654) (-534.075) [-534.233] * (-536.129) (-534.926) [-533.936] (-536.892) -- 0:00:18
701000 -- [-533.210] (-536.200) (-535.673) (-532.861) * (-533.638) (-533.844) (-543.773) [-534.960] -- 0:00:18
701500 -- (-530.911) (-536.405) (-536.059) [-534.630] * (-532.382) (-536.850) (-535.931) [-530.320] -- 0:00:18
702000 -- (-532.059) (-535.007) [-531.201] (-534.811) * (-536.161) (-536.513) (-532.821) [-535.097] -- 0:00:18
702500 -- (-532.345) (-540.536) (-532.656) [-532.943] * (-532.563) (-533.193) [-531.722] (-534.756) -- 0:00:18
703000 -- (-534.588) (-533.721) (-531.884) [-531.430] * [-533.688] (-533.121) (-534.904) (-532.654) -- 0:00:18
703500 -- (-533.583) [-532.973] (-532.008) (-532.463) * (-534.097) (-532.998) [-533.867] (-532.829) -- 0:00:18
704000 -- [-531.170] (-532.511) (-534.239) (-532.845) * (-532.535) [-532.415] (-536.457) (-540.064) -- 0:00:18
704500 -- [-534.458] (-532.256) (-535.598) (-531.414) * (-534.273) [-531.991] (-541.949) (-537.973) -- 0:00:18
705000 -- [-532.101] (-531.576) (-532.187) (-533.492) * (-533.362) (-532.328) [-533.146] (-538.865) -- 0:00:18
Average standard deviation of split frequencies: 0.008287
705500 -- [-532.071] (-532.695) (-537.691) (-534.163) * [-534.946] (-532.118) (-536.759) (-533.103) -- 0:00:18
706000 -- (-534.503) [-533.256] (-539.523) (-538.721) * (-535.239) (-534.076) [-532.592] (-533.767) -- 0:00:18
706500 -- (-533.615) (-532.758) [-532.345] (-535.223) * (-534.128) (-532.223) [-532.223] (-533.769) -- 0:00:18
707000 -- (-531.908) (-530.435) (-533.222) [-535.974] * (-538.639) (-535.264) (-530.846) [-535.000] -- 0:00:18
707500 -- [-535.206] (-532.397) (-531.296) (-531.199) * (-538.892) [-533.629] (-530.824) (-533.575) -- 0:00:18
708000 -- (-535.663) (-534.606) (-533.234) [-530.658] * [-531.896] (-531.679) (-530.888) (-535.428) -- 0:00:18
708500 -- (-533.235) [-532.226] (-533.058) (-533.324) * (-531.632) (-532.987) [-534.009] (-534.166) -- 0:00:18
709000 -- [-532.493] (-535.660) (-532.671) (-534.861) * [-532.170] (-532.966) (-533.313) (-531.698) -- 0:00:18
709500 -- (-533.814) (-532.858) [-531.019] (-531.834) * (-534.342) (-534.010) (-536.492) [-535.964] -- 0:00:18
710000 -- (-532.956) (-538.523) [-533.258] (-530.512) * (-532.650) (-533.426) (-534.029) [-530.111] -- 0:00:18
Average standard deviation of split frequencies: 0.007421
710500 -- (-534.760) (-531.200) [-531.980] (-536.034) * (-537.377) (-534.884) [-535.389] (-532.904) -- 0:00:18
711000 -- (-533.655) (-531.424) (-532.041) [-535.546] * (-534.484) (-532.966) (-536.442) [-532.207] -- 0:00:18
711500 -- (-533.456) [-532.107] (-532.684) (-533.845) * (-531.705) (-532.990) (-536.051) [-532.421] -- 0:00:18
712000 -- [-532.273] (-533.538) (-533.311) (-534.089) * (-533.541) [-535.675] (-534.328) (-532.277) -- 0:00:18
712500 -- [-534.439] (-538.995) (-533.121) (-531.635) * (-532.123) (-536.452) [-533.792] (-533.540) -- 0:00:18
713000 -- (-533.170) (-537.087) (-531.710) [-532.885] * (-531.970) (-533.180) (-531.285) [-533.947] -- 0:00:18
713500 -- (-534.719) [-532.626] (-532.140) (-531.925) * [-532.254] (-533.814) (-534.435) (-532.451) -- 0:00:18
714000 -- (-536.160) (-533.966) (-532.367) [-531.220] * (-534.925) (-534.467) (-538.729) [-531.720] -- 0:00:18
714500 -- (-534.194) (-532.840) (-532.976) [-531.437] * (-532.890) (-534.216) (-535.199) [-530.548] -- 0:00:17
715000 -- [-533.580] (-534.553) (-533.755) (-533.489) * (-531.608) (-535.127) (-533.957) [-533.161] -- 0:00:17
Average standard deviation of split frequencies: 0.007201
715500 -- (-532.077) (-533.735) [-531.523] (-531.103) * (-531.543) (-534.063) (-534.953) [-531.989] -- 0:00:17
716000 -- (-532.844) [-530.886] (-534.506) (-530.262) * (-531.697) [-536.158] (-535.852) (-535.512) -- 0:00:17
716500 -- (-532.524) (-537.970) (-534.546) [-531.180] * (-532.157) (-534.701) (-531.625) [-531.707] -- 0:00:17
717000 -- (-532.900) (-532.584) (-530.662) [-529.625] * [-534.071] (-535.787) (-533.416) (-532.768) -- 0:00:17
717500 -- (-531.984) (-535.042) (-533.283) [-534.556] * (-533.687) [-532.564] (-536.902) (-531.861) -- 0:00:17
718000 -- (-534.455) (-536.014) (-533.719) [-536.816] * (-537.140) (-530.990) (-532.588) [-533.480] -- 0:00:17
718500 -- (-535.816) (-532.817) (-533.122) [-537.907] * [-534.460] (-532.955) (-532.063) (-532.118) -- 0:00:17
719000 -- (-533.556) [-532.950] (-532.233) (-536.014) * (-534.611) (-533.562) (-533.816) [-533.576] -- 0:00:17
719500 -- [-533.820] (-531.052) (-531.570) (-534.286) * (-531.473) [-533.329] (-534.728) (-532.425) -- 0:00:17
720000 -- (-533.633) [-531.785] (-534.023) (-534.125) * (-530.817) (-535.082) [-534.120] (-532.610) -- 0:00:17
Average standard deviation of split frequencies: 0.007154
720500 -- (-531.018) [-532.094] (-533.236) (-534.011) * (-532.971) (-533.467) (-532.369) [-536.554] -- 0:00:17
721000 -- (-535.366) [-534.615] (-534.617) (-535.100) * (-533.675) (-532.849) [-532.937] (-535.032) -- 0:00:17
721500 -- (-533.205) (-533.225) [-533.438] (-533.816) * [-531.600] (-535.033) (-532.703) (-537.930) -- 0:00:17
722000 -- [-531.358] (-534.013) (-533.225) (-533.450) * (-533.565) [-531.646] (-534.085) (-534.678) -- 0:00:17
722500 -- (-532.651) (-540.316) (-532.235) [-533.027] * (-532.504) (-532.956) (-534.548) [-534.829] -- 0:00:17
723000 -- (-532.011) (-535.356) (-533.136) [-538.625] * [-532.978] (-531.924) (-534.117) (-533.692) -- 0:00:17
723500 -- [-531.980] (-532.201) (-534.980) (-533.808) * (-530.802) [-533.540] (-532.915) (-533.197) -- 0:00:17
724000 -- [-532.754] (-532.234) (-534.070) (-531.799) * [-531.695] (-532.993) (-533.133) (-534.273) -- 0:00:17
724500 -- (-537.771) (-533.976) [-536.821] (-532.386) * [-532.914] (-532.631) (-532.716) (-532.807) -- 0:00:17
725000 -- [-532.334] (-532.900) (-533.604) (-532.024) * [-532.593] (-532.756) (-534.378) (-532.343) -- 0:00:17
Average standard deviation of split frequencies: 0.007102
725500 -- [-534.816] (-534.229) (-534.007) (-533.888) * [-535.198] (-535.394) (-535.910) (-533.977) -- 0:00:17
726000 -- (-531.457) [-532.674] (-533.500) (-535.369) * [-533.986] (-535.024) (-532.268) (-533.657) -- 0:00:17
726500 -- (-531.403) [-530.803] (-534.048) (-531.873) * (-534.265) (-536.620) [-531.505] (-534.009) -- 0:00:17
727000 -- [-536.593] (-531.427) (-535.476) (-529.847) * (-534.513) [-532.530] (-532.756) (-533.153) -- 0:00:17
727500 -- [-533.047] (-535.494) (-533.412) (-533.370) * (-535.721) [-533.782] (-531.815) (-534.638) -- 0:00:17
728000 -- [-530.663] (-534.588) (-532.412) (-534.088) * (-534.658) (-531.343) (-535.871) [-533.514] -- 0:00:17
728500 -- [-531.269] (-532.038) (-532.146) (-534.650) * [-531.805] (-533.475) (-535.948) (-534.435) -- 0:00:17
729000 -- (-532.249) [-533.770] (-536.846) (-533.850) * [-532.994] (-533.890) (-531.376) (-529.862) -- 0:00:17
729500 -- (-532.012) (-532.310) [-536.380] (-531.637) * (-535.877) (-533.616) (-532.101) [-530.875] -- 0:00:17
730000 -- (-534.475) [-534.711] (-532.800) (-531.109) * [-533.459] (-534.884) (-532.492) (-533.838) -- 0:00:17
Average standard deviation of split frequencies: 0.007661
730500 -- (-531.068) (-534.118) [-534.606] (-531.464) * (-534.032) (-534.079) (-534.429) [-535.802] -- 0:00:16
731000 -- (-533.877) [-532.808] (-541.276) (-532.545) * [-534.178] (-536.126) (-533.130) (-532.621) -- 0:00:16
731500 -- (-534.159) (-530.435) [-533.679] (-531.094) * [-531.982] (-533.258) (-536.091) (-533.436) -- 0:00:16
732000 -- (-533.179) (-533.834) (-537.494) [-530.374] * (-533.653) [-536.066] (-533.190) (-536.010) -- 0:00:16
732500 -- (-538.297) [-533.556] (-533.821) (-532.143) * (-532.638) (-539.149) [-532.843] (-534.607) -- 0:00:16
733000 -- [-534.561] (-534.208) (-538.071) (-533.737) * (-533.405) (-537.287) (-533.676) [-530.307] -- 0:00:16
733500 -- (-532.365) [-537.454] (-532.615) (-533.170) * (-536.657) (-534.598) (-533.608) [-531.488] -- 0:00:16
734000 -- [-533.143] (-532.491) (-533.128) (-534.704) * (-539.752) (-533.496) [-534.183] (-533.553) -- 0:00:16
734500 -- (-533.965) [-531.805] (-534.504) (-532.070) * (-535.390) (-532.783) (-533.495) [-531.250] -- 0:00:16
735000 -- [-532.409] (-530.972) (-533.242) (-531.518) * (-531.343) [-534.180] (-535.178) (-532.359) -- 0:00:16
Average standard deviation of split frequencies: 0.008590
735500 -- (-533.142) (-541.492) [-533.741] (-536.385) * [-533.299] (-532.345) (-534.098) (-533.580) -- 0:00:16
736000 -- (-531.392) [-535.315] (-533.534) (-532.803) * (-531.861) (-533.400) [-533.646] (-532.767) -- 0:00:16
736500 -- (-533.170) (-533.546) (-533.165) [-531.097] * (-532.013) (-532.796) (-533.226) [-537.109] -- 0:00:16
737000 -- [-532.538] (-535.111) (-534.627) (-532.239) * (-533.237) (-534.314) (-534.678) [-532.634] -- 0:00:16
737500 -- [-531.239] (-531.844) (-532.984) (-532.722) * (-534.538) (-535.086) [-533.293] (-531.787) -- 0:00:16
738000 -- (-531.908) [-533.164] (-532.527) (-534.999) * (-535.174) (-532.432) (-532.492) [-531.230] -- 0:00:16
738500 -- (-535.855) (-533.309) (-537.709) [-532.617] * (-541.068) (-536.578) (-533.350) [-533.594] -- 0:00:16
739000 -- (-532.551) (-532.409) [-533.820] (-532.682) * (-533.970) [-536.438] (-534.928) (-540.277) -- 0:00:16
739500 -- [-529.643] (-534.011) (-532.745) (-531.218) * (-532.527) [-538.830] (-537.170) (-540.309) -- 0:00:16
740000 -- (-533.054) [-532.581] (-533.175) (-533.445) * (-532.251) [-534.166] (-537.413) (-533.439) -- 0:00:16
Average standard deviation of split frequencies: 0.007916
740500 -- (-532.882) [-532.570] (-532.193) (-531.477) * (-535.120) (-532.959) (-534.250) [-532.249] -- 0:00:16
741000 -- (-534.131) (-531.253) (-533.220) [-533.509] * (-532.988) [-532.903] (-534.541) (-532.442) -- 0:00:16
741500 -- (-531.405) [-533.028] (-534.340) (-532.843) * (-533.772) (-534.795) [-532.323] (-534.300) -- 0:00:16
742000 -- (-531.264) (-534.065) [-534.224] (-535.135) * (-531.695) (-533.312) (-533.942) [-535.564] -- 0:00:16
742500 -- (-535.551) (-534.153) (-533.220) [-533.094] * (-533.783) (-535.108) [-532.331] (-532.201) -- 0:00:16
743000 -- (-535.566) [-529.980] (-531.941) (-534.380) * (-533.455) [-533.772] (-536.000) (-531.528) -- 0:00:16
743500 -- (-536.537) (-535.507) [-533.472] (-535.563) * [-531.447] (-533.147) (-531.240) (-530.660) -- 0:00:16
744000 -- (-540.564) (-533.096) (-533.651) [-536.952] * (-533.796) (-536.149) (-532.366) [-533.005] -- 0:00:16
744500 -- (-531.546) (-531.534) (-533.449) [-531.830] * (-537.529) [-533.865] (-534.334) (-534.231) -- 0:00:16
745000 -- (-535.133) (-532.804) (-534.453) [-533.851] * (-536.093) (-539.550) (-533.379) [-533.002] -- 0:00:16
Average standard deviation of split frequencies: 0.008057
745500 -- (-531.732) (-533.060) (-534.856) [-533.006] * (-536.600) [-535.220] (-531.207) (-533.548) -- 0:00:16
746000 -- [-534.943] (-531.314) (-535.488) (-531.490) * (-533.508) [-532.696] (-531.988) (-533.249) -- 0:00:16
746500 -- (-534.121) (-531.777) [-535.040] (-533.327) * (-534.168) [-535.128] (-534.362) (-534.906) -- 0:00:15
747000 -- (-533.916) [-532.293] (-533.653) (-534.810) * [-535.216] (-535.044) (-533.900) (-533.374) -- 0:00:15
747500 -- (-533.909) [-531.143] (-533.818) (-533.631) * [-535.684] (-535.078) (-532.986) (-532.652) -- 0:00:15
748000 -- (-533.590) (-533.552) (-532.836) [-535.394] * [-533.444] (-532.532) (-532.698) (-537.664) -- 0:00:15
748500 -- (-534.467) [-532.933] (-534.601) (-534.552) * (-533.951) (-533.135) [-531.947] (-532.756) -- 0:00:15
749000 -- (-534.955) [-534.551] (-533.398) (-537.002) * [-535.503] (-533.292) (-531.493) (-532.531) -- 0:00:15
749500 -- (-533.630) (-536.817) [-537.263] (-530.272) * (-533.029) (-534.981) [-533.101] (-533.413) -- 0:00:15
750000 -- (-535.690) (-531.756) (-530.850) [-531.629] * [-535.069] (-536.207) (-533.722) (-531.325) -- 0:00:15
Average standard deviation of split frequencies: 0.008595
750500 -- (-533.522) [-534.565] (-531.892) (-533.112) * (-533.880) (-535.585) [-533.416] (-533.175) -- 0:00:15
751000 -- (-532.103) (-535.307) [-534.137] (-533.401) * (-532.928) [-532.911] (-531.337) (-533.133) -- 0:00:15
751500 -- (-541.002) (-532.543) [-534.284] (-534.141) * (-533.642) (-533.391) (-533.220) [-538.366] -- 0:00:15
752000 -- (-533.120) [-533.666] (-532.156) (-535.279) * [-536.656] (-532.147) (-533.274) (-532.886) -- 0:00:15
752500 -- (-534.157) (-530.803) [-532.113] (-534.072) * (-538.779) (-533.312) (-535.905) [-533.389] -- 0:00:15
753000 -- [-533.812] (-532.455) (-534.223) (-533.151) * [-533.387] (-537.933) (-530.765) (-532.908) -- 0:00:15
753500 -- [-536.119] (-532.171) (-532.613) (-536.703) * (-537.359) [-536.389] (-533.651) (-535.770) -- 0:00:15
754000 -- (-532.909) [-532.396] (-533.002) (-535.813) * (-537.952) (-534.813) [-534.003] (-534.404) -- 0:00:15
754500 -- [-532.663] (-534.965) (-533.602) (-534.481) * (-537.641) (-534.025) (-532.461) [-532.858] -- 0:00:15
755000 -- (-530.809) [-531.832] (-533.045) (-532.859) * (-537.387) (-531.924) (-536.628) [-533.565] -- 0:00:15
Average standard deviation of split frequencies: 0.008613
755500 -- (-532.704) (-532.370) (-533.391) [-531.145] * (-534.911) (-535.823) (-533.646) [-533.949] -- 0:00:15
756000 -- (-530.069) (-537.288) [-531.398] (-535.369) * [-532.361] (-537.685) (-536.600) (-533.159) -- 0:00:15
756500 -- [-532.189] (-534.515) (-531.869) (-535.439) * (-532.978) (-532.313) [-533.193] (-532.957) -- 0:00:15
757000 -- [-532.374] (-532.603) (-533.794) (-531.746) * [-531.577] (-534.699) (-531.681) (-533.265) -- 0:00:15
757500 -- (-533.040) [-531.922] (-533.635) (-532.888) * (-532.398) (-534.629) (-531.583) [-532.672] -- 0:00:15
758000 -- (-536.137) [-537.976] (-535.946) (-532.593) * (-532.855) (-534.597) [-534.670] (-535.790) -- 0:00:15
758500 -- (-535.306) (-534.581) (-536.708) [-537.154] * (-533.529) [-531.936] (-535.271) (-532.966) -- 0:00:15
759000 -- (-533.507) (-533.706) [-533.208] (-536.053) * (-537.212) (-532.634) (-533.304) [-531.839] -- 0:00:15
759500 -- (-535.647) (-532.240) (-532.701) [-532.527] * (-530.805) (-533.994) (-532.691) [-536.124] -- 0:00:15
760000 -- (-534.737) (-533.877) (-536.651) [-532.615] * (-535.164) (-535.180) [-535.697] (-533.697) -- 0:00:15
Average standard deviation of split frequencies: 0.008134
760500 -- (-533.004) (-532.149) [-532.300] (-540.747) * (-534.959) [-534.725] (-535.929) (-532.964) -- 0:00:15
761000 -- [-533.377] (-531.584) (-533.469) (-533.115) * (-532.574) (-534.376) (-532.585) [-533.380] -- 0:00:15
761500 -- [-537.444] (-532.202) (-535.759) (-534.248) * (-532.869) (-538.047) [-530.089] (-535.933) -- 0:00:15
762000 -- (-537.328) [-535.508] (-533.307) (-535.872) * (-532.739) (-533.546) [-531.447] (-532.783) -- 0:00:14
762500 -- (-534.529) (-537.938) (-530.821) [-532.120] * [-531.861] (-532.340) (-534.089) (-532.564) -- 0:00:14
763000 -- (-537.945) (-533.583) (-542.014) [-530.914] * (-533.521) (-532.114) [-533.791] (-534.814) -- 0:00:14
763500 -- (-535.235) (-538.257) [-532.990] (-535.460) * (-533.639) (-533.858) (-530.427) [-531.897] -- 0:00:14
764000 -- (-535.178) (-534.593) (-532.653) [-533.954] * (-534.356) [-534.251] (-530.159) (-533.547) -- 0:00:14
764500 -- [-537.277] (-533.665) (-534.079) (-535.869) * (-533.617) (-531.698) (-534.238) [-532.671] -- 0:00:14
765000 -- (-536.547) (-537.675) [-532.272] (-534.816) * [-533.264] (-532.579) (-530.400) (-537.377) -- 0:00:14
Average standard deviation of split frequencies: 0.007770
765500 -- (-534.971) (-535.143) [-533.333] (-533.967) * (-533.540) [-532.544] (-531.396) (-534.255) -- 0:00:14
766000 -- (-535.028) (-531.267) [-537.034] (-538.183) * (-532.175) (-536.756) (-531.003) [-533.775] -- 0:00:14
766500 -- (-534.385) (-533.315) [-531.984] (-533.028) * (-533.671) (-533.023) (-535.315) [-534.306] -- 0:00:14
767000 -- (-533.450) (-537.018) (-532.847) [-535.950] * (-535.334) (-535.347) [-534.582] (-532.936) -- 0:00:14
767500 -- (-534.013) (-531.062) (-532.853) [-532.888] * (-532.400) (-532.104) (-533.172) [-531.349] -- 0:00:14
768000 -- (-532.934) [-532.514] (-534.809) (-535.429) * (-533.007) (-532.991) [-531.359] (-532.549) -- 0:00:14
768500 -- (-532.499) (-531.869) (-537.948) [-538.185] * [-533.169] (-534.930) (-532.470) (-534.765) -- 0:00:14
769000 -- (-532.993) [-532.539] (-535.477) (-537.789) * [-533.170] (-534.811) (-532.415) (-533.634) -- 0:00:14
769500 -- [-531.539] (-531.433) (-533.083) (-534.871) * (-536.203) (-533.875) (-535.469) [-532.877] -- 0:00:14
770000 -- (-532.213) (-531.793) [-534.034] (-531.991) * (-538.368) [-531.185] (-533.838) (-533.515) -- 0:00:14
Average standard deviation of split frequencies: 0.008105
770500 -- (-531.906) (-532.656) (-533.565) [-534.695] * (-532.037) [-533.024] (-533.827) (-534.761) -- 0:00:14
771000 -- [-533.335] (-530.863) (-533.517) (-534.808) * (-530.345) (-532.483) (-533.654) [-533.108] -- 0:00:14
771500 -- (-535.134) [-532.050] (-532.515) (-533.142) * (-532.608) [-529.806] (-535.352) (-531.580) -- 0:00:14
772000 -- (-534.984) (-532.707) (-533.684) [-534.996] * (-535.903) [-533.163] (-533.896) (-536.874) -- 0:00:14
772500 -- (-534.574) [-534.325] (-533.115) (-533.680) * (-536.234) (-531.137) (-533.469) [-532.637] -- 0:00:14
773000 -- [-533.270] (-533.672) (-534.083) (-534.011) * [-535.969] (-529.835) (-534.948) (-534.821) -- 0:00:14
773500 -- (-533.109) (-533.579) [-533.598] (-533.210) * (-533.653) [-532.247] (-530.975) (-537.137) -- 0:00:14
774000 -- (-533.657) [-530.698] (-534.835) (-534.050) * (-531.984) (-534.072) [-533.467] (-532.341) -- 0:00:14
774500 -- [-534.679] (-531.129) (-534.414) (-533.932) * [-531.141] (-534.535) (-533.364) (-536.516) -- 0:00:14
775000 -- (-536.873) (-532.217) (-532.832) [-532.401] * (-531.530) (-531.738) [-531.297] (-535.216) -- 0:00:14
Average standard deviation of split frequencies: 0.008277
775500 -- (-535.586) [-534.733] (-533.445) (-532.887) * (-531.922) (-533.082) [-536.658] (-531.984) -- 0:00:14
776000 -- (-534.382) (-532.745) (-536.550) [-533.191] * [-534.064] (-533.861) (-534.679) (-532.842) -- 0:00:14
776500 -- (-532.537) (-534.196) [-532.375] (-534.197) * [-533.514] (-532.128) (-534.748) (-533.023) -- 0:00:14
777000 -- [-535.784] (-535.678) (-534.430) (-531.561) * (-529.916) (-530.935) (-533.358) [-535.865] -- 0:00:14
777500 -- [-534.953] (-534.820) (-533.342) (-535.330) * [-532.264] (-533.888) (-533.794) (-533.110) -- 0:00:14
778000 -- (-532.772) [-532.931] (-533.634) (-534.231) * (-533.663) (-532.617) [-532.910] (-531.547) -- 0:00:13
778500 -- (-531.640) (-533.364) [-533.889] (-533.489) * (-533.209) (-535.411) [-536.756] (-530.867) -- 0:00:13
779000 -- [-534.659] (-533.284) (-534.396) (-533.964) * (-534.740) (-535.360) (-533.189) [-531.761] -- 0:00:13
779500 -- [-532.921] (-534.668) (-533.515) (-532.396) * (-535.202) (-532.932) [-532.410] (-532.302) -- 0:00:13
780000 -- (-534.048) (-533.846) [-533.091] (-532.837) * (-531.785) (-530.866) [-533.846] (-535.515) -- 0:00:13
Average standard deviation of split frequencies: 0.007963
780500 -- (-531.970) (-535.719) [-533.791] (-533.221) * (-536.142) (-535.499) [-533.578] (-535.208) -- 0:00:13
781000 -- (-534.443) (-532.661) [-532.848] (-533.074) * (-534.047) [-532.480] (-532.851) (-531.763) -- 0:00:13
781500 -- (-536.630) [-532.397] (-533.261) (-530.716) * [-532.729] (-533.481) (-534.454) (-533.530) -- 0:00:13
782000 -- (-535.714) (-535.783) [-533.818] (-533.005) * [-533.850] (-532.304) (-532.827) (-533.283) -- 0:00:13
782500 -- (-534.547) (-534.647) (-531.881) [-534.352] * (-532.512) [-531.610] (-532.466) (-537.945) -- 0:00:13
783000 -- (-532.674) [-532.646] (-536.158) (-533.396) * (-532.081) (-536.592) [-534.999] (-531.039) -- 0:00:13
783500 -- [-532.753] (-533.887) (-534.058) (-537.204) * (-533.572) [-535.973] (-536.413) (-532.384) -- 0:00:13
784000 -- [-532.289] (-541.573) (-537.740) (-532.391) * (-532.427) [-530.909] (-539.024) (-534.405) -- 0:00:13
784500 -- (-533.064) (-537.635) (-532.733) [-533.919] * (-531.211) (-532.655) [-540.947] (-534.977) -- 0:00:13
785000 -- (-534.014) (-534.569) [-534.972] (-532.733) * (-534.219) [-532.229] (-536.444) (-534.936) -- 0:00:13
Average standard deviation of split frequencies: 0.007759
785500 -- [-531.554] (-534.636) (-532.427) (-532.171) * (-531.692) (-532.685) [-535.249] (-536.288) -- 0:00:13
786000 -- [-534.468] (-533.171) (-534.610) (-530.979) * (-532.191) (-531.813) (-539.884) [-535.600] -- 0:00:13
786500 -- [-537.702] (-532.727) (-537.712) (-534.769) * (-532.638) [-532.277] (-533.408) (-531.683) -- 0:00:13
787000 -- [-534.528] (-531.831) (-533.732) (-532.126) * [-531.963] (-533.274) (-532.643) (-532.822) -- 0:00:13
787500 -- (-535.466) (-533.170) [-533.150] (-530.699) * [-533.668] (-532.868) (-532.145) (-532.026) -- 0:00:13
788000 -- (-530.735) (-534.606) (-531.469) [-534.343] * (-533.035) (-534.844) (-533.527) [-534.331] -- 0:00:13
788500 -- (-539.075) [-534.173] (-533.166) (-533.423) * [-533.504] (-532.779) (-533.750) (-534.782) -- 0:00:13
789000 -- [-537.227] (-533.498) (-532.307) (-532.359) * [-532.279] (-533.552) (-534.694) (-533.331) -- 0:00:13
789500 -- [-535.339] (-533.261) (-536.745) (-532.919) * (-537.273) [-532.962] (-532.202) (-531.433) -- 0:00:13
790000 -- (-535.168) (-533.894) [-531.790] (-532.465) * (-536.987) [-538.145] (-535.581) (-535.295) -- 0:00:13
Average standard deviation of split frequencies: 0.007788
790500 -- (-535.234) (-535.382) (-533.943) [-531.118] * (-530.983) (-537.366) [-531.714] (-535.382) -- 0:00:13
791000 -- (-536.912) (-533.540) [-534.181] (-530.337) * (-532.929) (-530.728) [-533.776] (-532.386) -- 0:00:13
791500 -- [-530.806] (-534.125) (-532.383) (-530.649) * [-537.813] (-533.108) (-536.610) (-536.886) -- 0:00:13
792000 -- (-534.325) (-533.035) (-535.020) [-532.741] * (-537.470) (-534.453) [-534.067] (-536.483) -- 0:00:13
792500 -- (-532.569) [-533.048] (-534.236) (-533.695) * (-533.945) (-536.035) [-530.138] (-530.976) -- 0:00:13
793000 -- (-533.122) [-532.304] (-535.483) (-534.168) * (-532.631) (-532.028) [-531.833] (-533.037) -- 0:00:13
793500 -- [-532.555] (-534.552) (-537.475) (-534.255) * (-534.618) [-532.453] (-531.999) (-532.010) -- 0:00:13
794000 -- (-533.594) (-532.775) (-537.998) [-532.970] * (-534.160) (-532.255) (-533.563) [-533.549] -- 0:00:12
794500 -- [-533.329] (-535.492) (-534.608) (-532.971) * (-534.512) (-533.295) [-531.934] (-533.617) -- 0:00:12
795000 -- (-532.399) [-535.501] (-534.094) (-531.235) * (-534.132) [-531.472] (-531.357) (-531.977) -- 0:00:12
Average standard deviation of split frequencies: 0.008069
795500 -- [-536.552] (-532.614) (-534.061) (-532.126) * [-532.109] (-532.271) (-531.226) (-532.529) -- 0:00:12
796000 -- (-534.249) [-535.468] (-536.420) (-532.407) * (-531.805) (-533.959) (-534.947) [-535.729] -- 0:00:12
796500 -- (-534.325) (-532.840) [-537.408] (-533.321) * (-533.107) (-535.269) (-531.362) [-534.021] -- 0:00:12
797000 -- (-532.177) [-534.704] (-532.429) (-534.540) * (-535.314) [-534.201] (-534.206) (-532.948) -- 0:00:12
797500 -- (-533.472) (-534.401) [-532.817] (-533.508) * (-532.120) [-534.131] (-531.186) (-531.983) -- 0:00:12
798000 -- (-531.903) (-533.976) (-534.560) [-533.258] * (-534.198) (-534.589) (-536.773) [-536.720] -- 0:00:12
798500 -- (-532.631) (-534.120) [-531.376] (-534.744) * (-533.705) (-530.518) [-533.658] (-531.640) -- 0:00:12
799000 -- (-532.020) (-537.932) (-532.113) [-534.274] * [-532.015] (-530.891) (-537.850) (-532.510) -- 0:00:12
799500 -- (-534.890) (-532.962) (-531.161) [-534.144] * (-533.095) (-531.146) [-533.051] (-532.897) -- 0:00:12
800000 -- (-533.824) (-533.423) (-532.743) [-532.181] * [-533.649] (-532.803) (-536.033) (-532.993) -- 0:00:12
Average standard deviation of split frequencies: 0.008059
800500 -- (-533.862) [-532.709] (-532.492) (-533.827) * (-536.080) (-533.827) [-531.257] (-533.727) -- 0:00:12
801000 -- (-535.213) [-535.627] (-531.500) (-534.056) * (-532.442) (-534.595) (-532.241) [-537.318] -- 0:00:12
801500 -- [-532.200] (-535.420) (-534.056) (-532.794) * (-533.069) (-531.650) (-530.503) [-532.213] -- 0:00:12
802000 -- (-533.147) [-532.665] (-533.041) (-536.594) * (-532.956) [-533.795] (-532.864) (-534.609) -- 0:00:12
802500 -- (-532.205) [-532.438] (-535.087) (-531.879) * (-535.346) [-534.242] (-533.541) (-531.454) -- 0:00:12
803000 -- [-533.763] (-535.278) (-535.624) (-532.819) * (-536.110) (-531.359) (-535.783) [-532.679] -- 0:00:12
803500 -- (-533.914) [-533.511] (-536.967) (-534.157) * [-532.242] (-534.092) (-531.222) (-533.122) -- 0:00:12
804000 -- [-531.080] (-537.368) (-539.413) (-534.989) * [-533.464] (-532.219) (-531.436) (-533.349) -- 0:00:12
804500 -- (-536.369) [-532.768] (-535.465) (-535.917) * (-535.325) (-532.519) (-534.841) [-533.304] -- 0:00:12
805000 -- (-533.574) (-532.982) [-533.714] (-534.792) * (-537.149) [-534.596] (-534.625) (-534.297) -- 0:00:12
Average standard deviation of split frequencies: 0.008371
805500 -- (-531.469) (-535.598) (-534.944) [-533.264] * [-537.319] (-536.410) (-533.801) (-532.867) -- 0:00:12
806000 -- (-533.333) (-536.414) [-534.675] (-532.394) * (-538.090) [-532.632] (-533.911) (-534.465) -- 0:00:12
806500 -- (-533.117) (-536.666) (-534.303) [-533.924] * (-536.905) (-530.360) (-533.037) [-533.257] -- 0:00:12
807000 -- [-532.896] (-533.042) (-532.267) (-535.052) * (-534.022) [-534.645] (-538.234) (-534.631) -- 0:00:12
807500 -- (-532.652) (-531.801) (-530.973) [-533.857] * (-535.113) (-532.507) [-532.410] (-533.484) -- 0:00:12
808000 -- (-537.912) [-531.946] (-533.793) (-533.913) * (-536.796) (-531.833) [-533.031] (-532.657) -- 0:00:12
808500 -- [-535.512] (-531.942) (-534.724) (-533.940) * [-534.091] (-532.865) (-532.638) (-532.144) -- 0:00:12
809000 -- (-535.355) [-530.811] (-532.547) (-535.093) * [-534.741] (-534.511) (-535.774) (-532.820) -- 0:00:12
809500 -- (-535.983) [-532.013] (-532.166) (-534.789) * (-535.348) (-531.674) [-534.743] (-532.657) -- 0:00:12
810000 -- (-533.473) (-530.112) (-532.555) [-532.023] * (-534.328) [-532.682] (-533.466) (-532.098) -- 0:00:11
Average standard deviation of split frequencies: 0.008068
810500 -- (-533.184) (-533.302) (-533.430) [-531.603] * (-533.790) [-532.971] (-534.042) (-537.917) -- 0:00:11
811000 -- [-533.838] (-534.140) (-534.285) (-534.624) * (-532.159) (-532.830) (-533.369) [-533.150] -- 0:00:11
811500 -- (-532.230) (-534.757) [-532.573] (-530.610) * [-532.507] (-533.734) (-538.310) (-532.668) -- 0:00:11
812000 -- (-534.610) (-534.745) (-533.388) [-533.264] * (-533.554) [-531.511] (-533.730) (-532.781) -- 0:00:11
812500 -- (-532.893) [-532.547] (-536.138) (-533.817) * (-533.257) (-532.369) (-530.400) [-534.910] -- 0:00:11
813000 -- (-533.046) (-534.681) (-534.327) [-536.642] * (-532.997) [-533.231] (-530.564) (-532.261) -- 0:00:11
813500 -- [-532.121] (-534.431) (-533.835) (-532.935) * (-533.621) [-533.025] (-533.522) (-531.727) -- 0:00:11
814000 -- (-535.232) (-533.947) [-536.876] (-545.772) * [-533.183] (-533.666) (-533.329) (-536.590) -- 0:00:11
814500 -- (-531.601) (-533.631) [-531.627] (-536.568) * (-532.857) (-534.005) [-531.774] (-532.101) -- 0:00:11
815000 -- (-532.629) (-538.268) [-535.846] (-535.124) * (-531.315) (-535.627) [-532.509] (-532.507) -- 0:00:11
Average standard deviation of split frequencies: 0.007691
815500 -- (-533.659) (-532.259) [-530.879] (-535.855) * (-532.709) (-534.443) [-532.744] (-531.868) -- 0:00:11
816000 -- (-532.935) [-532.057] (-536.200) (-535.327) * [-530.171] (-537.462) (-531.638) (-534.005) -- 0:00:11
816500 -- [-532.621] (-533.772) (-532.488) (-531.494) * (-534.024) (-537.006) [-531.152] (-536.918) -- 0:00:11
817000 -- (-535.154) [-532.675] (-530.718) (-532.384) * (-535.485) (-535.096) (-531.883) [-533.074] -- 0:00:11
817500 -- (-535.204) (-533.451) (-531.964) [-532.699] * (-532.508) (-535.578) [-534.230] (-538.133) -- 0:00:11
818000 -- (-534.951) [-533.013] (-536.198) (-533.575) * [-533.610] (-538.915) (-533.690) (-536.517) -- 0:00:11
818500 -- (-532.152) (-532.629) [-532.192] (-535.006) * (-532.554) (-538.637) (-536.085) [-532.353] -- 0:00:11
819000 -- (-532.375) [-531.532] (-534.010) (-533.828) * [-535.312] (-533.002) (-538.284) (-535.722) -- 0:00:11
819500 -- [-533.064] (-532.344) (-534.408) (-531.515) * [-535.521] (-532.433) (-534.948) (-535.458) -- 0:00:11
820000 -- (-533.124) (-532.541) (-530.332) [-536.378] * (-535.569) [-531.452] (-539.733) (-535.623) -- 0:00:11
Average standard deviation of split frequencies: 0.007791
820500 -- (-538.421) (-534.059) [-531.647] (-535.537) * (-537.028) (-531.260) (-533.550) [-536.508] -- 0:00:11
821000 -- (-535.412) [-533.620] (-533.820) (-532.842) * (-534.096) [-535.560] (-533.640) (-535.065) -- 0:00:11
821500 -- (-535.586) (-533.021) [-533.970] (-536.238) * [-533.872] (-534.523) (-533.732) (-534.360) -- 0:00:11
822000 -- (-533.827) (-533.854) [-533.940] (-533.356) * (-537.435) (-533.825) [-534.617] (-537.274) -- 0:00:11
822500 -- (-532.303) (-535.263) [-532.417] (-536.762) * (-533.964) (-535.257) [-533.192] (-531.378) -- 0:00:11
823000 -- (-534.400) (-533.193) (-534.547) [-536.219] * (-532.947) [-536.433] (-537.121) (-532.041) -- 0:00:11
823500 -- (-533.485) (-534.470) (-534.880) [-539.235] * (-534.186) [-532.642] (-537.039) (-532.344) -- 0:00:11
824000 -- [-532.074] (-533.724) (-532.320) (-533.188) * (-536.535) (-533.026) (-533.994) [-533.072] -- 0:00:11
824500 -- (-533.648) [-534.536] (-534.282) (-532.891) * (-532.787) (-537.319) [-533.569] (-532.828) -- 0:00:11
825000 -- (-533.388) [-532.810] (-533.845) (-532.985) * (-532.348) [-535.044] (-532.449) (-530.966) -- 0:00:11
Average standard deviation of split frequencies: 0.007277
825500 -- [-533.013] (-530.741) (-532.171) (-531.290) * [-532.720] (-538.810) (-536.798) (-532.683) -- 0:00:10
826000 -- [-532.859] (-532.870) (-530.917) (-533.856) * [-534.585] (-534.075) (-532.297) (-534.137) -- 0:00:10
826500 -- [-535.800] (-534.766) (-530.946) (-534.357) * [-532.974] (-532.775) (-532.518) (-533.539) -- 0:00:10
827000 -- (-538.385) [-535.575] (-534.940) (-532.412) * (-532.931) (-532.280) (-531.139) [-531.833] -- 0:00:10
827500 -- (-535.232) (-532.156) [-535.071] (-532.910) * (-532.722) (-532.125) (-532.742) [-534.516] -- 0:00:10
828000 -- (-534.349) (-533.977) (-533.329) [-532.741] * [-533.922] (-531.549) (-536.857) (-531.334) -- 0:00:10
828500 -- (-533.828) [-531.896] (-531.903) (-534.250) * (-538.119) [-532.988] (-537.927) (-534.452) -- 0:00:10
829000 -- [-533.399] (-532.436) (-535.301) (-533.949) * (-533.452) (-532.600) (-532.863) [-532.842] -- 0:00:10
829500 -- (-531.649) [-532.753] (-534.998) (-534.168) * [-533.766] (-532.512) (-532.564) (-531.460) -- 0:00:10
830000 -- (-534.836) [-532.774] (-532.430) (-535.371) * (-531.420) [-532.919] (-533.938) (-532.280) -- 0:00:10
Average standard deviation of split frequencies: 0.007555
830500 -- [-535.001] (-538.294) (-535.122) (-533.818) * (-531.590) (-531.767) (-536.408) [-533.721] -- 0:00:10
831000 -- [-531.978] (-535.325) (-530.220) (-532.263) * (-532.920) [-533.664] (-535.371) (-534.622) -- 0:00:10
831500 -- (-536.622) [-531.747] (-532.294) (-533.481) * (-537.534) (-534.385) (-533.532) [-532.501] -- 0:00:10
832000 -- (-537.076) [-533.118] (-535.687) (-535.482) * (-532.255) (-533.723) [-533.496] (-535.769) -- 0:00:10
832500 -- [-535.679] (-530.064) (-536.941) (-534.839) * (-533.560) (-534.764) (-534.397) [-532.113] -- 0:00:10
833000 -- (-535.699) (-530.704) (-531.881) [-532.696] * (-535.353) (-535.171) (-534.054) [-534.041] -- 0:00:10
833500 -- (-533.919) [-532.707] (-533.926) (-537.351) * (-533.815) (-534.286) (-536.157) [-532.864] -- 0:00:10
834000 -- (-534.122) [-531.065] (-537.965) (-532.044) * (-535.728) (-534.322) [-533.532] (-533.908) -- 0:00:10
834500 -- (-536.556) (-534.891) (-534.733) [-533.218] * (-535.701) [-534.249] (-536.676) (-536.392) -- 0:00:10
835000 -- [-532.568] (-532.626) (-532.261) (-533.598) * (-530.746) [-535.574] (-536.475) (-533.429) -- 0:00:10
Average standard deviation of split frequencies: 0.007401
835500 -- (-535.562) (-532.453) [-531.801] (-532.063) * (-530.297) (-536.758) (-535.138) [-532.672] -- 0:00:10
836000 -- (-532.280) (-533.903) [-532.313] (-532.474) * (-531.877) (-535.286) (-534.168) [-531.716] -- 0:00:10
836500 -- [-532.931] (-533.071) (-536.130) (-532.423) * [-530.628] (-534.596) (-535.800) (-534.195) -- 0:00:10
837000 -- (-536.239) [-532.830] (-533.233) (-534.276) * [-531.537] (-535.115) (-534.801) (-534.459) -- 0:00:10
837500 -- (-535.069) (-535.766) (-537.353) [-532.079] * [-533.598] (-534.452) (-537.799) (-534.716) -- 0:00:10
838000 -- (-535.468) (-533.299) [-535.284] (-532.527) * (-534.113) [-533.180] (-534.702) (-532.745) -- 0:00:10
838500 -- [-534.006] (-532.867) (-532.645) (-532.552) * (-534.233) [-534.358] (-535.425) (-532.712) -- 0:00:10
839000 -- [-532.292] (-531.804) (-532.716) (-533.071) * (-531.778) (-536.106) (-533.771) [-533.495] -- 0:00:10
839500 -- [-534.403] (-533.637) (-533.265) (-533.162) * (-531.095) [-532.143] (-532.201) (-538.235) -- 0:00:10
840000 -- (-538.465) (-536.195) [-534.591] (-532.002) * (-532.848) [-533.038] (-538.370) (-540.809) -- 0:00:10
Average standard deviation of split frequencies: 0.007220
840500 -- [-536.265] (-531.748) (-533.155) (-532.647) * (-532.332) (-536.628) [-533.291] (-531.833) -- 0:00:10
841000 -- (-539.184) (-533.617) (-532.650) [-532.421] * (-532.590) (-535.662) (-534.848) [-532.170] -- 0:00:10
841500 -- [-535.382] (-533.031) (-532.228) (-536.060) * [-533.325] (-537.075) (-531.399) (-537.859) -- 0:00:09
842000 -- [-535.648] (-531.997) (-531.691) (-533.064) * (-533.914) (-541.131) (-532.704) [-535.837] -- 0:00:09
842500 -- (-532.625) (-533.399) (-533.535) [-532.748] * (-533.982) (-533.625) [-533.838] (-533.787) -- 0:00:09
843000 -- [-533.427] (-533.267) (-535.174) (-531.527) * (-533.653) (-532.886) (-531.352) [-533.766] -- 0:00:09
843500 -- (-535.773) [-530.838] (-533.586) (-531.674) * [-534.218] (-532.567) (-536.730) (-531.035) -- 0:00:09
844000 -- (-534.552) (-534.387) [-532.802] (-532.024) * [-533.966] (-533.789) (-541.099) (-531.624) -- 0:00:09
844500 -- [-535.096] (-534.703) (-532.429) (-530.177) * [-532.178] (-531.849) (-536.892) (-531.724) -- 0:00:09
845000 -- (-532.116) (-533.255) (-533.764) [-531.515] * [-532.127] (-533.196) (-539.406) (-534.228) -- 0:00:09
Average standard deviation of split frequencies: 0.007174
845500 -- [-532.829] (-533.031) (-536.915) (-533.668) * (-532.559) (-539.226) [-533.962] (-533.753) -- 0:00:09
846000 -- [-531.144] (-532.066) (-535.536) (-533.800) * [-532.973] (-534.394) (-531.896) (-532.048) -- 0:00:09
846500 -- (-534.050) [-534.122] (-536.585) (-531.583) * (-536.080) [-533.298] (-533.803) (-533.221) -- 0:00:09
847000 -- [-532.328] (-537.150) (-537.522) (-532.041) * (-531.995) [-535.311] (-531.957) (-534.189) -- 0:00:09
847500 -- [-533.421] (-537.013) (-533.507) (-535.010) * (-532.950) (-534.547) [-534.960] (-536.949) -- 0:00:09
848000 -- (-532.433) (-533.987) [-534.144] (-535.163) * (-531.365) [-534.694] (-533.205) (-541.156) -- 0:00:09
848500 -- (-533.219) (-532.854) (-535.717) [-535.148] * (-530.604) (-535.391) [-534.370] (-539.437) -- 0:00:09
849000 -- (-534.929) [-536.023] (-534.268) (-532.956) * [-531.531] (-531.653) (-533.164) (-533.460) -- 0:00:09
849500 -- [-532.434] (-535.369) (-539.808) (-533.856) * [-531.383] (-533.036) (-532.658) (-536.287) -- 0:00:09
850000 -- (-534.900) (-534.021) (-533.934) [-532.759] * (-530.965) (-538.269) [-531.378] (-535.102) -- 0:00:09
Average standard deviation of split frequencies: 0.007412
850500 -- (-532.876) (-532.314) [-531.534] (-532.723) * (-533.986) [-534.331] (-537.307) (-535.341) -- 0:00:09
851000 -- (-533.051) [-534.194] (-532.324) (-532.369) * (-532.467) [-533.595] (-538.354) (-533.497) -- 0:00:09
851500 -- (-538.838) (-532.515) (-531.949) [-532.043] * [-531.578] (-536.033) (-536.731) (-533.565) -- 0:00:09
852000 -- (-535.013) [-535.110] (-531.948) (-533.183) * [-533.354] (-532.881) (-535.960) (-533.478) -- 0:00:09
852500 -- (-532.750) (-535.648) (-533.543) [-530.988] * (-534.196) [-531.196] (-534.504) (-531.924) -- 0:00:09
853000 -- (-533.661) (-532.962) [-534.717] (-533.832) * (-530.761) [-533.059] (-533.182) (-533.845) -- 0:00:09
853500 -- (-540.607) (-537.632) (-535.671) [-532.058] * (-535.087) (-532.913) (-532.758) [-533.066] -- 0:00:09
854000 -- (-532.070) (-532.559) [-531.554] (-536.689) * [-533.106] (-538.017) (-535.847) (-533.052) -- 0:00:09
854500 -- (-533.551) (-532.423) (-533.029) [-533.821] * (-533.772) (-533.214) [-532.262] (-534.624) -- 0:00:09
855000 -- (-533.094) [-536.335] (-532.130) (-533.045) * (-536.992) [-533.396] (-534.025) (-533.685) -- 0:00:09
Average standard deviation of split frequencies: 0.007331
855500 -- (-530.620) [-532.204] (-534.804) (-534.202) * [-532.509] (-532.807) (-532.180) (-537.084) -- 0:00:09
856000 -- (-530.717) (-538.732) (-533.127) [-532.329] * (-533.669) [-533.184] (-531.751) (-536.568) -- 0:00:09
856500 -- (-530.207) (-534.700) (-534.908) [-532.661] * (-535.235) (-532.668) (-533.099) [-533.963] -- 0:00:09
857000 -- (-532.131) (-530.784) [-536.690] (-534.896) * [-533.857] (-531.356) (-538.294) (-533.319) -- 0:00:09
857500 -- (-532.816) [-531.318] (-534.243) (-533.480) * [-532.296] (-533.889) (-534.622) (-534.105) -- 0:00:08
858000 -- [-532.844] (-534.410) (-532.315) (-536.400) * (-534.453) [-534.897] (-536.159) (-534.597) -- 0:00:08
858500 -- [-531.792] (-532.778) (-532.480) (-534.970) * [-534.043] (-532.565) (-536.359) (-532.776) -- 0:00:08
859000 -- (-533.138) [-532.542] (-534.128) (-535.536) * [-532.131] (-532.609) (-531.510) (-532.140) -- 0:00:08
859500 -- [-532.355] (-533.567) (-532.164) (-536.668) * (-532.498) [-534.772] (-534.533) (-531.664) -- 0:00:08
860000 -- [-531.368] (-534.063) (-534.257) (-533.236) * (-532.749) (-534.659) [-533.646] (-531.301) -- 0:00:08
Average standard deviation of split frequencies: 0.007223
860500 -- [-531.875] (-531.008) (-532.688) (-536.123) * (-533.893) [-532.521] (-532.900) (-532.445) -- 0:00:08
861000 -- (-533.167) (-532.163) [-532.934] (-532.873) * (-534.479) [-534.902] (-531.516) (-533.830) -- 0:00:08
861500 -- (-533.212) [-532.972] (-531.390) (-533.654) * (-534.107) (-533.643) (-540.256) [-535.786] -- 0:00:08
862000 -- (-532.653) [-531.942] (-532.312) (-534.212) * (-536.169) [-536.038] (-536.926) (-534.331) -- 0:00:08
862500 -- (-531.214) [-536.976] (-537.195) (-538.560) * [-533.446] (-532.920) (-535.086) (-534.674) -- 0:00:08
863000 -- (-533.385) (-533.134) [-537.207] (-532.408) * (-531.529) [-533.501] (-532.258) (-533.293) -- 0:00:08
863500 -- (-531.257) [-531.748] (-537.067) (-534.350) * (-534.413) (-532.412) [-540.173] (-540.465) -- 0:00:08
864000 -- (-532.923) (-536.817) (-535.943) [-534.331] * (-532.304) [-531.658] (-537.469) (-535.726) -- 0:00:08
864500 -- [-532.022] (-536.940) (-536.465) (-534.820) * (-531.607) (-534.645) [-533.756] (-531.013) -- 0:00:08
865000 -- (-531.974) [-533.640] (-539.517) (-532.252) * [-531.975] (-534.930) (-532.388) (-531.905) -- 0:00:08
Average standard deviation of split frequencies: 0.007213
865500 -- [-533.112] (-534.208) (-533.843) (-534.281) * (-535.850) [-533.706] (-531.817) (-533.883) -- 0:00:08
866000 -- (-531.585) [-533.487] (-536.092) (-535.123) * [-534.825] (-531.249) (-534.408) (-531.167) -- 0:00:08
866500 -- (-532.221) [-532.486] (-534.201) (-534.362) * (-534.528) (-529.421) [-535.405] (-536.445) -- 0:00:08
867000 -- (-533.343) (-534.513) (-541.819) [-533.851] * [-530.988] (-533.411) (-533.321) (-539.261) -- 0:00:08
867500 -- (-532.425) [-534.577] (-535.075) (-531.605) * [-532.520] (-533.569) (-532.855) (-538.432) -- 0:00:08
868000 -- (-532.993) (-533.605) (-533.019) [-533.012] * (-533.995) (-533.319) (-536.484) [-532.019] -- 0:00:08
868500 -- (-532.316) (-533.326) (-532.539) [-534.246] * (-532.011) [-531.642] (-532.530) (-535.170) -- 0:00:08
869000 -- (-533.009) (-543.073) (-533.174) [-531.495] * (-531.523) [-536.794] (-533.817) (-532.757) -- 0:00:08
869500 -- (-540.017) (-533.950) [-531.729] (-532.389) * (-531.370) (-535.890) [-535.838] (-537.576) -- 0:00:08
870000 -- (-534.087) (-533.824) [-531.801] (-531.587) * (-532.665) [-533.088] (-536.644) (-542.626) -- 0:00:08
Average standard deviation of split frequencies: 0.006768
870500 -- (-534.132) (-532.221) (-534.063) [-531.739] * (-534.019) (-531.684) [-531.537] (-534.593) -- 0:00:08
871000 -- (-537.409) (-534.168) [-535.556] (-534.622) * (-533.357) (-532.455) (-530.766) [-531.437] -- 0:00:08
871500 -- (-534.019) [-533.096] (-533.360) (-533.842) * (-534.379) [-533.194] (-534.119) (-534.167) -- 0:00:08
872000 -- (-535.852) (-533.717) (-531.353) [-532.501] * (-536.563) [-533.172] (-531.984) (-535.139) -- 0:00:08
872500 -- (-536.281) (-533.926) [-532.418] (-535.536) * (-532.744) [-532.345] (-533.327) (-534.474) -- 0:00:08
873000 -- (-532.906) (-536.930) [-532.559] (-533.400) * [-535.231] (-534.137) (-534.801) (-533.684) -- 0:00:08
873500 -- [-539.968] (-532.427) (-538.344) (-531.085) * (-534.978) (-541.828) [-530.633] (-534.948) -- 0:00:07
874000 -- (-536.108) (-532.600) (-534.879) [-535.177] * [-538.084] (-534.801) (-535.210) (-535.584) -- 0:00:07
874500 -- (-534.017) (-533.195) [-531.976] (-530.191) * (-533.622) [-535.527] (-536.872) (-535.783) -- 0:00:07
875000 -- (-535.509) (-531.929) (-538.191) [-532.880] * (-534.467) (-535.212) (-531.965) [-535.385] -- 0:00:07
Average standard deviation of split frequencies: 0.006760
875500 -- (-534.980) [-532.448] (-534.146) (-534.020) * (-536.295) [-534.274] (-532.451) (-532.827) -- 0:00:07
876000 -- (-534.577) (-531.789) [-536.695] (-534.480) * [-533.074] (-534.603) (-533.455) (-533.117) -- 0:00:07
876500 -- (-535.487) (-534.293) (-534.346) [-530.834] * (-534.296) (-535.450) (-533.625) [-534.642] -- 0:00:07
877000 -- [-535.119] (-534.710) (-534.728) (-532.138) * (-532.078) [-534.829] (-534.245) (-535.172) -- 0:00:07
877500 -- [-534.329] (-530.938) (-534.910) (-533.746) * (-535.280) (-534.529) [-531.492] (-540.623) -- 0:00:07
878000 -- (-534.687) (-531.746) [-537.006] (-533.552) * [-533.205] (-532.846) (-533.118) (-539.262) -- 0:00:07
878500 -- (-533.095) (-533.103) [-534.054] (-533.126) * (-536.376) [-534.482] (-533.152) (-535.788) -- 0:00:07
879000 -- [-533.813] (-533.304) (-533.189) (-534.224) * (-532.599) (-532.381) (-541.465) [-532.365] -- 0:00:07
879500 -- (-532.574) [-532.391] (-533.585) (-534.403) * (-535.413) [-534.903] (-537.891) (-532.630) -- 0:00:07
880000 -- (-532.479) (-534.021) [-534.530] (-532.995) * (-535.995) (-534.204) (-532.754) [-532.183] -- 0:00:07
Average standard deviation of split frequencies: 0.006423
880500 -- (-535.194) (-533.668) [-536.103] (-531.938) * (-531.741) (-537.349) (-535.183) [-532.904] -- 0:00:07
881000 -- [-531.702] (-538.194) (-537.663) (-532.522) * [-534.440] (-537.225) (-534.324) (-538.234) -- 0:00:07
881500 -- (-534.297) [-533.455] (-533.317) (-531.346) * [-534.134] (-533.943) (-533.283) (-535.550) -- 0:00:07
882000 -- (-533.338) [-533.141] (-532.258) (-535.940) * (-535.094) (-533.590) (-533.226) [-534.076] -- 0:00:07
882500 -- (-533.091) (-535.531) (-536.645) [-535.742] * (-533.904) [-533.705] (-534.747) (-535.514) -- 0:00:07
883000 -- [-536.222] (-536.912) (-532.623) (-540.543) * (-533.913) (-535.211) (-533.533) [-534.636] -- 0:00:07
883500 -- (-534.340) (-533.668) [-532.369] (-533.846) * [-534.554] (-541.796) (-530.686) (-534.321) -- 0:00:07
884000 -- (-532.631) (-532.248) [-532.889] (-536.176) * [-532.493] (-535.223) (-536.820) (-533.418) -- 0:00:07
884500 -- (-533.983) [-535.818] (-533.701) (-535.793) * (-538.483) (-533.466) (-534.993) [-534.417] -- 0:00:07
885000 -- (-536.255) (-532.389) (-533.885) [-534.431] * [-533.599] (-533.016) (-533.093) (-536.663) -- 0:00:07
Average standard deviation of split frequencies: 0.006584
885500 -- [-535.799] (-536.329) (-533.638) (-534.301) * (-534.929) (-538.921) [-531.374] (-535.341) -- 0:00:07
886000 -- (-536.210) [-536.496] (-535.290) (-533.774) * (-532.269) [-537.210] (-533.807) (-537.634) -- 0:00:07
886500 -- (-534.909) (-533.595) [-531.411] (-533.088) * [-535.331] (-533.161) (-534.642) (-534.057) -- 0:00:07
887000 -- [-535.804] (-534.729) (-532.643) (-531.370) * (-530.427) [-533.449] (-536.336) (-532.523) -- 0:00:07
887500 -- [-532.298] (-539.071) (-532.461) (-534.461) * (-533.467) (-533.911) [-537.878] (-536.037) -- 0:00:07
888000 -- (-534.896) (-536.859) (-533.346) [-531.979] * [-533.187] (-533.708) (-534.312) (-536.613) -- 0:00:07
888500 -- (-532.239) (-534.395) (-534.469) [-533.461] * (-533.434) [-532.315] (-531.948) (-535.756) -- 0:00:07
889000 -- [-532.473] (-533.711) (-532.648) (-532.507) * (-532.477) (-531.594) (-532.927) [-533.554] -- 0:00:06
889500 -- [-532.315] (-533.079) (-531.690) (-532.816) * (-535.151) (-536.417) (-531.892) [-532.710] -- 0:00:06
890000 -- (-532.456) (-533.227) (-533.284) [-532.095] * [-536.135] (-535.550) (-535.734) (-533.501) -- 0:00:06
Average standard deviation of split frequencies: 0.006781
890500 -- (-532.230) (-537.454) (-532.288) [-531.206] * (-538.016) (-532.386) [-536.111] (-532.882) -- 0:00:06
891000 -- (-534.701) (-533.582) [-532.850] (-531.334) * (-535.677) (-537.078) (-533.510) [-534.568] -- 0:00:06
891500 -- [-535.416] (-533.599) (-533.373) (-540.394) * (-532.472) (-532.113) [-534.476] (-535.669) -- 0:00:06
892000 -- (-535.325) (-533.859) [-532.188] (-537.020) * [-536.776] (-534.445) (-532.192) (-535.339) -- 0:00:06
892500 -- (-535.448) [-531.510] (-530.371) (-536.424) * (-538.687) (-534.573) [-535.603] (-535.289) -- 0:00:06
893000 -- (-532.026) [-531.553] (-530.973) (-536.411) * (-534.417) [-536.628] (-541.723) (-533.294) -- 0:00:06
893500 -- [-532.136] (-532.767) (-534.001) (-533.157) * (-537.516) [-532.606] (-535.662) (-533.758) -- 0:00:06
894000 -- (-534.422) [-531.466] (-532.320) (-531.146) * (-535.136) (-540.242) (-533.802) [-532.043] -- 0:00:06
894500 -- (-535.102) (-532.925) [-533.054] (-532.569) * (-531.648) (-533.992) [-534.371] (-534.501) -- 0:00:06
895000 -- (-531.846) (-534.480) (-532.081) [-533.618] * [-532.614] (-532.253) (-534.964) (-534.313) -- 0:00:06
Average standard deviation of split frequencies: 0.006905
895500 -- (-534.383) (-533.683) (-531.954) [-530.500] * (-531.421) (-533.763) (-533.241) [-533.916] -- 0:00:06
896000 -- [-533.932] (-531.872) (-533.546) (-530.423) * (-532.479) (-534.796) [-534.893] (-532.749) -- 0:00:06
896500 -- (-534.429) (-532.203) (-533.015) [-532.115] * (-537.146) [-533.292] (-532.893) (-534.316) -- 0:00:06
897000 -- (-534.104) (-534.374) (-530.083) [-533.459] * (-533.236) [-531.993] (-533.631) (-533.475) -- 0:00:06
897500 -- (-534.289) [-532.740] (-532.613) (-536.880) * (-534.319) [-535.871] (-534.959) (-534.601) -- 0:00:06
898000 -- (-532.634) (-531.288) [-531.398] (-540.326) * [-531.162] (-536.294) (-536.120) (-532.722) -- 0:00:06
898500 -- (-533.785) [-532.223] (-534.654) (-533.123) * [-533.197] (-533.472) (-532.431) (-533.395) -- 0:00:06
899000 -- (-533.215) (-532.280) (-535.687) [-532.375] * [-533.086] (-531.667) (-536.206) (-534.792) -- 0:00:06
899500 -- (-535.955) [-534.746] (-535.754) (-532.098) * [-531.158] (-535.922) (-533.996) (-533.675) -- 0:00:06
900000 -- (-534.346) [-533.722] (-532.817) (-533.983) * [-531.334] (-531.499) (-533.908) (-533.399) -- 0:00:06
Average standard deviation of split frequencies: 0.007393
900500 -- (-535.520) [-534.746] (-532.440) (-534.252) * (-533.337) (-535.179) (-535.850) [-535.844] -- 0:00:06
901000 -- (-534.926) [-532.587] (-535.147) (-534.008) * (-534.596) (-535.084) [-533.808] (-532.139) -- 0:00:06
901500 -- (-535.911) (-534.376) (-531.355) [-531.193] * (-533.227) (-534.431) (-534.364) [-532.254] -- 0:00:06
902000 -- (-535.662) (-532.473) [-531.699] (-530.486) * (-531.330) (-534.369) (-534.503) [-533.289] -- 0:00:06
902500 -- (-533.768) (-532.266) (-537.368) [-531.187] * (-532.931) [-534.095] (-533.442) (-532.764) -- 0:00:06
903000 -- (-533.869) [-532.330] (-536.495) (-534.218) * (-535.058) [-535.762] (-534.066) (-533.940) -- 0:00:06
903500 -- (-535.150) (-533.360) [-531.719] (-533.152) * (-532.713) [-536.120] (-533.769) (-534.159) -- 0:00:06
904000 -- (-534.006) [-533.237] (-531.812) (-532.623) * (-533.886) (-537.472) [-534.881] (-536.477) -- 0:00:06
904500 -- (-534.732) [-532.675] (-532.076) (-533.083) * (-534.096) (-537.142) [-532.108] (-533.787) -- 0:00:06
905000 -- (-533.107) (-533.434) (-532.381) [-532.195] * (-530.843) [-535.037] (-533.044) (-535.512) -- 0:00:05
Average standard deviation of split frequencies: 0.007317
905500 -- (-534.393) (-533.393) [-530.470] (-532.935) * (-535.243) [-533.670] (-532.860) (-534.703) -- 0:00:05
906000 -- (-536.258) [-532.715] (-530.546) (-532.781) * (-532.282) (-532.315) [-534.051] (-533.079) -- 0:00:05
906500 -- [-532.986] (-532.902) (-530.375) (-533.587) * [-534.869] (-530.505) (-535.507) (-531.850) -- 0:00:05
907000 -- (-532.444) (-532.432) (-537.516) [-531.805] * (-533.088) (-533.287) [-533.013] (-533.588) -- 0:00:05
907500 -- (-532.246) (-532.842) (-532.856) [-533.453] * (-534.173) (-532.770) (-533.762) [-534.685] -- 0:00:05
908000 -- (-535.061) (-530.275) [-532.061] (-532.959) * (-534.760) (-532.160) (-531.722) [-530.923] -- 0:00:05
908500 -- (-532.537) [-531.072] (-534.057) (-530.322) * (-531.966) [-536.679] (-534.082) (-535.811) -- 0:00:05
909000 -- [-535.978] (-534.004) (-534.573) (-531.840) * (-533.629) [-533.880] (-532.492) (-534.302) -- 0:00:05
909500 -- (-532.294) [-534.061] (-532.502) (-534.482) * (-533.353) (-534.598) (-532.637) [-534.509] -- 0:00:05
910000 -- [-534.514] (-534.039) (-533.517) (-533.154) * (-537.106) (-534.093) (-533.580) [-533.222] -- 0:00:05
Average standard deviation of split frequencies: 0.006729
910500 -- [-534.715] (-531.629) (-533.570) (-532.435) * (-534.630) [-534.771] (-532.979) (-534.285) -- 0:00:05
911000 -- [-532.354] (-530.658) (-538.850) (-535.888) * (-537.107) (-536.335) [-530.331] (-532.927) -- 0:00:05
911500 -- (-531.637) (-531.438) (-536.549) [-535.980] * (-538.173) (-533.577) [-531.135] (-533.344) -- 0:00:05
912000 -- [-531.804] (-532.252) (-532.476) (-532.026) * (-539.134) [-538.634] (-533.138) (-532.699) -- 0:00:05
912500 -- [-534.109] (-534.845) (-532.156) (-537.586) * (-532.803) [-536.387] (-535.056) (-534.047) -- 0:00:05
913000 -- (-533.866) [-534.700] (-534.942) (-535.821) * (-533.962) (-542.836) [-532.713] (-532.398) -- 0:00:05
913500 -- (-535.127) [-531.362] (-532.871) (-533.322) * (-532.809) (-532.323) [-534.408] (-534.858) -- 0:00:05
914000 -- (-535.507) (-530.836) (-532.671) [-533.312] * (-532.358) (-530.102) [-531.924] (-534.417) -- 0:00:05
914500 -- (-530.460) [-531.416] (-538.786) (-533.078) * (-532.325) (-536.469) [-529.643] (-532.547) -- 0:00:05
915000 -- (-534.423) (-533.155) (-535.100) [-532.173] * (-536.605) [-534.985] (-530.659) (-535.006) -- 0:00:05
Average standard deviation of split frequencies: 0.006401
915500 -- (-531.796) [-533.734] (-531.441) (-533.526) * (-533.359) (-533.955) (-538.470) [-534.612] -- 0:00:05
916000 -- (-532.221) (-540.398) [-530.500] (-533.239) * [-534.371] (-533.863) (-537.438) (-534.824) -- 0:00:05
916500 -- (-532.803) [-532.128] (-531.414) (-533.285) * (-532.619) [-531.884] (-533.051) (-536.222) -- 0:00:05
917000 -- (-533.714) [-532.116] (-534.294) (-531.705) * (-533.767) (-533.401) [-536.031] (-534.549) -- 0:00:05
917500 -- (-535.056) [-533.510] (-535.699) (-534.703) * [-531.715] (-532.621) (-532.012) (-533.041) -- 0:00:05
918000 -- [-532.788] (-531.895) (-532.345) (-530.941) * (-534.465) [-532.216] (-532.728) (-535.024) -- 0:00:05
918500 -- (-532.969) (-532.854) (-531.536) [-532.227] * (-531.828) (-534.620) (-533.967) [-535.666] -- 0:00:05
919000 -- (-532.078) (-532.778) (-534.648) [-532.824] * [-530.780] (-532.920) (-531.829) (-532.946) -- 0:00:05
919500 -- (-533.832) (-540.055) [-533.930] (-533.055) * (-531.854) (-532.412) [-532.261] (-535.087) -- 0:00:05
920000 -- (-532.089) (-540.776) (-533.824) [-533.675] * (-535.758) (-533.046) (-531.310) [-533.653] -- 0:00:05
Average standard deviation of split frequencies: 0.006368
920500 -- (-533.903) (-537.209) (-534.054) [-534.001] * (-533.465) (-534.917) [-531.533] (-532.630) -- 0:00:05
921000 -- (-536.932) (-534.667) (-534.421) [-533.577] * (-532.531) (-534.959) (-536.680) [-533.748] -- 0:00:04
921500 -- (-543.568) [-533.662] (-534.535) (-530.578) * (-532.102) [-533.241] (-535.140) (-533.325) -- 0:00:04
922000 -- [-535.587] (-535.653) (-535.800) (-533.707) * (-532.943) (-534.936) (-532.849) [-536.810] -- 0:00:04
922500 -- (-533.629) [-532.270] (-534.649) (-532.357) * (-531.594) (-536.480) [-533.017] (-532.912) -- 0:00:04
923000 -- (-534.300) (-533.972) [-535.777] (-531.853) * [-531.536] (-534.546) (-534.981) (-534.483) -- 0:00:04
923500 -- (-532.179) [-531.989] (-539.161) (-532.364) * (-533.706) (-533.145) [-533.734] (-533.344) -- 0:00:04
924000 -- (-533.760) (-533.812) [-533.277] (-535.346) * (-532.847) (-532.640) [-534.662] (-532.046) -- 0:00:04
924500 -- (-532.235) (-534.132) (-533.698) [-536.086] * (-535.317) [-533.111] (-532.236) (-534.408) -- 0:00:04
925000 -- (-536.006) [-533.468] (-533.715) (-533.477) * (-531.740) [-533.468] (-532.443) (-531.405) -- 0:00:04
Average standard deviation of split frequencies: 0.006013
925500 -- (-534.230) (-540.280) (-534.557) [-530.253] * (-534.538) [-531.495] (-534.395) (-533.065) -- 0:00:04
926000 -- (-533.134) (-534.337) (-532.858) [-534.792] * (-535.735) (-535.113) (-537.409) [-535.717] -- 0:00:04
926500 -- (-532.942) (-533.487) (-532.316) [-532.728] * (-533.332) (-535.071) (-533.926) [-533.097] -- 0:00:04
927000 -- (-533.751) (-534.189) [-532.588] (-533.910) * (-534.080) (-535.432) [-533.964] (-534.639) -- 0:00:04
927500 -- (-533.457) (-537.302) [-532.234] (-532.931) * (-532.561) [-533.026] (-533.786) (-535.106) -- 0:00:04
928000 -- (-534.380) (-535.890) (-533.290) [-534.939] * [-531.827] (-533.114) (-535.661) (-535.430) -- 0:00:04
928500 -- (-535.485) (-532.992) (-532.952) [-532.550] * (-532.175) (-532.205) (-536.137) [-534.302] -- 0:00:04
929000 -- (-532.542) (-533.451) [-531.487] (-533.105) * (-531.977) (-532.273) (-533.888) [-531.437] -- 0:00:04
929500 -- (-533.685) (-534.374) [-532.557] (-532.963) * (-532.077) [-532.625] (-535.147) (-533.605) -- 0:00:04
930000 -- (-534.536) [-531.870] (-533.889) (-532.213) * (-534.798) [-532.095] (-536.351) (-536.922) -- 0:00:04
Average standard deviation of split frequencies: 0.005920
930500 -- (-533.090) [-532.843] (-531.530) (-537.334) * [-533.884] (-533.476) (-537.585) (-532.330) -- 0:00:04
931000 -- [-532.754] (-534.945) (-537.870) (-532.445) * (-537.413) (-534.424) (-536.313) [-533.495] -- 0:00:04
931500 -- (-532.252) (-533.024) (-534.709) [-531.240] * [-532.902] (-534.361) (-534.917) (-538.263) -- 0:00:04
932000 -- [-532.942] (-534.255) (-532.636) (-531.847) * (-532.478) (-537.045) (-535.618) [-531.400] -- 0:00:04
932500 -- (-536.459) (-532.512) (-531.936) [-532.465] * [-531.222] (-537.943) (-531.631) (-534.889) -- 0:00:04
933000 -- (-539.308) (-532.607) [-532.197] (-534.631) * (-534.341) [-535.420] (-533.603) (-535.239) -- 0:00:04
933500 -- (-532.868) (-532.338) [-531.872] (-535.434) * (-535.389) (-534.466) [-536.510] (-534.524) -- 0:00:04
934000 -- (-534.443) [-533.551] (-530.894) (-534.676) * (-532.503) (-531.877) [-537.182] (-534.496) -- 0:00:04
934500 -- (-535.365) (-534.780) [-532.124] (-538.572) * (-532.983) [-532.051] (-532.572) (-531.050) -- 0:00:04
935000 -- (-534.427) (-531.165) [-538.034] (-536.553) * (-533.141) [-532.030] (-533.417) (-532.885) -- 0:00:04
Average standard deviation of split frequencies: 0.006170
935500 -- (-534.200) (-531.192) [-532.957] (-535.583) * (-531.386) (-532.411) (-532.266) [-533.331] -- 0:00:04
936000 -- (-533.614) (-531.867) [-531.616] (-532.851) * [-532.454] (-533.748) (-533.430) (-535.007) -- 0:00:04
936500 -- (-532.116) (-535.043) [-531.320] (-534.750) * (-532.603) [-537.091] (-534.994) (-532.181) -- 0:00:04
937000 -- (-533.546) (-530.820) [-532.674] (-533.273) * (-535.358) (-537.674) [-533.343] (-537.401) -- 0:00:03
937500 -- (-534.134) [-531.283] (-530.889) (-531.177) * (-533.137) (-531.980) [-530.821] (-532.504) -- 0:00:03
938000 -- (-533.646) [-531.514] (-531.958) (-533.581) * (-533.268) [-534.086] (-533.445) (-531.574) -- 0:00:03
938500 -- (-534.178) (-532.770) [-532.772] (-533.492) * [-534.468] (-534.526) (-532.695) (-534.769) -- 0:00:03
939000 -- (-533.789) (-533.326) [-531.188] (-534.062) * (-534.479) [-532.653] (-533.565) (-536.844) -- 0:00:03
939500 -- (-533.243) (-537.183) [-530.443] (-531.283) * (-533.761) [-535.282] (-533.658) (-533.296) -- 0:00:03
940000 -- (-532.996) [-532.151] (-534.344) (-532.887) * (-533.164) (-532.716) [-533.394] (-534.743) -- 0:00:03
Average standard deviation of split frequencies: 0.006076
940500 -- (-533.545) (-535.654) [-532.580] (-532.664) * (-537.698) (-533.345) [-532.070] (-533.714) -- 0:00:03
941000 -- (-534.039) [-531.256] (-535.559) (-532.142) * (-535.516) (-532.545) [-531.892] (-533.741) -- 0:00:03
941500 -- (-535.328) (-532.323) [-531.324] (-530.485) * [-532.680] (-533.351) (-533.116) (-532.917) -- 0:00:03
942000 -- (-533.818) [-532.890] (-533.061) (-530.921) * (-532.986) (-533.037) (-533.860) [-532.430] -- 0:00:03
942500 -- [-532.726] (-532.122) (-534.883) (-531.785) * (-531.190) (-531.589) [-533.931] (-532.973) -- 0:00:03
943000 -- (-532.212) (-533.118) [-536.357] (-534.642) * (-532.629) (-533.923) [-531.646] (-532.642) -- 0:00:03
943500 -- (-537.393) [-531.864] (-533.369) (-530.115) * (-532.698) (-531.289) [-535.274] (-533.185) -- 0:00:03
944000 -- (-535.091) (-532.895) [-534.191] (-531.808) * [-532.472] (-534.198) (-532.617) (-532.839) -- 0:00:03
944500 -- (-532.198) [-532.156] (-531.593) (-531.090) * (-531.821) (-534.068) [-532.856] (-533.000) -- 0:00:03
945000 -- (-534.808) (-535.094) (-534.998) [-532.714] * (-534.966) (-536.505) (-532.324) [-532.126] -- 0:00:03
Average standard deviation of split frequencies: 0.006013
945500 -- [-530.932] (-533.947) (-533.817) (-532.258) * (-529.896) (-535.850) [-536.030] (-532.976) -- 0:00:03
946000 -- (-531.723) [-530.490] (-534.020) (-533.043) * (-531.267) (-532.631) (-533.816) [-533.791] -- 0:00:03
946500 -- (-530.979) [-533.128] (-536.789) (-531.942) * (-532.987) (-531.238) [-533.756] (-538.024) -- 0:00:03
947000 -- (-532.446) [-531.507] (-533.875) (-535.717) * [-530.164] (-535.547) (-535.538) (-533.008) -- 0:00:03
947500 -- (-532.093) (-534.284) [-532.418] (-531.589) * [-531.544] (-534.574) (-536.031) (-534.880) -- 0:00:03
948000 -- (-533.424) (-534.874) [-534.648] (-533.501) * (-531.168) (-531.752) [-534.242] (-531.942) -- 0:00:03
948500 -- (-532.079) [-531.367] (-537.460) (-532.837) * (-531.427) (-533.370) [-532.856] (-533.239) -- 0:00:03
949000 -- (-532.333) (-532.760) [-531.350] (-535.010) * (-532.462) (-533.081) (-532.971) [-533.168] -- 0:00:03
949500 -- [-532.696] (-537.361) (-535.681) (-535.837) * (-533.174) (-535.018) (-531.694) [-530.065] -- 0:00:03
950000 -- [-530.581] (-532.601) (-535.397) (-543.011) * (-532.364) (-534.659) (-533.339) [-532.273] -- 0:00:03
Average standard deviation of split frequencies: 0.006017
950500 -- [-531.511] (-534.756) (-534.759) (-532.094) * (-532.714) (-534.132) [-531.528] (-532.960) -- 0:00:03
951000 -- [-534.377] (-532.659) (-535.025) (-532.940) * (-533.226) (-534.260) [-534.253] (-533.071) -- 0:00:03
951500 -- [-534.616] (-531.236) (-531.951) (-534.214) * (-533.660) (-534.511) (-531.907) [-533.075] -- 0:00:03
952000 -- [-531.772] (-533.346) (-538.897) (-534.676) * (-531.402) [-535.246] (-530.756) (-536.371) -- 0:00:03
952500 -- [-532.585] (-533.477) (-533.836) (-533.801) * (-532.509) [-532.437] (-535.121) (-534.964) -- 0:00:02
953000 -- (-533.072) (-532.611) (-532.823) [-533.222] * (-534.984) (-532.209) (-534.002) [-532.354] -- 0:00:02
953500 -- (-531.055) (-536.011) [-533.419] (-533.642) * (-531.670) (-530.874) (-534.328) [-533.376] -- 0:00:02
954000 -- [-533.382] (-534.637) (-538.381) (-532.753) * (-532.837) (-533.284) (-533.483) [-534.893] -- 0:00:02
954500 -- (-531.790) [-534.837] (-533.204) (-531.835) * (-534.814) (-535.185) (-532.760) [-531.897] -- 0:00:02
955000 -- [-533.322] (-533.505) (-535.229) (-532.165) * (-530.687) (-536.175) [-530.568] (-535.643) -- 0:00:02
Average standard deviation of split frequencies: 0.006279
955500 -- (-534.460) [-535.423] (-535.253) (-531.198) * (-531.632) (-534.215) [-533.192] (-536.774) -- 0:00:02
956000 -- (-538.963) (-534.031) (-536.075) [-532.518] * (-536.548) [-533.239] (-532.817) (-532.994) -- 0:00:02
956500 -- (-533.638) [-534.346] (-541.018) (-531.019) * (-540.578) (-533.095) (-533.476) [-532.879] -- 0:00:02
957000 -- [-531.960] (-534.475) (-544.933) (-531.234) * (-538.609) [-534.271] (-533.295) (-532.392) -- 0:00:02
957500 -- (-533.951) [-533.667] (-548.793) (-530.327) * (-536.369) (-533.881) [-533.889] (-531.901) -- 0:00:02
958000 -- (-534.090) (-533.236) [-534.887] (-532.703) * [-532.198] (-533.974) (-534.724) (-530.774) -- 0:00:02
958500 -- (-533.200) (-533.515) [-532.872] (-530.649) * (-536.524) [-533.065] (-532.205) (-531.808) -- 0:00:02
959000 -- (-532.568) (-536.097) (-536.190) [-531.706] * (-533.842) (-535.014) (-532.944) [-532.938] -- 0:00:02
959500 -- (-532.861) [-532.553] (-535.478) (-532.314) * (-532.032) (-533.116) [-532.395] (-531.101) -- 0:00:02
960000 -- (-531.309) (-531.933) (-531.801) [-531.603] * [-532.984] (-533.434) (-535.161) (-534.940) -- 0:00:02
Average standard deviation of split frequencies: 0.005594
960500 -- (-532.367) (-535.307) (-531.593) [-531.912] * (-533.996) [-533.442] (-533.547) (-536.302) -- 0:00:02
961000 -- (-534.263) (-533.177) (-534.178) [-532.235] * (-531.845) (-532.367) [-533.443] (-538.783) -- 0:00:02
961500 -- (-532.963) [-533.246] (-531.815) (-530.272) * (-532.836) (-535.400) [-531.547] (-530.970) -- 0:00:02
962000 -- (-535.072) (-534.153) [-532.772] (-538.964) * (-536.110) [-535.491] (-532.996) (-534.102) -- 0:00:02
962500 -- (-533.260) [-532.627] (-537.594) (-530.741) * (-532.611) [-536.132] (-534.026) (-532.052) -- 0:00:02
963000 -- (-532.749) (-532.169) (-536.041) [-532.818] * (-534.321) (-533.538) [-531.136] (-533.268) -- 0:00:02
963500 -- (-531.682) (-532.539) (-531.896) [-533.234] * (-532.695) (-535.072) [-531.571] (-530.543) -- 0:00:02
964000 -- (-534.838) (-533.049) (-534.093) [-534.258] * (-534.453) (-532.519) [-535.255] (-532.510) -- 0:00:02
964500 -- (-534.115) [-534.437] (-535.891) (-534.272) * (-534.250) (-533.338) [-533.430] (-534.814) -- 0:00:02
965000 -- (-537.314) (-536.666) [-530.843] (-536.731) * (-533.536) (-535.619) (-531.511) [-533.847] -- 0:00:02
Average standard deviation of split frequencies: 0.005400
965500 -- (-533.092) (-533.834) (-534.535) [-532.070] * (-535.042) (-535.749) (-534.410) [-535.780] -- 0:00:02
966000 -- (-533.269) (-533.669) [-532.005] (-538.442) * (-531.979) (-533.330) [-535.142] (-534.938) -- 0:00:02
966500 -- (-533.758) (-533.980) [-531.990] (-532.157) * [-532.404] (-534.777) (-532.088) (-534.227) -- 0:00:02
967000 -- (-534.336) [-532.019] (-531.470) (-532.426) * (-532.101) [-532.371] (-533.707) (-531.965) -- 0:00:02
967500 -- (-535.353) [-531.998] (-532.954) (-532.031) * [-535.168] (-533.069) (-533.337) (-531.842) -- 0:00:02
968000 -- [-533.189] (-532.072) (-537.394) (-532.524) * (-533.987) (-532.837) (-534.636) [-532.969] -- 0:00:02
968500 -- (-533.616) (-537.612) (-536.286) [-533.874] * (-533.850) (-532.847) (-531.792) [-532.784] -- 0:00:01
969000 -- (-532.774) (-532.628) (-535.631) [-533.035] * (-533.664) (-534.278) (-532.002) [-534.485] -- 0:00:01
969500 -- (-532.705) [-532.326] (-532.630) (-534.235) * [-533.307] (-535.390) (-533.865) (-531.924) -- 0:00:01
970000 -- (-537.266) (-532.675) [-536.127] (-532.224) * (-532.244) [-529.938] (-533.966) (-536.379) -- 0:00:01
Average standard deviation of split frequencies: 0.005407
970500 -- (-532.948) [-533.259] (-533.416) (-532.626) * [-535.535] (-532.534) (-535.598) (-532.907) -- 0:00:01
971000 -- (-531.623) [-533.262] (-533.144) (-533.110) * (-536.789) (-534.005) [-530.557] (-534.488) -- 0:00:01
971500 -- (-532.248) (-534.592) [-532.371] (-536.166) * (-536.139) [-539.746] (-532.150) (-532.976) -- 0:00:01
972000 -- (-533.691) (-532.648) [-532.578] (-535.364) * (-534.423) (-534.784) [-533.086] (-534.474) -- 0:00:01
972500 -- [-534.027] (-534.723) (-533.459) (-533.413) * (-532.613) (-531.562) (-534.109) [-535.053] -- 0:00:01
973000 -- [-535.191] (-535.226) (-532.511) (-535.358) * (-535.078) (-531.605) [-531.081] (-531.434) -- 0:00:01
973500 -- (-535.457) (-536.150) (-534.070) [-532.752] * (-535.793) (-532.329) [-532.296] (-533.039) -- 0:00:01
974000 -- (-534.824) (-534.663) (-532.218) [-531.079] * (-533.823) [-531.647] (-536.455) (-536.138) -- 0:00:01
974500 -- (-533.338) [-532.482] (-540.560) (-532.028) * (-532.909) [-532.738] (-532.843) (-535.962) -- 0:00:01
975000 -- [-531.463] (-536.058) (-533.918) (-533.364) * [-533.641] (-535.790) (-531.433) (-538.078) -- 0:00:01
Average standard deviation of split frequencies: 0.005088
975500 -- (-531.788) (-536.639) [-535.176] (-530.558) * (-532.847) (-535.099) [-535.112] (-537.460) -- 0:00:01
976000 -- (-534.608) (-533.587) [-533.433] (-534.582) * (-534.433) [-534.049] (-537.314) (-533.770) -- 0:00:01
976500 -- (-533.567) [-534.566] (-534.733) (-532.835) * (-533.895) (-537.130) [-536.873] (-531.487) -- 0:00:01
977000 -- (-533.223) (-533.288) [-531.859] (-534.432) * (-534.211) [-533.174] (-534.883) (-531.510) -- 0:00:01
977500 -- (-532.797) (-535.525) [-530.584] (-531.867) * [-535.005] (-534.184) (-534.991) (-537.978) -- 0:00:01
978000 -- [-531.776] (-533.958) (-531.512) (-533.228) * [-532.971] (-533.592) (-532.452) (-534.465) -- 0:00:01
978500 -- (-534.347) (-533.870) [-531.694] (-533.497) * (-533.911) (-535.373) (-533.232) [-532.807] -- 0:00:01
979000 -- (-531.591) (-534.609) [-532.935] (-534.005) * (-533.373) (-531.951) (-531.472) [-532.668] -- 0:00:01
979500 -- [-531.799] (-537.277) (-532.394) (-536.095) * (-533.216) [-531.682] (-534.287) (-534.295) -- 0:00:01
980000 -- (-533.156) (-533.642) [-531.234] (-532.918) * (-533.590) (-533.942) [-535.662] (-532.724) -- 0:00:01
Average standard deviation of split frequencies: 0.004583
980500 -- [-532.304] (-531.722) (-534.987) (-531.034) * (-535.207) (-535.211) [-532.902] (-532.908) -- 0:00:01
981000 -- [-533.183] (-533.162) (-535.420) (-534.157) * (-531.709) [-533.672] (-538.816) (-532.623) -- 0:00:01
981500 -- (-533.176) [-532.618] (-531.886) (-533.034) * [-531.797] (-533.423) (-533.997) (-533.524) -- 0:00:01
982000 -- (-534.963) (-534.170) (-535.255) [-532.030] * [-532.243] (-531.817) (-533.539) (-533.282) -- 0:00:01
982500 -- [-534.365] (-536.583) (-531.914) (-532.436) * [-531.628] (-531.658) (-534.090) (-535.305) -- 0:00:01
983000 -- (-535.752) [-535.432] (-537.431) (-533.852) * (-535.342) (-533.563) [-534.513] (-535.373) -- 0:00:01
983500 -- [-535.238] (-539.077) (-531.557) (-539.344) * [-536.612] (-531.470) (-537.007) (-536.068) -- 0:00:01
984000 -- (-533.185) [-535.650] (-533.239) (-538.651) * (-534.478) [-531.659] (-533.232) (-534.578) -- 0:00:01
984500 -- [-532.146] (-534.384) (-534.764) (-534.659) * (-533.235) (-534.406) [-532.843] (-533.058) -- 0:00:00
985000 -- (-535.631) (-538.663) [-532.778] (-531.894) * (-536.526) (-533.343) (-533.955) [-537.375] -- 0:00:00
Average standard deviation of split frequencies: 0.004813
985500 -- (-533.029) (-534.088) [-534.404] (-531.865) * (-536.000) [-534.535] (-534.974) (-533.933) -- 0:00:00
986000 -- (-541.122) (-531.755) [-534.057] (-531.249) * (-536.637) (-533.639) (-534.049) [-534.048] -- 0:00:00
986500 -- (-535.560) [-533.685] (-532.827) (-532.942) * [-536.367] (-534.529) (-532.530) (-539.284) -- 0:00:00
987000 -- (-536.571) (-533.273) [-531.314] (-534.999) * (-539.978) (-533.344) (-531.344) [-532.416] -- 0:00:00
987500 -- (-530.819) [-534.788] (-531.547) (-535.001) * (-543.586) [-532.238] (-534.273) (-538.187) -- 0:00:00
988000 -- [-534.983] (-537.993) (-533.175) (-536.939) * (-534.293) [-532.213] (-531.977) (-534.111) -- 0:00:00
988500 -- [-535.366] (-532.634) (-532.312) (-540.676) * (-532.523) (-532.203) (-534.914) [-532.845] -- 0:00:00
989000 -- (-534.144) (-533.473) [-532.689] (-536.344) * (-532.701) (-533.024) (-534.966) [-535.251] -- 0:00:00
989500 -- (-532.565) (-532.338) [-532.646] (-532.415) * (-537.201) (-532.914) [-531.716] (-534.398) -- 0:00:00
990000 -- (-532.472) (-532.997) (-531.288) [-536.923] * (-537.364) (-533.359) [-533.108] (-532.594) -- 0:00:00
Average standard deviation of split frequencies: 0.004727
990500 -- [-535.740] (-534.609) (-532.401) (-535.633) * (-533.683) (-532.968) [-533.556] (-535.672) -- 0:00:00
991000 -- (-534.129) (-538.473) (-531.589) [-534.511] * (-535.265) (-532.042) (-534.989) [-536.642] -- 0:00:00
991500 -- (-534.326) [-534.348] (-531.661) (-538.186) * (-534.315) (-533.238) [-531.658] (-534.176) -- 0:00:00
992000 -- (-532.550) [-533.605] (-533.480) (-534.583) * (-532.397) [-533.398] (-535.933) (-536.421) -- 0:00:00
992500 -- (-532.756) (-531.879) [-536.252] (-532.548) * [-530.555] (-532.616) (-532.955) (-531.825) -- 0:00:00
993000 -- (-532.330) (-534.586) (-531.727) [-533.216] * [-533.232] (-533.192) (-535.460) (-531.949) -- 0:00:00
993500 -- [-533.453] (-535.539) (-533.311) (-533.288) * (-534.141) (-532.963) (-535.242) [-533.078] -- 0:00:00
994000 -- (-533.948) (-536.751) [-533.469] (-531.696) * (-536.323) (-531.546) [-535.220] (-533.326) -- 0:00:00
994500 -- (-538.104) [-532.719] (-532.515) (-534.333) * [-533.555] (-536.192) (-531.877) (-537.884) -- 0:00:00
995000 -- (-534.527) [-536.452] (-535.893) (-532.543) * [-530.211] (-538.345) (-534.665) (-533.105) -- 0:00:00
Average standard deviation of split frequencies: 0.004859
995500 -- (-536.022) (-532.626) (-533.506) [-533.189] * [-531.047] (-536.036) (-537.901) (-532.098) -- 0:00:00
996000 -- (-533.144) (-533.446) [-533.891] (-533.765) * (-533.401) (-534.231) (-535.865) [-532.832] -- 0:00:00
996500 -- (-534.832) (-541.323) [-533.340] (-535.103) * [-532.435] (-533.117) (-533.603) (-533.951) -- 0:00:00
997000 -- [-533.481] (-532.184) (-536.870) (-533.572) * (-533.315) [-531.952] (-531.893) (-532.970) -- 0:00:00
997500 -- (-532.140) (-533.255) (-538.151) [-531.803] * (-532.598) (-532.337) [-534.564] (-533.621) -- 0:00:00
998000 -- (-539.833) [-533.912] (-539.468) (-535.662) * [-533.885] (-536.605) (-533.091) (-532.521) -- 0:00:00
998500 -- (-532.477) (-531.424) (-538.315) [-534.314] * (-536.890) [-534.281] (-530.769) (-534.609) -- 0:00:00
999000 -- (-533.252) (-538.664) [-536.863] (-535.041) * [-533.967] (-532.518) (-533.136) (-534.163) -- 0:00:00
999500 -- (-536.491) (-535.301) [-532.638] (-534.699) * [-533.575] (-531.726) (-530.590) (-536.048) -- 0:00:00
1000000 -- [-530.239] (-532.568) (-534.974) (-532.888) * (-534.891) [-531.857] (-533.275) (-537.269) -- 0:00:00
Average standard deviation of split frequencies: 0.004931
Analysis completed in 1 mins 3 seconds
Analysis used 62.47 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -528.39
Likelihood of best state for "cold" chain of run 2 was -528.38
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 69 %) Dirichlet(Revmat{all})
98.0 % ( 97 %) Slider(Revmat{all})
35.1 % ( 26 %) Dirichlet(Pi{all})
35.3 % ( 34 %) Slider(Pi{all})
70.0 % ( 49 %) Multiplier(Alpha{1,2})
79.2 % ( 56 %) Multiplier(Alpha{3})
27.7 % ( 27 %) Slider(Pinvar{all})
97.1 % ( 93 %) ExtSPR(Tau{all},V{all})
68.9 % ( 62 %) ExtTBR(Tau{all},V{all})
97.9 % ( 98 %) NNI(Tau{all},V{all})
87.7 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
93.4 % ( 95 %) Nodeslider(V{all})
30.3 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
73.8 % ( 57 %) Dirichlet(Revmat{all})
98.1 % ( 99 %) Slider(Revmat{all})
34.7 % ( 25 %) Dirichlet(Pi{all})
35.2 % ( 28 %) Slider(Pi{all})
70.2 % ( 38 %) Multiplier(Alpha{1,2})
78.4 % ( 44 %) Multiplier(Alpha{3})
28.4 % ( 20 %) Slider(Pinvar{all})
97.1 % ( 98 %) ExtSPR(Tau{all},V{all})
68.9 % ( 72 %) ExtTBR(Tau{all},V{all})
98.0 % ( 98 %) NNI(Tau{all},V{all})
87.6 % ( 92 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
93.3 % ( 94 %) Nodeslider(V{all})
30.7 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167202 0.82 0.66
3 | 166248 166248 0.83
4 | 166481 167117 166704
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166252 0.82 0.66
3 | 166609 166496 0.84
4 | 167069 166493 167081
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -532.24
| 1 |
| 2 1 1 |
| 2 1 |
| 1 1 1 1 1 * 2 1 |
| 2 2 1 2 21 1 1 2 1 |
| 2 22 * 2 2 1 1 1 1 * 12|
|1 2 2 2 1 2 22 2 *1 *21 2 1 |
|21 1 1 * 2 2 1 2 22 |
| 1 2 21 2 2 1* 1 1 222 2 2 |
| 11 *2 21 1 11 1 1 * |
| 1 1 2 2 22 21 2 |
| 1 222 1|
| 1 2 |
| 2 1 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -534.48
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -532.34 -535.40
2 -532.30 -536.54
--------------------------------------
TOTAL -532.32 -536.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.864628 0.085718 0.362501 1.478783 0.834164 1460.78 1480.89 1.000
r(A<->C){all} 0.156066 0.017462 0.000011 0.420224 0.124690 364.48 378.17 1.003
r(A<->G){all} 0.152770 0.018554 0.000002 0.429607 0.114033 281.91 299.65 1.002
r(A<->T){all} 0.166205 0.019661 0.000011 0.447319 0.133537 166.04 202.97 1.003
r(C<->G){all} 0.156334 0.020457 0.000028 0.468683 0.114950 234.46 238.86 1.001
r(C<->T){all} 0.161201 0.022549 0.000116 0.481651 0.113170 154.01 171.12 1.000
r(G<->T){all} 0.207425 0.023196 0.000225 0.498694 0.176712 177.05 264.00 1.006
pi(A){all} 0.265231 0.000498 0.222645 0.308772 0.264508 1302.04 1375.08 1.000
pi(C){all} 0.244884 0.000470 0.201856 0.286048 0.244475 1261.73 1381.36 1.000
pi(G){all} 0.320028 0.000565 0.272011 0.364057 0.319839 1194.70 1347.85 1.000
pi(T){all} 0.169857 0.000374 0.132730 0.207325 0.169341 1196.51 1250.12 1.000
alpha{1,2} 0.349867 0.161262 0.000595 1.129292 0.221040 1273.35 1328.41 1.000
alpha{3} 0.400992 0.217771 0.000135 1.376451 0.233324 1180.95 1256.15 1.000
pinvar{all} 0.990688 0.000063 0.975490 0.999851 0.992888 1468.14 1484.57 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- .*...*
9 -- ...**.
10 -- ..**..
11 -- ...*.*
12 -- .*..*.
13 -- .****.
14 -- ....**
15 -- .*.*..
16 -- .*.***
17 -- ..*..*
18 -- .***.*
19 -- ..****
20 -- ..*.*.
21 -- .**.**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 465 0.154897 0.004240 0.151899 0.157895 2
8 458 0.152565 0.008480 0.146569 0.158561 2
9 449 0.149567 0.004240 0.146569 0.152565 2
10 448 0.149234 0.014133 0.139241 0.159227 2
11 443 0.147568 0.003298 0.145237 0.149900 2
12 433 0.144237 0.001413 0.143238 0.145237 2
13 430 0.143238 0.004711 0.139907 0.146569 2
14 423 0.140906 0.001413 0.139907 0.141905 2
15 422 0.140573 0.000000 0.140573 0.140573 2
16 420 0.139907 0.015075 0.129247 0.150566 2
17 418 0.139241 0.001884 0.137908 0.140573 2
18 416 0.138574 0.002827 0.136576 0.140573 2
19 415 0.138241 0.003298 0.135909 0.140573 2
20 413 0.137575 0.004240 0.134577 0.140573 2
21 402 0.133911 0.004711 0.130580 0.137242 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.132047 0.013603 0.000147 0.351670 0.099610 1.000 2
length{all}[2] 0.090511 0.008637 0.000028 0.274902 0.061343 1.000 2
length{all}[3] 0.092707 0.008694 0.000031 0.281047 0.063292 1.000 2
length{all}[4] 0.089812 0.008384 0.000019 0.273657 0.060667 1.000 2
length{all}[5] 0.091450 0.009023 0.000033 0.292125 0.058781 1.000 2
length{all}[6] 0.091913 0.008993 0.000029 0.274297 0.062237 1.000 2
length{all}[7] 0.089823 0.007897 0.000156 0.271666 0.062272 0.998 2
length{all}[8] 0.091816 0.007383 0.000022 0.251488 0.067479 1.004 2
length{all}[9] 0.092835 0.009369 0.000125 0.268042 0.066479 0.998 2
length{all}[10] 0.088750 0.007119 0.000064 0.259888 0.061672 1.000 2
length{all}[11] 0.089408 0.007151 0.000003 0.253682 0.062152 0.998 2
length{all}[12] 0.088089 0.010768 0.000158 0.287975 0.053088 0.998 2
length{all}[13] 0.096976 0.009392 0.000110 0.278612 0.066856 1.004 2
length{all}[14] 0.090574 0.009592 0.000270 0.264808 0.061746 0.998 2
length{all}[15] 0.088407 0.008651 0.000011 0.276714 0.056683 0.999 2
length{all}[16] 0.085973 0.008681 0.000168 0.246938 0.061452 1.003 2
length{all}[17] 0.097438 0.012251 0.000028 0.330006 0.057870 1.006 2
length{all}[18] 0.094169 0.008322 0.000498 0.273712 0.067364 0.998 2
length{all}[19] 0.094583 0.008558 0.000122 0.286333 0.065896 0.998 2
length{all}[20] 0.090452 0.009252 0.000067 0.262838 0.064194 1.005 2
length{all}[21] 0.095143 0.009331 0.000067 0.296175 0.062375 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004931
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------- C2 (2)
|
|---------------------------------------------- C3 (3)
+
|-------------------------------------------- C4 (4)
|
|------------------------------------------ C5 (5)
|
\--------------------------------------------- C6 (6)
|-------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 381
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 47 patterns at 127 / 127 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 47 patterns at 127 / 127 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
45872 bytes for conP
4136 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.019325 0.104058 0.012586 0.045038 0.018253 0.062935 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -538.769758
Iterating by ming2
Initial: fx= 538.769758
x= 0.01933 0.10406 0.01259 0.04504 0.01825 0.06294 0.30000 1.30000
1 h-m-p 0.0000 0.0001 287.8036 ++ 530.538192 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3518.1584 ++ 527.718976 m 0.0000 24 | 2/8
3 h-m-p 0.0005 0.0156 20.1398 -----------.. | 2/8
4 h-m-p 0.0000 0.0002 219.1426 +++ 517.961429 m 0.0002 56 | 3/8
5 h-m-p 0.0000 0.0000 3626.6953 ++ 513.490528 m 0.0000 67 | 4/8
6 h-m-p 0.0022 0.0209 8.2811 ------------.. | 4/8
7 h-m-p 0.0000 0.0003 240.5901 +YCYCCC 512.444258 5 0.0001 108 | 4/8
8 h-m-p 0.0000 0.0002 170.6948 ++ 508.543889 m 0.0002 119 | 5/8
9 h-m-p 0.0000 0.0201 4.3778 ++++YYYCYCCCC 507.919828 8 0.0123 146 | 5/8
10 h-m-p 0.3409 8.0000 0.1575 +++ 507.778222 m 8.0000 158 | 5/8
11 h-m-p 0.3045 1.5227 0.9983 ++ 507.673256 m 1.5227 172 | 6/8
12 h-m-p 1.4276 8.0000 1.0602 CC 507.660590 1 1.6131 188 | 6/8
13 h-m-p 0.8271 8.0000 2.0676 YCCC 507.643380 3 1.3461 204 | 6/8
14 h-m-p 1.6000 8.0000 1.2280 +YC 507.632400 1 4.0492 217 | 6/8
15 h-m-p 1.6000 8.0000 1.8989 YCC 507.626290 2 2.8809 231 | 6/8
16 h-m-p 1.6000 8.0000 2.8541 +YC 507.621196 1 4.0742 244 | 6/8
17 h-m-p 1.6000 8.0000 4.3415 YCC 507.618497 2 2.6550 258 | 6/8
18 h-m-p 1.6000 8.0000 6.2346 +YC 507.616171 1 4.3993 271 | 6/8
19 h-m-p 1.6000 8.0000 9.7630 YC 507.614979 1 2.5287 283 | 6/8
20 h-m-p 1.6000 8.0000 13.3797 +YC 507.613960 1 4.4907 296 | 6/8
21 h-m-p 1.6000 8.0000 22.0855 YC 507.613413 1 2.5254 308 | 6/8
22 h-m-p 1.6000 8.0000 29.8375 +YC 507.612959 1 4.4350 321 | 6/8
23 h-m-p 1.6000 8.0000 49.2523 YC 507.612711 1 2.5494 333 | 6/8
24 h-m-p 1.6000 8.0000 66.2028 +YC 507.612510 1 4.3504 346 | 6/8
25 h-m-p 0.4447 2.2235 109.2793 ++ 507.612398 m 2.2235 357 | 7/8
26 h-m-p 1.6000 8.0000 0.0000 Y 507.612393 0 0.9967 368 | 7/8
27 h-m-p 1.6000 8.0000 0.0000 -----C 507.612393 0 0.0004 385
Out..
lnL = -507.612393
386 lfun, 386 eigenQcodon, 2316 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.083733 0.105540 0.028425 0.035535 0.069994 0.043753 0.000100 0.796482 0.220219
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.740314
np = 9
lnL0 = -548.195260
Iterating by ming2
Initial: fx= 548.195260
x= 0.08373 0.10554 0.02843 0.03553 0.06999 0.04375 0.00011 0.79648 0.22022
1 h-m-p 0.0000 0.0000 271.5865 ++ 548.026641 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0003 396.8365 +++ 526.521378 m 0.0003 27 | 2/9
3 h-m-p 0.0000 0.0000 497.3515 ++ 523.302998 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 1244.5467 ++ 520.507853 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0001 441.9067 ++ 514.695138 m 0.0001 63 | 5/9
6 h-m-p 0.0000 0.0000 18856.7292 ++ 510.965103 m 0.0000 75 | 6/9
7 h-m-p 0.0007 0.0037 5.8590 ++ 510.592919 m 0.0037 87 | 6/9
8 h-m-p -0.0000 -0.0000 3.3196
h-m-p: -7.44056757e-20 -3.72028379e-19 3.31964166e+00 510.592919
.. | 6/9
9 h-m-p 0.0000 0.0004 94.1301 ++CYYCYYCCC 508.313570 8 0.0003 122 | 6/9
10 h-m-p 0.0126 0.3710 2.5289 ++YYC 507.928471 2 0.2404 138 | 6/9
11 h-m-p 0.1404 0.7018 0.3817 CYCC 507.868462 3 0.1593 155 | 6/9
12 h-m-p 0.5629 2.8144 0.0749 ++ 507.839233 m 2.8144 170 | 7/9
13 h-m-p 1.6000 8.0000 0.0011 CC 507.838844 1 1.3781 187 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 +Y 507.838844 0 6.7955 202 | 7/9
15 h-m-p 1.1132 8.0000 0.0000 ---N 507.838844 0 0.0022 219 | 7/9
16 h-m-p 0.0160 8.0000 0.0000 Y 507.838844 0 0.0040 233 | 7/9
17 h-m-p 0.0160 8.0000 0.0000 --Y 507.838844 0 0.0003 249
Out..
lnL = -507.838844
250 lfun, 750 eigenQcodon, 3000 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.087559 0.054604 0.058849 0.050507 0.065994 0.058175 0.000100 1.446482 0.541864 0.189935 1066.409230
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.082270
np = 11
lnL0 = -522.476852
Iterating by ming2
Initial: fx= 522.476852
x= 0.08756 0.05460 0.05885 0.05051 0.06599 0.05817 0.00011 1.44648 0.54186 0.18994 951.42857
1 h-m-p 0.0000 0.0000 34.9309 ++ 522.471670 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0245 17.1348 +++++ 517.285970 m 0.0245 33 | 2/11
3 h-m-p 0.0000 0.0001 215.8102 ++ 516.950405 m 0.0001 47 | 3/11
4 h-m-p 0.0003 0.0017 42.6628 ++ 516.444122 m 0.0017 61 | 4/11
5 h-m-p 0.0000 0.0000 999.2426 ++ 516.371115 m 0.0000 75 | 5/11
6 h-m-p 0.0001 0.0003 91.0715 ++ 516.150179 m 0.0003 89 | 6/11
7 h-m-p 0.0066 0.1975 3.3188 +++ 513.415344 m 0.1975 104 | 7/11
8 h-m-p 0.0208 3.3949 30.3651 YCYCCC 510.284746 5 0.0442 126 | 7/11
9 h-m-p 0.5808 2.9038 0.6017 +YYYCYYYCYY 507.512799 10 2.8143 153 | 7/11
10 h-m-p 0.0029 0.0146 3.6647 CCC 507.511032 2 0.0012 175 | 7/11
11 h-m-p 0.1565 8.0000 0.0289 +++ 507.490232 m 8.0000 190 | 7/11
12 h-m-p 0.0167 7.5544 13.9017 CYCCC 507.471226 4 0.0249 215 | 7/11
13 h-m-p 1.6000 8.0000 0.0030 CC 507.471051 1 2.0331 231 | 7/11
14 h-m-p 1.0039 8.0000 0.0060 Y 507.471049 0 0.5618 249 | 7/11
15 h-m-p 1.6000 8.0000 0.0001 C 507.471049 0 1.6313 267 | 7/11
16 h-m-p 1.1555 8.0000 0.0001 ++ 507.471049 m 8.0000 285 | 7/11
17 h-m-p 0.0160 8.0000 0.0711 +++Y 507.471046 0 2.0459 306 | 7/11
18 h-m-p 1.6000 8.0000 0.0736 ++ 507.471021 m 8.0000 324 | 7/11
19 h-m-p 0.0149 1.1926 39.6022 ++YCCYC 507.470645 4 0.3437 350 | 7/11
20 h-m-p 1.6000 8.0000 0.7513 Y 507.470637 0 1.0601 364 | 7/11
21 h-m-p 1.6000 8.0000 0.4039 C 507.470636 0 0.4518 382 | 7/11
22 h-m-p 1.6000 8.0000 0.0092 -C 507.470636 0 0.1090 401 | 7/11
23 h-m-p 1.6000 8.0000 0.0002 -----------C 507.470636 0 0.0000 430
Out..
lnL = -507.470636
431 lfun, 1724 eigenQcodon, 7758 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -508.038817 S = -506.005962 -2.533641
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:03
did 20 / 47 patterns 0:03
did 30 / 47 patterns 0:04
did 40 / 47 patterns 0:04
did 47 / 47 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.084328 0.083633 0.037000 0.076982 0.081352 0.016481 0.000100 0.705698 1.088456
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 17.366075
np = 9
lnL0 = -549.839963
Iterating by ming2
Initial: fx= 549.839963
x= 0.08433 0.08363 0.03700 0.07698 0.08135 0.01648 0.00011 0.70570 1.08846
1 h-m-p 0.0000 0.0000 272.0452 ++ 549.672239 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0011 89.0963 +++CYYCYYCCC 544.192592 8 0.0010 42 | 1/9
3 h-m-p 0.0017 0.0088 50.1151 ++ 530.903165 m 0.0088 54 | 2/9
4 h-m-p 0.0001 0.0006 59.2404 ++ 523.543701 m 0.0006 66 | 3/9
5 h-m-p 0.0021 0.0202 14.9812 +YYYCYCCCC 523.185374 8 0.0105 91 | 3/9
6 h-m-p 0.0275 0.1373 2.2086 --------------.. | 3/9
7 h-m-p 0.0000 0.0003 205.9386 +++ 510.139715 m 0.0003 128 | 4/9
8 h-m-p 0.0000 0.0000 6553.8478 ++ 509.995235 m 0.0000 140 | 5/9
9 h-m-p 0.0000 0.0000 332.4124 ++ 509.867196 m 0.0000 152 | 6/9
10 h-m-p 0.0028 1.3842 7.7274 ++++
QuantileBeta(0.85, 10.75458, 0.00500) = 1.000000e+00 2000 rounds
CYCCC 507.868049 4 0.5419 176 | 6/9
11 h-m-p 1.6000 8.0000 0.0462 ++ 507.850168 m 8.0000 188 | 6/9
12 h-m-p 0.0130 3.4738 28.4981 -------------.. | 6/9
13 h-m-p 0.0000 0.0019 4.4059 +YC 507.849518 1 0.0001 228 | 6/9
14 h-m-p 0.0101 5.0506 0.0473 ++++
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
+ 507.838844 m 5.0506 243
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26225, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26242, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26208, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
15 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.85, 4.26217, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26191, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
Y 507.838843 0 1.0036 258
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26237, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26203, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
16 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
C 507.838843 0 0.0016 276
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -507.838843
277 lfun, 3047 eigenQcodon, 16620 P(t)
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 4.26220, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.067042 0.049448 0.023839 0.079424 0.079798 0.102926 0.000100 0.900000 0.981175 1.953634 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.117925
np = 11
lnL0 = -518.916500
Iterating by ming2
Initial: fx= 518.916500
x= 0.06704 0.04945 0.02384 0.07942 0.07980 0.10293 0.00011 0.90000 0.98117 1.95363 951.42857
1 h-m-p 0.0000 0.0000 99.6409 ++ 518.876224 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0001 716.4947 +CYYYCYYYYC 512.334656 10 0.0001 44 | 1/11
3 h-m-p 0.0032 0.0160 11.1489 ++ 511.259400 m 0.0160 58 | 2/11
4 h-m-p 0.0052 0.0262 2.4092 ++ 510.454211 m 0.0262 72 | 3/11
5 h-m-p 0.0058 0.0289 3.7423 ++ 509.094012 m 0.0289 86 | 4/11
6 h-m-p 0.0060 0.0299 0.7730 ------------.. | 4/11
7 h-m-p 0.0000 0.0000 35.4541 ++ 509.089583 m 0.0000 131 | 5/11
8 h-m-p 0.0000 0.0111 15.3185 +YC 509.068288 1 0.0002 147 | 5/11
9 h-m-p 0.0046 0.2624 0.7106 ++YYYYCYCYC 509.024770 8 0.1392 175 | 5/11
10 h-m-p 0.0004 0.0019 47.0191 --C 509.024767 0 0.0000 197 | 5/11
11 h-m-p 0.4396 8.0000 0.0007 ----------------.. | 5/11
12 h-m-p 0.0000 0.0016 23.3600 ++++ 508.558261 m 0.0016 247 | 6/11
13 h-m-p 0.0015 0.0075 9.3631 +YYYYYC 508.190016 5 0.0058 267 | 6/11
14 h-m-p 0.1695 8.0000 0.3225 +YCCC 508.119414 3 0.4610 287 | 6/11
15 h-m-p 0.0842 2.5002 1.7652 +YYCCC 507.861858 4 0.5110 313 | 6/11
16 h-m-p 0.2174 1.0872 0.8215 +YYCYCCC 507.514531 6 0.7561 337 | 6/11
17 h-m-p 1.6000 8.0000 0.1375 YCCC 507.497360 3 2.7426 361 | 6/11
18 h-m-p 0.4458 2.2291 0.4360 YCC 507.493337 2 0.2807 383 | 6/11
19 h-m-p 1.6000 8.0000 0.0457 CY 507.492911 1 1.8426 404 | 6/11
20 h-m-p 1.6000 8.0000 0.0065 C 507.492860 0 2.1037 423 | 6/11
21 h-m-p 1.2742 8.0000 0.0108 ++ 507.492396 m 8.0000 442 | 6/11
22 h-m-p 0.0452 7.4396 1.9147 +++
QuantileBeta(0.15, 0.00500, 15.06680) = 1.414252e-161 2000 rounds
YC 507.484075 1 1.9049 465 | 6/11
23 h-m-p 1.4733 7.3664 0.8809 YCCC 507.475929 3 3.4218 484 | 6/11
24 h-m-p 0.4308 2.1539 2.2325 +
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
+ 507.471187 m 2.1539 503
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.822484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.19673) = 1.761008e-161 2000 rounds
| 7/11
25 h-m-p 1.6000 8.0000 0.8358
QuantileBeta(0.15, 0.00500, 10.85961) = 1.988080e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.84828) = 3.241728e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.29805) = 1.907435e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
C 507.470986 1 1.1226 518
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.981260e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25887) = 1.914374e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25827) = 1.914481e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25857) = 1.914428e-161 2000 rounds
| 7/11
26 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 11.25871) = 1.914404e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25911) = 1.914331e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
Y 507.470986 0 0.9575 536
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.981245e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25895) = 1.914360e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25835) = 1.914467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25865) = 1.914413e-161 2000 rounds
| 7/11
27 h-m-p 0.0272 8.0000 0.0036
QuantileBeta(0.15, 0.00500, 11.25875) = 1.914396e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.25905) = 1.914343e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.26024) = 1.914132e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.26499) = 1.913287e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.28401) = 1.909916e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.28776) = 1.909253e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
Y 507.470986 0 7.3336 558
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.976348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28563) = 1.909629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28503) = 1.909735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.28533) = 1.909682e-161 2000 rounds
| 7/11
28 h-m-p 0.8382 8.0000 0.0318
QuantileBeta(0.15, 0.00500, 11.31202) = 1.904973e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.39206) = 1.890987e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
+ 507.470985 m 8.0000 576
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.930799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54031) = 1.865618e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.53970) = 1.865721e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.54001) = 1.865669e-161 2000 rounds
| 7/11
29 h-m-p 0.0872 8.0000 2.9232
QuantileBeta(0.15, 0.00500, 11.79468) = 1.823639e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.55869) = 1.708189e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 15.61476) = 1.363008e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 27.83901) = 7.537091e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
Y 507.470981 0 2.3684 596
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.187178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46060) = 1.147132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.46059) = 1.147132e-161 2000 rounds
| 7/11
30 h-m-p 1.6000 8.0000 3.5120
QuantileBeta(0.15, 0.00500, 24.07743) = 8.739275e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.92796) = 4.106538e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
+ 507.470941 m 8.0000 610
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.728945e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54483) = 3.605643e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.54480) = 3.605645e-162 2000 rounds
| 7/11
31 h-m-p 0.0013 0.0063 8299.8726
QuantileBeta(0.15, 0.00500, 57.03584) = 7.428987e-163 2000 rounds
++ 507.470865 m 0.0063 624 | 7/11
32 h-m-p 0.0000 0.0000 28932.7568
h-m-p: 0.00000000e+00 0.00000000e+00 2.89327568e+04 507.470865
.. | 7/11
33 h-m-p 0.0001 0.0605 0.1994 Y 507.470859 0 0.0003 649 | 8/11
34 h-m-p 0.0160 8.0000 0.0355 -Y 507.470859 0 0.0008 668 | 8/11
35 h-m-p 0.5626 8.0000 0.0001 +C 507.470859 0 2.8123 686 | 8/11
36 h-m-p 0.5907 8.0000 0.0002 ++ 507.470859 m 8.0000 703 | 8/11
37 h-m-p 0.5358 8.0000 0.0036 ++ 507.470858 m 8.0000 720 | 8/11
38 h-m-p 1.6000 8.0000 0.0174 ++ 507.470851 m 8.0000 737 | 8/11
39 h-m-p 0.0080 2.5529 17.5219 ++++YC 507.470041 1 1.7184 759 | 8/11
40 h-m-p 0.1701 0.8505 17.1912 ++ 507.469329 m 0.8505 773 | 9/11
41 h-m-p 0.0160 8.0000 0.0012 ++YC 507.468840 1 0.4698 790 | 9/11
42 h-m-p 1.6000 8.0000 0.0001 +YC 507.468703 1 4.1506 808 | 9/11
43 h-m-p 1.6000 8.0000 0.0000 Y 507.468702 0 1.0586 824 | 9/11
44 h-m-p 1.6000 8.0000 0.0000 Y 507.468702 0 0.6549 840
Out..
lnL = -507.468702
841 lfun, 10092 eigenQcodon, 55506 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -507.972910 S = -506.028468 -2.227377
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 47 patterns 0:28
did 20 / 47 patterns 0:28
did 30 / 47 patterns 0:28
did 40 / 47 patterns 0:28
did 47 / 47 patterns 0:28
Time used: 0:28
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=127
NC_011896_1_WP_012634438_1_1981_MLBR_RS09400 MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK
NC_002677_1_NP_302256_1_1128_rpsQ MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK
*********************** **************************
NC_011896_1_WP_012634438_1_1981_MLBR_RS09400 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
NC_002677_1_NP_302256_1_1128_rpsQ MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470 MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG
**************************************************
NC_011896_1_WP_012634438_1_1981_MLBR_RS09400 DRVSLMETRPLSATKRWRLVEILEKAK
NC_002677_1_NP_302256_1_1128_rpsQ DRVSLMETRPLSATKRWRLVEILEKAK
NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615 DRVSLMETRPLSATKRWRLVEILEKAK
NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235 DRVSLMETRPLSATKRWRLVEILEKAK
NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200 DRVSLMETRPLSATKRWRLVEILEKAK
NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470 DRVSLMETRPLSATKRWRLVEILEKAK
***************************
>NC_011896_1_WP_012634438_1_1981_MLBR_RS09400 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC CACAGCCGCTCCTAAGGGAGTAGCTGTCAAGGGTGGCGTATCAAAAGACA AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG >NC_002677_1_NP_302256_1_1128_rpsQ ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG >NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG >NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG >NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG >NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470 ATGATGGCAGCAGAAGCTAAGACCAGCGCTAAGGCAGCGCCCTCGGCAAC CACAGCCGCTCCTAAGGGAGGAGCTGTCAAGGGTGGCGTATCAAAAGACA AGGGTCCCAAGCACACTCCGAGTATTCCGAAGGTACGTGGGGGACGTAAA ATGCGCATTGGCTATGTAGTGAGCGACAAGATGCAGAAGACCATTGTGGT TGAACTGGAAGACCGCATGCGCCATCCCTTGTACGGCAAGATCATTCGTA CCACCAAGAAGGTCAAGGCGCACGACGAGAACAGCGTTGCGGGCATTGGT GATCGTGTTTCGCTGATGGAGACGCGGCCTCTATCGGCGACCAAACGGTG GCGGCTGGTGGAGATCCTCGAAAAGGCCAAG
>NC_011896_1_WP_012634438_1_1981_MLBR_RS09400 MMAAEAKTSAKAAPSATTAAPKGVAVKGGVSKDKGPKHTPSIPKVRGGRK MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG DRVSLMETRPLSATKRWRLVEILEKAK >NC_002677_1_NP_302256_1_1128_rpsQ MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG DRVSLMETRPLSATKRWRLVEILEKAK >NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG DRVSLMETRPLSATKRWRLVEILEKAK >NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG DRVSLMETRPLSATKRWRLVEILEKAK >NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG DRVSLMETRPLSATKRWRLVEILEKAK >NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470 MMAAEAKTSAKAAPSATTAAPKGGAVKGGVSKDKGPKHTPSIPKVRGGRK MRIGYVVSDKMQKTIVVELEDRMRHPLYGKIIRTTKKVKAHDENSVAGIG DRVSLMETRPLSATKRWRLVEILEKAK
#NEXUS
[ID: 0729204141]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_012634438_1_1981_MLBR_RS09400
NC_002677_1_NP_302256_1_1128_rpsQ
NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615
NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235
NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200
NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470
;
end;
begin trees;
translate
1 NC_011896_1_WP_012634438_1_1981_MLBR_RS09400,
2 NC_002677_1_NP_302256_1_1128_rpsQ,
3 NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615,
4 NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235,
5 NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200,
6 NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.09961038,2:0.06134346,3:0.0632924,4:0.06066693,5:0.05878053,6:0.06223745);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.09961038,2:0.06134346,3:0.0632924,4:0.06066693,5:0.05878053,6:0.06223745);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -532.34 -535.40
2 -532.30 -536.54
--------------------------------------
TOTAL -532.32 -536.12
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsQ/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.864628 0.085718 0.362501 1.478783 0.834164 1460.78 1480.89 1.000
r(A<->C){all} 0.156066 0.017462 0.000011 0.420224 0.124690 364.48 378.17 1.003
r(A<->G){all} 0.152770 0.018554 0.000002 0.429607 0.114033 281.91 299.65 1.002
r(A<->T){all} 0.166205 0.019661 0.000011 0.447319 0.133537 166.04 202.97 1.003
r(C<->G){all} 0.156334 0.020457 0.000028 0.468683 0.114950 234.46 238.86 1.001
r(C<->T){all} 0.161201 0.022549 0.000116 0.481651 0.113170 154.01 171.12 1.000
r(G<->T){all} 0.207425 0.023196 0.000225 0.498694 0.176712 177.05 264.00 1.006
pi(A){all} 0.265231 0.000498 0.222645 0.308772 0.264508 1302.04 1375.08 1.000
pi(C){all} 0.244884 0.000470 0.201856 0.286048 0.244475 1261.73 1381.36 1.000
pi(G){all} 0.320028 0.000565 0.272011 0.364057 0.319839 1194.70 1347.85 1.000
pi(T){all} 0.169857 0.000374 0.132730 0.207325 0.169341 1196.51 1250.12 1.000
alpha{1,2} 0.349867 0.161262 0.000595 1.129292 0.221040 1273.35 1328.41 1.000
alpha{3} 0.400992 0.217771 0.000135 1.376451 0.233324 1180.95 1256.15 1.000
pinvar{all} 0.990688 0.000063 0.975490 0.999851 0.992888 1468.14 1484.57 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/rpsQ/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 127
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 2 2 2 2 2 2 | His CAT 1 1 1 1 1 1 | Arg CGT 4 4 4 4 4 4
CTC 1 1 1 1 1 1 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 3 3 3 3 3 3
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 3 3 3 3 3 3 | CCG 2 2 2 2 2 2 | CAG 1 1 1 1 1 1 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 5 5 5 5 5 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 2 2 2 2 2 2 | ACC 6 6 6 6 6 6 | AAC 1 1 1 1 1 1 | AGC 3 3 3 3 3 3
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 1 1 1 1 1 1 | AAG 15 15 15 15 15 15 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 4 4 4 4 4 4 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 4 4 4 4 4 4 | GGC 4 4 4 4 4 4
GTA 4 3 3 3 3 3 | GCA 4 4 4 4 4 4 | Glu GAA 4 4 4 4 4 4 | GGA 2 3 3 3 3 3
GTG 3 3 3 3 3 3 | GCG 4 4 4 4 4 4 | GAG 3 3 3 3 3 3 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_012634438_1_1981_MLBR_RS09400
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.24409 C:0.26772 A:0.29134 G:0.19685
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.17060 C:0.24672 A:0.26772 G:0.31496
#2: NC_002677_1_NP_302256_1_1128_rpsQ
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.23622 C:0.26772 A:0.29134 G:0.20472
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.16798 C:0.24672 A:0.26772 G:0.31759
#3: NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.23622 C:0.26772 A:0.29134 G:0.20472
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.16798 C:0.24672 A:0.26772 G:0.31759
#4: NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.23622 C:0.26772 A:0.29134 G:0.20472
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.16798 C:0.24672 A:0.26772 G:0.31759
#5: NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.23622 C:0.26772 A:0.29134 G:0.20472
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.16798 C:0.24672 A:0.26772 G:0.31759
#6: NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.23622 C:0.26772 A:0.29134 G:0.20472
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.16798 C:0.24672 A:0.26772 G:0.31759
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 18 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 12 | His H CAT 6 | Arg R CGT 24
CTC 6 | CCC 18 | CAC 12 | CGC 18
CTA 6 | CCA 0 | Gln Q CAA 0 | CGA 0
CTG 18 | CCG 12 | CAG 6 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 30 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 12 | ACC 36 | AAC 6 | AGC 18
ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 36 | ACG 6 | AAG 90 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 24 | Asp D GAT 6 | Gly G GGT 18
GTC 12 | GCC 12 | GAC 24 | GGC 24
GTA 19 | GCA 24 | Glu E GAA 24 | GGA 17
GTG 18 | GCG 24 | GAG 18 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.06299 C:0.20472 A:0.35433 G:0.37795
position 2: T:0.23753 C:0.26772 A:0.29134 G:0.20341
position 3: T:0.20472 C:0.26772 A:0.15748 G:0.37008
Average T:0.16842 C:0.24672 A:0.26772 G:0.31715
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -507.612393 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.007973 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.007993
(1: 0.007973, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634438_1_1981_MLBR_RS09400: 0.007973, NC_002677_1_NP_302256_1_1128_rpsQ: 0.000004, NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615: 0.000004, NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235: 0.000004, NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200: 0.000004, NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.008 303.0 78.0 999.0000 0.0033 0.0000 1.0 0.0
7..2 0.000 303.0 78.0 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 303.0 78.0 999.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 303.0 78.0 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 303.0 78.0 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 303.0 78.0 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0033
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -507.838844 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.007988 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.323821
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008008
(1: 0.007988, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634438_1_1981_MLBR_RS09400: 0.007988, NC_002677_1_NP_302256_1_1128_rpsQ: 0.000004, NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615: 0.000004, NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235: 0.000004, NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200: 0.000004, NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.32382 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.008 303.0 78.0 1.0000 0.0027 0.0027 0.8 0.2
7..2 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -507.470636 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.017353 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.976379 0.011746 0.000001 966.270259
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.017373
(1: 0.017353, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634438_1_1981_MLBR_RS09400: 0.017353, NC_002677_1_NP_302256_1_1128_rpsQ: 0.000004, NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615: 0.000004, NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235: 0.000004, NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200: 0.000004, NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.97638 0.01175 0.01188
w: 0.00000 1.00000 966.27026
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.017 303.0 78.0 11.4864 0.0071 0.0006 2.2 0.0
7..2 0.000 303.0 78.0 11.4864 0.0000 0.0000 0.0 0.0
7..3 0.000 303.0 78.0 11.4864 0.0000 0.0000 0.0 0.0
7..4 0.000 303.0 78.0 11.4864 0.0000 0.0000 0.0 0.0
7..5 0.000 303.0 78.0 11.4864 0.0000 0.0000 0.0 0.0
7..6 0.000 303.0 78.0 11.4864 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634438_1_1981_MLBR_RS09400)
Pr(w>1) post mean +- SE for w
24 V 0.998** 964.520
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634438_1_1981_MLBR_RS09400)
Pr(w>1) post mean +- SE for w
24 V 0.743 5.298 +- 3.455
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.096 0.097 0.098 0.100 0.101 0.102 0.103 0.104 0.105
w2: 0.061 0.075 0.087 0.096 0.103 0.109 0.113 0.117 0.119 0.120
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.007
0.009 0.008 0.007
0.010 0.009 0.009 0.007 0.006
0.011 0.011 0.010 0.009 0.008 0.007 0.006
0.012 0.012 0.011 0.011 0.010 0.009 0.008 0.007 0.006
0.013 0.012 0.012 0.012 0.011 0.010 0.010 0.009 0.008 0.007 0.006
0.013 0.013 0.013 0.012 0.012 0.011 0.011 0.010 0.010 0.009 0.008 0.006 0.005
0.013 0.013 0.013 0.013 0.012 0.012 0.012 0.011 0.011 0.010 0.009 0.008 0.008 0.006 0.005
0.013 0.013 0.013 0.013 0.013 0.013 0.012 0.012 0.012 0.011 0.011 0.010 0.009 0.008 0.007 0.006 0.005
0.013 0.013 0.013 0.013 0.013 0.013 0.013 0.012 0.012 0.012 0.012 0.011 0.011 0.010 0.009 0.008 0.007 0.006 0.004
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -507.838843 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.007988 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 4.262198 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.008008
(1: 0.007988, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634438_1_1981_MLBR_RS09400: 0.007988, NC_002677_1_NP_302256_1_1128_rpsQ: 0.000004, NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615: 0.000004, NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235: 0.000004, NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200: 0.000004, NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 4.26220 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.008 303.0 78.0 1.0000 0.0027 0.0027 0.8 0.2
7..2 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 303.0 78.0 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -507.468702 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.017461 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.988141 0.005000 99.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.017481
(1: 0.017461, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_012634438_1_1981_MLBR_RS09400: 0.017461, NC_002677_1_NP_302256_1_1128_rpsQ: 0.000004, NZ_LVXE01000034_1_WP_010908577_1_1554_A3216_RS09615: 0.000004, NZ_LYPH01000037_1_WP_010908577_1_1510_A8144_RS07235: 0.000004, NZ_CP029543_1_WP_010908577_1_2004_DIJ64_RS10200: 0.000004, NZ_AP014567_1_WP_010908577_1_2058_JK2ML_RS10470: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.98814 p = 0.00500 q = 99.00000
(p1 = 0.01186) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.09881 0.09881 0.09881 0.09881 0.09881 0.09881 0.09881 0.09881 0.09881 0.09881 0.01186
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.017 303.0 78.0 11.8468 0.0072 0.0006 2.2 0.0
7..2 0.000 303.0 78.0 11.8468 0.0000 0.0000 0.0 0.0
7..3 0.000 303.0 78.0 11.8468 0.0000 0.0000 0.0 0.0
7..4 0.000 303.0 78.0 11.8468 0.0000 0.0000 0.0 0.0
7..5 0.000 303.0 78.0 11.8468 0.0000 0.0000 0.0 0.0
7..6 0.000 303.0 78.0 11.8468 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634438_1_1981_MLBR_RS09400)
Pr(w>1) post mean +- SE for w
24 V 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634438_1_1981_MLBR_RS09400)
Pr(w>1) post mean +- SE for w
1 M 0.561 3.835 +- 3.575
2 M 0.561 3.835 +- 3.575
3 A 0.563 3.846 +- 3.577
4 A 0.563 3.846 +- 3.577
5 E 0.562 3.839 +- 3.576
6 A 0.563 3.844 +- 3.577
7 K 0.561 3.833 +- 3.575
8 T 0.562 3.842 +- 3.576
9 S 0.562 3.838 +- 3.576
10 A 0.563 3.844 +- 3.577
11 K 0.561 3.833 +- 3.575
12 A 0.563 3.846 +- 3.577
13 A 0.562 3.839 +- 3.576
14 P 0.562 3.841 +- 3.576
15 S 0.562 3.841 +- 3.576
16 A 0.563 3.846 +- 3.577
17 T 0.562 3.842 +- 3.576
18 T 0.563 3.846 +- 3.577
19 A 0.562 3.842 +- 3.576
20 A 0.563 3.844 +- 3.577
21 P 0.562 3.843 +- 3.576
22 K 0.561 3.833 +- 3.575
23 G 0.563 3.846 +- 3.577
24 V 0.886 5.962 +- 3.141
25 A 0.563 3.844 +- 3.577
26 V 0.562 3.842 +- 3.576
27 K 0.561 3.833 +- 3.575
28 G 0.563 3.844 +- 3.577
29 G 0.562 3.842 +- 3.576
30 V 0.563 3.846 +- 3.577
31 S 0.563 3.847 +- 3.577
32 K 0.562 3.840 +- 3.576
33 D 0.561 3.834 +- 3.575
34 K 0.561 3.833 +- 3.575
35 G 0.563 3.844 +- 3.577
36 P 0.562 3.841 +- 3.576
37 K 0.561 3.833 +- 3.575
38 H 0.562 3.836 +- 3.575
39 T 0.563 3.844 +- 3.577
40 P 0.562 3.837 +- 3.575
41 S 0.562 3.840 +- 3.576
42 I 0.562 3.841 +- 3.576
43 P 0.562 3.837 +- 3.575
44 K 0.561 3.833 +- 3.575
45 V 0.563 3.846 +- 3.577
46 R 0.563 3.844 +- 3.577
47 G 0.562 3.839 +- 3.576
48 G 0.563 3.846 +- 3.577
49 R 0.563 3.844 +- 3.577
50 K 0.562 3.840 +- 3.576
51 M 0.561 3.835 +- 3.575
52 R 0.562 3.842 +- 3.576
53 I 0.562 3.841 +- 3.576
54 G 0.562 3.842 +- 3.576
55 Y 0.563 3.844 +- 3.577
56 V 0.563 3.846 +- 3.577
57 V 0.562 3.839 +- 3.576
58 S 0.562 3.838 +- 3.576
59 D 0.561 3.834 +- 3.575
60 K 0.561 3.833 +- 3.575
61 M 0.561 3.835 +- 3.575
62 Q 0.561 3.832 +- 3.575
63 K 0.561 3.833 +- 3.575
64 T 0.562 3.842 +- 3.576
65 I 0.562 3.841 +- 3.576
66 V 0.562 3.839 +- 3.576
67 V 0.563 3.844 +- 3.577
68 E 0.562 3.839 +- 3.576
69 L 0.562 3.838 +- 3.576
70 E 0.562 3.839 +- 3.576
71 D 0.561 3.834 +- 3.575
72 R 0.562 3.842 +- 3.576
73 M 0.561 3.835 +- 3.575
74 R 0.562 3.842 +- 3.576
75 H 0.562 3.839 +- 3.576
76 P 0.562 3.841 +- 3.576
77 L 0.562 3.841 +- 3.576
78 Y 0.562 3.842 +- 3.576
79 G 0.562 3.842 +- 3.576
80 K 0.561 3.833 +- 3.575
81 I 0.562 3.839 +- 3.576
82 I 0.562 3.841 +- 3.576
83 R 0.563 3.844 +- 3.577
84 T 0.562 3.842 +- 3.576
85 T 0.562 3.842 +- 3.576
86 K 0.561 3.833 +- 3.575
87 K 0.561 3.833 +- 3.575
88 V 0.562 3.842 +- 3.576
89 K 0.561 3.833 +- 3.575
90 A 0.562 3.839 +- 3.576
91 H 0.562 3.836 +- 3.575
92 D 0.561 3.834 +- 3.575
93 E 0.561 3.832 +- 3.575
94 N 0.561 3.835 +- 3.575
95 S 0.562 3.838 +- 3.576
96 V 0.563 3.844 +- 3.577
97 A 0.562 3.839 +- 3.576
98 G 0.562 3.842 +- 3.576
99 I 0.562 3.841 +- 3.576
100 G 0.563 3.844 +- 3.577
101 D 0.562 3.836 +- 3.575
102 R 0.563 3.844 +- 3.577
103 V 0.563 3.844 +- 3.577
104 S 0.562 3.841 +- 3.576
105 L 0.562 3.838 +- 3.576
106 M 0.561 3.835 +- 3.575
107 E 0.561 3.832 +- 3.575
108 T 0.562 3.839 +- 3.576
109 R 0.562 3.842 +- 3.576
110 P 0.562 3.843 +- 3.576
111 L 0.563 3.845 +- 3.577
112 S 0.562 3.841 +- 3.576
113 A 0.562 3.839 +- 3.576
114 T 0.562 3.842 +- 3.576
115 K 0.562 3.840 +- 3.576
116 R 0.562 3.842 +- 3.576
117 W 0.562 3.842 +- 3.576
118 R 0.562 3.842 +- 3.576
119 L 0.562 3.838 +- 3.576
120 V 0.562 3.839 +- 3.576
121 E 0.561 3.832 +- 3.575
122 I 0.562 3.839 +- 3.576
123 L 0.562 3.841 +- 3.576
124 E 0.562 3.839 +- 3.576
125 K 0.561 3.833 +- 3.575
126 A 0.562 3.842 +- 3.576
127 K 0.561 3.833 +- 3.575
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.120 0.120 0.120 0.118 0.114 0.108 0.099 0.086 0.068 0.045
p : 0.095 0.097 0.099 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.101 0.100 0.099 0.099 0.098 0.098 0.097
ws: 0.055 0.074 0.089 0.099 0.107 0.112 0.115 0.116 0.117 0.116
Time used: 0:28
Model 1: NearlyNeutral -507.838844 Model 2: PositiveSelection -507.470636 Model 0: one-ratio -507.612393 Model 7: beta -507.838843 Model 8: beta&w>1 -507.468702 Model 0 vs 1 0.4529019999999946 Model 2 vs 1 0.7364159999999629 Model 8 vs 7 0.7402819999999792
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
