--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:14:54 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sahH/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -2019.49         -2022.52
2      -2019.49         -2023.30
--------------------------------------
TOTAL    -2019.49         -2022.98
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.889914    0.091402    0.364807    1.479796    0.852852   1464.57   1482.79    1.000
r(A<->C){all}   0.164694    0.018618    0.000041    0.433065    0.130770    212.93    262.43    1.000
r(A<->G){all}   0.169818    0.020602    0.000081    0.458501    0.136174    303.20    310.23    1.000
r(A<->T){all}   0.172459    0.021618    0.000001    0.466750    0.131375    134.00    246.29    1.000
r(C<->G){all}   0.162827    0.019882    0.000196    0.459450    0.126220    240.88    288.29    1.000
r(C<->T){all}   0.166976    0.019730    0.000180    0.433394    0.128414    186.09    271.78    1.002
r(G<->T){all}   0.163225    0.018874    0.000028    0.442290    0.126879    226.53    236.61    1.003
pi(A){all}      0.222092    0.000114    0.201750    0.243632    0.222087   1060.48   1194.90    1.000
pi(C){all}      0.282959    0.000137    0.260213    0.305654    0.282575   1107.71   1181.69    1.000
pi(G){all}      0.309028    0.000144    0.284728    0.331354    0.308944   1243.33   1243.92    1.000
pi(T){all}      0.185921    0.000103    0.166484    0.205380    0.185983   1036.27   1132.00    1.000
alpha{1,2}      0.430859    0.239406    0.000101    1.414029    0.254137   1147.91   1201.75    1.000
alpha{3}        0.468867    0.278739    0.000107    1.443251    0.302613    852.12   1102.35    1.000
pinvar{all}     0.998970    0.000001    0.996754    0.999999    0.999342    960.03   1097.83    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1894.200459
Model 2: PositiveSelection	-1894.200459
Model 0: one-ratio	-1894.201052
Model 7: beta	-1894.200459
Model 8: beta&w>1	-1894.200559


Model 0 vs 1	0.0011859999999614956

Model 2 vs 1	0.0

Model 8 vs 7	2.0000000040454324E-4
>C1
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C2
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C3
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C4
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C5
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C6
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=492 

C1              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C2              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C3              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C4              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C5              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C6              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
                **************************************************

C1              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C2              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C3              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C4              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C5              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C6              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
                **************************************************

C1              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C2              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C3              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C4              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C5              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C6              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
                **************************************************

C1              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C2              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C3              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C4              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C5              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C6              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
                **************************************************

C1              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C2              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C3              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C4              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C5              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C6              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
                **************************************************

C1              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C2              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C3              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C4              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C5              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C6              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
                **************************************************

C1              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C2              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C3              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C4              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C5              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C6              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
                **************************************************

C1              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C2              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C3              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C4              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C5              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C6              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
                **************************************************

C1              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C2              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C3              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C4              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C5              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C6              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
                **************************************************

C1              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C2              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C3              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C4              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C5              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C6              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
                ******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  492 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  492 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [14760]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [14760]--->[14760]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.548 Mb, Max= 31.079 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C2              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C3              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C4              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C5              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
C6              MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
                **************************************************

C1              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C2              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C3              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C4              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C5              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
C6              AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
                **************************************************

C1              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C2              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C3              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C4              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C5              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
C6              AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
                **************************************************

C1              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C2              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C3              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C4              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C5              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
C6              LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
                **************************************************

C1              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C2              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C3              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C4              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C5              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
C6              KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
                **************************************************

C1              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C2              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C3              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C4              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C5              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
C6              KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
                **************************************************

C1              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C2              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C3              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C4              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C5              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
C6              TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
                **************************************************

C1              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C2              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C3              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C4              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C5              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
C6              DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
                **************************************************

C1              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C2              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C3              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C4              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C5              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
C6              EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
                **************************************************

C1              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C2              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C3              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C4              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C5              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
C6              DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
                ******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
C2              ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
C3              ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
C4              ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
C5              ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
C6              ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
                **************************************************

C1              CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
C2              CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
C3              CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
C4              CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
C5              CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
C6              CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
                **************************************************

C1              ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
C2              ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
C3              ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
C4              ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
C5              ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
C6              ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
                **************************************************

C1              GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
C2              GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
C3              GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
C4              GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
C5              GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
C6              GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
                **************************************************

C1              GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
C2              GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
C3              GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
C4              GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
C5              GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
C6              GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
                **************************************************

C1              AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
C2              AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
C3              AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
C4              AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
C5              AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
C6              AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
                **************************************************

C1              GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
C2              GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
C3              GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
C4              GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
C5              GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
C6              GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
                **************************************************

C1              ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
C2              ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
C3              ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
C4              ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
C5              ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
C6              ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
                **************************************************

C1              CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
C2              CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
C3              CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
C4              CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
C5              CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
C6              CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
                **************************************************

C1              CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
C2              CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
C3              CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
C4              CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
C5              CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
C6              CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
                **************************************************

C1              CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
C2              CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
C3              CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
C4              CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
C5              CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
C6              CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
                **************************************************

C1              GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
C2              GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
C3              GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
C4              GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
C5              GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
C6              GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
                **************************************************

C1              AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
C2              AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
C3              AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
C4              AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
C5              AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
C6              AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
                **************************************************

C1              CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
C2              CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
C3              CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
C4              CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
C5              CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
C6              CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
                **************************************************

C1              TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
C2              TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
C3              TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
C4              TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
C5              TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
C6              TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
                **************************************************

C1              AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
C2              AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
C3              AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
C4              AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
C5              AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
C6              AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
                **************************************************

C1              CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
C2              CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
C3              CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
C4              CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
C5              CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
C6              CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
                **************************************************

C1              GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
C2              GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
C3              GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
C4              GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
C5              GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
C6              GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
                **************************************************

C1              ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
C2              ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
C3              ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
C4              ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
C5              ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
C6              ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
                **************************************************

C1              CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
C2              CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
C3              CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
C4              CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
C5              CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
C6              CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
                **************************************************

C1              CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
C2              CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
C3              CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
C4              CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
C5              CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
C6              CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
                **************************************************

C1              GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
C2              GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
C3              GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
C4              GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
C5              GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
C6              GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
                **************************************************

C1              GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
C2              GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
C3              GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
C4              GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
C5              GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
C6              GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
                **************************************************

C1              TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
C2              TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
C3              TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
C4              TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
C5              TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
C6              TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
                **************************************************

C1              GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
C2              GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
C3              GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
C4              GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
C5              GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
C6              GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
                **************************************************

C1              GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
C2              GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
C3              GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
C4              GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
C5              GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
C6              GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
                **************************************************

C1              CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
C2              CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
C3              CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
C4              CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
C5              CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
C6              CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
                **************************************************

C1              GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
C2              GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
C3              GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
C4              GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
C5              GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
C6              GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
                **************************************************

C1              CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
C2              CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
C3              CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
C4              CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
C5              CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
C6              CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
                **************************************************

C1              CGTTCAAGCCGGACCACTATCGCTAC
C2              CGTTCAAGCCGGACCACTATCGCTAC
C3              CGTTCAAGCCGGACCACTATCGCTAC
C4              CGTTCAAGCCGGACCACTATCGCTAC
C5              CGTTCAAGCCGGACCACTATCGCTAC
C6              CGTTCAAGCCGGACCACTATCGCTAC
                **************************



>C1
ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
CGTTCAAGCCGGACCACTATCGCTAC
>C2
ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
CGTTCAAGCCGGACCACTATCGCTAC
>C3
ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
CGTTCAAGCCGGACCACTATCGCTAC
>C4
ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
CGTTCAAGCCGGACCACTATCGCTAC
>C5
ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
CGTTCAAGCCGGACCACTATCGCTAC
>C6
ATGACGACGACCGAAAATTCGCTGATGCCTGATGTTCGTAACGGCATCGA
CTTCAAGGTTGCTGACCTGTCGCTAGCGAATTTCGGCCGCAAAGAACTCG
ACCTCGCCGAGTACGAGATGCCTGGCCTGATGTCACTGCGTCATGAGTAC
GCCGAAGTGCAGCCCTTGAAAGGGGCCCGTATTTCCGGCTCGCTGCACAT
GACGGTGCAGACCGCGGTGCTGATCGAGACGTTAACTGCACTTGGCGCCG
AGGTTCGCTGGGCATCGTGCAATATCTTCTCGACTCAGGACCATGCGGCA
GCGGCAGTTGTCGTTGGCCCATACGGCACGCCCGAGGAGCCCAAGGGTGT
ACCGGTGTTCGCCTGGAAGGGCGAGACGCTCGAGGAGTATTGGTGGGCTG
CCGAGCAGATGCTCACCTGGCCAGATCCCGATAAGCCGGTCAACATGATC
CTGGATGACGGCGGGGATGCCACCATGCTGGTGCTGCGAGGCGTGCAGTA
CGAGAAAGCCGGCGTAGTGCCGCCTGCCGAGGTCGACGACTCCGCCGAGT
GGAAAGTTTTTCTGAACCTGCTGCGGAAGCGCTTCGAGACTGACAAAGGC
AAATGGACCAAGATCGCCAAGTCGGTCAAGGGTGTCACCGAGGAGACGAC
CACGGGCGTGCTGCGACTGTACCAATTCGCCGCGGCCGGGGATCTGGCCT
TCCCCGCGATCAATGTCAACGACTCGGTGACCAAGTCCAAGTTCGACAAC
AAGTACGGCACTCGACACTCCCTGATCGACGGCATCAACCGTGGTACCGA
CTCCCTAATTGGGGGCAAGAACGTGCTCATTTGTGGCTACGGGGATGTAG
GTAAGGGGTGCGCGGAGGCGGCGAAGGGTCAGGGTGCGCGGGTCACTATC
ACCGAGATCGACCCGATTAACGCGCTGCAGGCGCTGATGGAGGGCTTCGA
CGTCAAGCGGGTCGAGGACGTCATCGCTGATTCAGACATCGTCGTCACCG
CGACCGGCAACAAGGACATCATTCTACTTGAGCACATGAAGGCAATGAAG
GATCACGCCATCCTGGGCAACATTGGCCATTTTGACAACGAAATCGACAT
GGCGGCGCTGGAACGTTCCGGGGCGACGCGGCTCAACATCAAACCGCAGG
TTGATCTGTGGACTTTCGGCGACAGCGGTAAGTCGATCATTGTGCTTTCC
GAAGGCCGGCTGCTGAACCTGGGCAACGCCACCGGTCATCCGTCGTTTGT
GATGAGTAATAGTTTCGCTAACCAGACTATCGCCCAGATCGAGCTGTGGA
CCAAAAACGACGACTATGACAATGAGGTGTATAGGCTCCCCAAGCACCTC
GACGAAAAAGTGGCCCGCGTCCACGTCGAGGCCCTGGGCGGCCAGCTGAC
CAAGCTGACCAAGGACCAGGCCGAATACCTCGGTGTCGACGTCGACGGCC
CGTTCAAGCCGGACCACTATCGCTAC
>C1
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C2
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C3
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C4
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C5
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY
>C6
MTTTENSLMPDVRNGIDFKVADLSLANFGRKELDLAEYEMPGLMSLRHEY
AEVQPLKGARISGSLHMTVQTAVLIETLTALGAEVRWASCNIFSTQDHAA
AAVVVGPYGTPEEPKGVPVFAWKGETLEEYWWAAEQMLTWPDPDKPVNMI
LDDGGDATMLVLRGVQYEKAGVVPPAEVDDSAEWKVFLNLLRKRFETDKG
KWTKIAKSVKGVTEETTTGVLRLYQFAAAGDLAFPAINVNDSVTKSKFDN
KYGTRHSLIDGINRGTDSLIGGKNVLICGYGDVGKGCAEAAKGQGARVTI
TEIDPINALQALMEGFDVKRVEDVIADSDIVVTATGNKDIILLEHMKAMK
DHAILGNIGHFDNEIDMAALERSGATRLNIKPQVDLWTFGDSGKSIIVLS
EGRLLNLGNATGHPSFVMSNSFANQTIAQIELWTKNDDYDNEVYRLPKHL
DEKVARVHVEALGGQLTKLTKDQAEYLGVDVDGPFKPDHYRY


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1476 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788811
      Setting output file names to "/data/12res/sahH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1539904866
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0955563827
      Seed = 2092227332
      Swapseed = 1579788811
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3303.358260 -- -24.965149
         Chain 2 -- -3303.358574 -- -24.965149
         Chain 3 -- -3303.358763 -- -24.965149
         Chain 4 -- -3303.358763 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3303.358763 -- -24.965149
         Chain 2 -- -3303.358763 -- -24.965149
         Chain 3 -- -3303.358574 -- -24.965149
         Chain 4 -- -3303.358763 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3303.358] (-3303.359) (-3303.359) (-3303.359) * [-3303.359] (-3303.359) (-3303.359) (-3303.359) 
        500 -- (-2053.946) [-2030.632] (-2043.404) (-2047.850) * [-2032.158] (-2049.601) (-2025.272) (-2025.347) -- 0:00:00
       1000 -- (-2029.654) (-2037.591) [-2033.044] (-2030.225) * (-2033.111) [-2030.562] (-2031.447) (-2030.230) -- 0:00:00
       1500 -- (-2026.869) (-2038.441) (-2025.668) [-2025.133] * (-2026.287) [-2027.754] (-2025.352) (-2030.971) -- 0:00:00
       2000 -- (-2023.217) (-2025.869) (-2030.015) [-2031.476] * (-2035.419) (-2031.938) [-2024.253] (-2042.460) -- 0:00:00
       2500 -- (-2027.903) (-2028.606) (-2027.094) [-2029.042] * [-2028.001] (-2033.552) (-2038.782) (-2029.793) -- 0:00:00
       3000 -- (-2028.928) (-2027.752) (-2027.437) [-2026.118] * (-2033.299) (-2034.127) [-2028.057] (-2034.040) -- 0:00:00
       3500 -- (-2028.276) (-2030.616) [-2034.256] (-2026.574) * (-2037.827) (-2035.115) [-2028.344] (-2027.172) -- 0:04:44
       4000 -- (-2025.653) (-2030.157) (-2032.498) [-2034.818] * [-2024.433] (-2032.805) (-2024.881) (-2031.793) -- 0:04:09
       4500 -- (-2026.032) (-2030.414) (-2027.762) [-2026.953] * (-2033.661) (-2029.182) (-2028.206) [-2024.906] -- 0:03:41
       5000 -- (-2040.233) (-2030.874) (-2033.454) [-2033.864] * [-2031.944] (-2028.041) (-2028.501) (-2027.338) -- 0:03:19

      Average standard deviation of split frequencies: 0.111304

       5500 -- (-2033.603) (-2025.509) [-2030.351] (-2032.268) * (-2041.222) (-2037.652) (-2032.055) [-2030.584] -- 0:03:00
       6000 -- (-2036.306) [-2029.424] (-2040.700) (-2025.914) * (-2025.864) (-2028.598) [-2028.544] (-2023.303) -- 0:02:45
       6500 -- (-2031.283) (-2029.768) [-2032.713] (-2023.216) * (-2029.887) (-2033.892) [-2025.454] (-2031.297) -- 0:02:32
       7000 -- (-2028.502) (-2028.668) (-2028.844) [-2022.816] * (-2029.359) (-2027.247) [-2029.416] (-2026.783) -- 0:02:21
       7500 -- (-2029.030) (-2025.167) [-2025.173] (-2032.699) * [-2026.697] (-2030.558) (-2025.902) (-2025.824) -- 0:02:12
       8000 -- (-2029.659) (-2027.871) [-2025.706] (-2021.948) * (-2024.949) (-2025.943) [-2026.581] (-2027.744) -- 0:02:04
       8500 -- [-2027.754] (-2026.624) (-2035.264) (-2035.476) * (-2028.225) (-2027.489) (-2023.738) [-2028.453] -- 0:01:56
       9000 -- (-2033.202) (-2032.329) (-2032.230) [-2026.948] * [-2027.634] (-2033.184) (-2024.827) (-2028.580) -- 0:01:50
       9500 -- (-2032.094) [-2028.199] (-2035.700) (-2022.813) * (-2032.151) [-2030.164] (-2029.119) (-2032.170) -- 0:01:44
      10000 -- (-2026.960) (-2026.037) (-2030.919) [-2030.716] * (-2024.411) (-2030.529) (-2038.532) [-2031.455] -- 0:01:39

      Average standard deviation of split frequencies: 0.072920

      10500 -- [-2022.683] (-2028.507) (-2032.012) (-2032.386) * [-2025.472] (-2028.013) (-2029.618) (-2025.757) -- 0:01:34
      11000 -- (-2031.494) (-2028.331) (-2028.032) [-2025.425] * (-2036.247) (-2031.876) [-2026.839] (-2026.048) -- 0:01:29
      11500 -- (-2028.266) (-2038.116) (-2034.165) [-2023.455] * (-2033.116) (-2026.414) [-2026.577] (-2026.497) -- 0:01:25
      12000 -- (-2036.641) (-2024.103) (-2038.109) [-2022.964] * (-2028.329) (-2029.278) [-2029.344] (-2033.597) -- 0:01:22
      12500 -- (-2031.542) [-2024.946] (-2033.925) (-2031.880) * (-2036.360) (-2032.586) (-2028.905) [-2027.599] -- 0:01:19
      13000 -- [-2028.125] (-2032.398) (-2035.023) (-2031.612) * [-2030.517] (-2028.427) (-2030.865) (-2030.491) -- 0:01:15
      13500 -- (-2037.655) [-2026.821] (-2040.487) (-2035.529) * (-2037.722) [-2027.535] (-2023.932) (-2031.879) -- 0:01:13
      14000 -- (-2027.698) [-2030.746] (-2033.631) (-2031.137) * (-2033.669) [-2026.332] (-2037.136) (-2020.739) -- 0:01:10
      14500 -- (-2030.711) (-2028.619) (-2026.781) [-2031.818] * [-2022.497] (-2034.521) (-2027.936) (-2019.679) -- 0:01:07
      15000 -- (-2028.351) [-2028.811] (-2025.606) (-2029.407) * [-2025.638] (-2033.042) (-2029.151) (-2019.332) -- 0:01:05

      Average standard deviation of split frequencies: 0.074358

      15500 -- [-2028.700] (-2030.789) (-2026.333) (-2031.745) * (-2031.743) (-2027.354) [-2028.878] (-2020.261) -- 0:01:03
      16000 -- [-2022.672] (-2032.758) (-2035.128) (-2022.642) * (-2027.448) (-2026.168) (-2032.251) [-2019.693] -- 0:01:01
      16500 -- [-2025.866] (-2029.072) (-2032.523) (-2023.591) * [-2027.027] (-2032.916) (-2047.755) (-2019.369) -- 0:01:59
      17000 -- (-2029.947) [-2024.458] (-2026.283) (-2025.361) * (-2032.402) [-2029.209] (-2028.314) (-2019.629) -- 0:01:55
      17500 -- (-2027.304) [-2025.941] (-2036.280) (-2026.750) * (-2032.348) (-2029.674) [-2037.716] (-2019.327) -- 0:01:52
      18000 -- (-2028.047) [-2022.579] (-2026.706) (-2031.800) * (-2024.688) (-2034.347) (-2032.117) [-2021.857] -- 0:01:49
      18500 -- [-2025.267] (-2035.037) (-2025.555) (-2028.092) * [-2031.576] (-2028.855) (-2027.356) (-2020.383) -- 0:01:46
      19000 -- [-2023.462] (-2035.400) (-2031.259) (-2026.340) * [-2029.894] (-2026.395) (-2031.272) (-2021.571) -- 0:01:43
      19500 -- (-2026.681) [-2033.857] (-2037.749) (-2024.555) * (-2029.928) [-2028.757] (-2033.615) (-2018.554) -- 0:01:40
      20000 -- (-2023.455) (-2030.168) (-2036.118) [-2030.044] * (-2028.228) (-2035.794) [-2022.589] (-2021.091) -- 0:01:38

      Average standard deviation of split frequencies: 0.077554

      20500 -- (-2027.068) [-2028.275] (-2029.123) (-2040.598) * [-2028.452] (-2031.737) (-2032.529) (-2019.925) -- 0:01:35
      21000 -- (-2024.647) (-2047.412) [-2026.112] (-2029.204) * (-2025.459) (-2033.909) [-2036.989] (-2018.843) -- 0:01:33
      21500 -- (-2025.123) (-2029.228) [-2022.073] (-2040.596) * [-2030.507] (-2030.437) (-2032.805) (-2019.340) -- 0:01:31
      22000 -- (-2022.693) (-2038.227) [-2027.174] (-2034.866) * (-2028.053) [-2029.806] (-2042.853) (-2019.340) -- 0:01:28
      22500 -- (-2034.541) (-2026.037) [-2024.640] (-2029.773) * [-2032.906] (-2045.944) (-2025.518) (-2019.370) -- 0:01:26
      23000 -- (-2025.724) (-2038.461) [-2025.369] (-2027.828) * (-2029.292) (-2021.633) [-2029.324] (-2019.071) -- 0:01:24
      23500 -- [-2029.604] (-2034.295) (-2026.853) (-2023.166) * (-2027.528) (-2020.267) (-2030.127) [-2020.027] -- 0:01:23
      24000 -- (-2031.458) (-2027.379) [-2024.320] (-2028.350) * (-2026.598) (-2018.736) [-2030.887] (-2019.933) -- 0:01:21
      24500 -- [-2030.808] (-2022.531) (-2036.617) (-2029.340) * [-2028.348] (-2020.068) (-2028.035) (-2025.733) -- 0:01:19
      25000 -- (-2031.690) (-2019.874) [-2040.695] (-2028.131) * (-2028.262) (-2020.962) [-2027.478] (-2025.704) -- 0:01:18

      Average standard deviation of split frequencies: 0.053529

      25500 -- (-2025.825) (-2021.546) (-2029.760) [-2027.287] * (-2039.585) (-2020.183) [-2029.663] (-2026.994) -- 0:01:16
      26000 -- [-2027.288] (-2025.441) (-2029.438) (-2029.248) * (-2031.190) [-2020.345] (-2027.242) (-2021.624) -- 0:01:14
      26500 -- (-2027.596) (-2021.430) [-2028.050] (-2031.046) * (-2030.205) (-2021.500) [-2022.793] (-2019.660) -- 0:01:13
      27000 -- (-2029.100) (-2022.614) [-2030.980] (-2028.855) * [-2028.170] (-2026.983) (-2025.371) (-2019.729) -- 0:01:12
      27500 -- (-2028.353) [-2018.783] (-2027.078) (-2030.296) * [-2025.521] (-2023.495) (-2026.127) (-2019.614) -- 0:01:10
      28000 -- [-2032.510] (-2019.525) (-2035.914) (-2027.387) * (-2040.600) (-2022.294) (-2031.718) [-2018.961] -- 0:01:09
      28500 -- (-2030.116) (-2019.539) [-2027.645] (-2026.472) * [-2026.271] (-2019.406) (-2035.044) (-2018.720) -- 0:01:08
      29000 -- (-2027.740) (-2019.598) [-2025.194] (-2019.970) * (-2030.581) [-2019.401] (-2034.501) (-2018.364) -- 0:01:06
      29500 -- (-2032.911) (-2020.519) [-2019.370] (-2020.423) * (-2030.099) (-2018.765) [-2026.068] (-2018.888) -- 0:01:05
      30000 -- (-2025.968) (-2027.085) [-2021.053] (-2019.662) * (-2036.621) (-2020.906) (-2030.767) [-2018.647] -- 0:01:04

      Average standard deviation of split frequencies: 0.044578

      30500 -- (-2032.261) (-2022.289) [-2021.624] (-2020.129) * (-2031.240) [-2018.675] (-2030.081) (-2019.067) -- 0:01:03
      31000 -- (-2028.835) (-2020.829) [-2020.389] (-2019.682) * (-2032.896) (-2018.843) (-2030.862) [-2020.079] -- 0:01:33
      31500 -- [-2029.472] (-2020.358) (-2022.219) (-2019.104) * [-2032.602] (-2021.186) (-2029.074) (-2020.851) -- 0:01:32
      32000 -- (-2029.868) [-2019.621] (-2021.382) (-2019.373) * (-2032.304) [-2021.430] (-2038.138) (-2020.417) -- 0:01:30
      32500 -- (-2026.211) (-2019.511) [-2018.341] (-2021.471) * (-2028.901) (-2020.150) [-2030.373] (-2019.601) -- 0:01:29
      33000 -- (-2030.589) (-2020.551) (-2018.342) [-2021.114] * (-2028.205) (-2021.296) [-2024.749] (-2019.156) -- 0:01:27
      33500 -- (-2040.646) (-2023.160) [-2024.733] (-2019.641) * (-2031.973) (-2020.042) [-2032.560] (-2021.417) -- 0:01:26
      34000 -- (-2029.201) (-2021.079) (-2022.444) [-2019.067] * [-2034.238] (-2025.012) (-2023.193) (-2022.167) -- 0:01:25
      34500 -- (-2029.573) [-2020.348] (-2020.533) (-2019.405) * (-2027.636) (-2022.510) (-2029.881) [-2024.050] -- 0:01:23
      35000 -- (-2034.587) (-2021.716) (-2025.507) [-2020.034] * (-2028.905) (-2022.235) (-2034.957) [-2019.571] -- 0:01:22

      Average standard deviation of split frequencies: 0.043212

      35500 -- (-2033.652) (-2018.351) (-2020.324) [-2019.440] * (-2032.030) (-2018.628) (-2026.963) [-2018.867] -- 0:01:21
      36000 -- [-2032.503] (-2018.877) (-2019.477) (-2019.451) * (-2031.070) [-2018.187] (-2025.300) (-2022.309) -- 0:01:20
      36500 -- (-2029.285) (-2021.323) [-2018.905] (-2020.069) * (-2036.459) (-2020.078) (-2027.686) [-2019.765] -- 0:01:19
      37000 -- (-2025.725) (-2021.807) [-2019.498] (-2018.688) * (-2022.535) (-2019.455) [-2029.457] (-2020.171) -- 0:01:18
      37500 -- (-2032.085) (-2020.729) (-2019.173) [-2019.084] * [-2019.481] (-2019.017) (-2027.252) (-2020.014) -- 0:01:17
      38000 -- (-2034.351) (-2021.775) [-2019.514] (-2022.809) * [-2019.900] (-2019.784) (-2030.959) (-2025.360) -- 0:01:15
      38500 -- (-2030.788) [-2021.781] (-2018.125) (-2023.196) * [-2020.627] (-2019.727) (-2029.671) (-2022.031) -- 0:01:14
      39000 -- [-2028.301] (-2022.502) (-2019.087) (-2019.530) * [-2022.258] (-2022.089) (-2029.675) (-2022.588) -- 0:01:13
      39500 -- (-2036.226) (-2018.938) (-2020.132) [-2017.975] * (-2021.632) (-2020.035) (-2030.463) [-2019.828] -- 0:01:12
      40000 -- (-2029.546) (-2019.019) (-2020.178) [-2018.305] * [-2021.701] (-2019.696) (-2029.013) (-2018.810) -- 0:01:12

      Average standard deviation of split frequencies: 0.039284

      40500 -- (-2025.258) (-2020.573) (-2020.503) [-2018.627] * (-2021.914) [-2019.421] (-2026.079) (-2018.856) -- 0:01:11
      41000 -- (-2028.532) (-2021.650) [-2018.885] (-2018.391) * (-2021.935) [-2019.610] (-2026.258) (-2018.307) -- 0:01:10
      41500 -- (-2024.759) (-2023.062) (-2018.725) [-2018.557] * (-2018.194) (-2018.909) [-2023.886] (-2018.431) -- 0:01:09
      42000 -- (-2028.041) (-2020.781) (-2018.644) [-2019.224] * (-2018.194) (-2019.050) (-2028.047) [-2018.303] -- 0:01:08
      42500 -- [-2025.336] (-2019.750) (-2019.426) (-2020.911) * (-2018.374) [-2019.824] (-2029.974) (-2019.264) -- 0:01:07
      43000 -- [-2024.752] (-2019.750) (-2020.372) (-2021.154) * (-2019.805) (-2024.221) (-2031.166) [-2019.281] -- 0:01:06
      43500 -- (-2033.332) [-2019.120] (-2018.687) (-2019.448) * [-2019.906] (-2019.882) (-2025.227) (-2020.833) -- 0:01:05
      44000 -- (-2037.150) [-2019.412] (-2021.911) (-2020.000) * (-2018.717) (-2022.934) (-2035.835) [-2022.057] -- 0:01:05
      44500 -- [-2027.172] (-2019.098) (-2020.267) (-2023.372) * (-2021.146) (-2022.646) (-2027.267) [-2018.745] -- 0:01:25
      45000 -- [-2030.654] (-2020.575) (-2020.495) (-2023.095) * (-2018.658) (-2019.497) [-2025.874] (-2018.746) -- 0:01:24

      Average standard deviation of split frequencies: 0.030744

      45500 -- (-2030.528) (-2019.587) (-2018.319) [-2025.362] * (-2018.971) (-2018.419) [-2030.063] (-2018.953) -- 0:01:23
      46000 -- (-2032.100) (-2019.218) [-2018.336] (-2025.067) * (-2019.009) (-2018.508) [-2032.480] (-2019.118) -- 0:01:22
      46500 -- (-2028.184) (-2019.089) (-2018.329) [-2021.600] * (-2020.063) (-2018.620) [-2027.525] (-2018.574) -- 0:01:22
      47000 -- (-2027.904) (-2019.371) (-2018.613) [-2021.325] * (-2019.695) (-2022.232) (-2028.546) [-2019.476] -- 0:01:21
      47500 -- [-2026.777] (-2019.422) (-2020.063) (-2020.419) * (-2019.839) (-2018.738) [-2027.860] (-2019.237) -- 0:01:20
      48000 -- (-2031.923) (-2023.841) [-2020.178] (-2020.101) * (-2018.371) [-2018.787] (-2027.811) (-2018.104) -- 0:01:19
      48500 -- (-2031.351) (-2023.076) (-2021.536) [-2018.932] * (-2018.460) [-2019.190] (-2027.535) (-2018.104) -- 0:01:18
      49000 -- [-2031.169] (-2021.873) (-2020.438) (-2018.905) * (-2019.380) (-2021.126) [-2028.074] (-2018.104) -- 0:01:17
      49500 -- (-2027.316) [-2022.659] (-2022.621) (-2019.053) * (-2020.861) (-2019.698) (-2029.927) [-2019.336] -- 0:01:16
      50000 -- (-2027.353) (-2022.256) [-2021.551] (-2020.528) * (-2022.022) (-2018.903) [-2028.634] (-2021.334) -- 0:01:16

      Average standard deviation of split frequencies: 0.032564

      50500 -- (-2028.911) (-2021.153) [-2023.670] (-2018.938) * (-2022.184) (-2020.089) [-2025.941] (-2021.417) -- 0:01:15
      51000 -- (-2031.069) (-2020.958) (-2021.437) [-2019.446] * (-2020.409) (-2019.776) (-2026.869) [-2022.485] -- 0:01:14
      51500 -- (-2030.878) (-2020.380) (-2021.729) [-2018.589] * (-2020.401) (-2019.759) (-2033.655) [-2018.913] -- 0:01:13
      52000 -- (-2028.982) [-2021.083] (-2024.600) (-2019.910) * (-2019.391) [-2018.073] (-2027.575) (-2019.074) -- 0:01:12
      52500 -- (-2037.749) [-2020.925] (-2025.439) (-2022.327) * (-2023.081) [-2021.979] (-2027.458) (-2019.036) -- 0:01:12
      53000 -- (-2035.164) [-2019.410] (-2023.193) (-2022.170) * (-2019.433) (-2023.892) [-2027.908] (-2019.464) -- 0:01:11
      53500 -- (-2036.532) (-2020.902) (-2020.230) [-2020.873] * (-2018.790) [-2018.376] (-2035.237) (-2020.546) -- 0:01:10
      54000 -- (-2043.184) [-2019.725] (-2020.044) (-2020.548) * (-2021.629) (-2018.720) (-2030.824) [-2021.746] -- 0:01:10
      54500 -- (-2027.987) [-2020.379] (-2021.027) (-2021.100) * (-2021.863) (-2018.799) (-2028.203) [-2021.416] -- 0:01:09
      55000 -- (-2024.628) (-2019.663) [-2020.143] (-2020.008) * (-2019.656) (-2021.386) (-2028.621) [-2019.247] -- 0:01:08

      Average standard deviation of split frequencies: 0.029042

      55500 -- [-2028.892] (-2018.056) (-2022.442) (-2022.331) * (-2018.755) [-2019.289] (-2026.546) (-2019.326) -- 0:01:08
      56000 -- (-2037.134) (-2020.979) (-2023.712) [-2022.669] * (-2019.048) [-2019.611] (-2026.297) (-2019.012) -- 0:01:07
      56500 -- [-2029.104] (-2018.038) (-2024.207) (-2020.446) * (-2019.499) (-2018.576) [-2031.593] (-2020.340) -- 0:01:23
      57000 -- (-2025.793) (-2019.263) [-2023.621] (-2021.020) * (-2019.568) (-2019.579) (-2027.736) [-2018.641] -- 0:01:22
      57500 -- (-2028.192) (-2018.812) (-2024.007) [-2019.503] * (-2019.007) (-2020.805) [-2024.379] (-2018.641) -- 0:01:21
      58000 -- [-2029.381] (-2018.812) (-2019.289) (-2020.350) * (-2019.700) [-2019.495] (-2032.354) (-2018.506) -- 0:01:21
      58500 -- (-2037.400) (-2018.082) [-2019.767] (-2020.336) * (-2019.214) (-2020.717) (-2034.255) [-2019.509] -- 0:01:20
      59000 -- (-2022.605) (-2020.926) (-2021.583) [-2019.775] * (-2018.980) (-2020.750) (-2037.928) [-2019.878] -- 0:01:19
      59500 -- (-2022.174) (-2021.989) (-2020.761) [-2018.778] * [-2020.622] (-2021.501) (-2034.143) (-2018.691) -- 0:01:19
      60000 -- (-2020.859) [-2019.830] (-2021.646) (-2021.471) * (-2020.746) [-2019.096] (-2028.836) (-2023.121) -- 0:01:18

      Average standard deviation of split frequencies: 0.025597

      60500 -- (-2021.289) [-2018.711] (-2020.174) (-2018.710) * (-2022.313) (-2020.148) [-2020.810] (-2018.918) -- 0:01:17
      61000 -- [-2021.106] (-2020.164) (-2022.611) (-2018.529) * (-2020.437) (-2018.819) (-2029.401) [-2018.719] -- 0:01:16
      61500 -- (-2020.512) [-2020.620] (-2024.235) (-2018.079) * (-2021.857) (-2018.521) (-2032.340) [-2018.946] -- 0:01:16
      62000 -- (-2018.200) (-2020.776) [-2025.385] (-2018.167) * (-2021.647) [-2020.246] (-2024.770) (-2018.519) -- 0:01:15
      62500 -- [-2019.089] (-2023.293) (-2018.737) (-2020.190) * [-2020.431] (-2020.042) (-2027.192) (-2018.590) -- 0:01:15
      63000 -- (-2019.246) [-2023.958] (-2021.819) (-2020.048) * (-2020.633) (-2020.795) (-2036.945) [-2018.590] -- 0:01:14
      63500 -- (-2021.377) [-2020.144] (-2021.379) (-2020.018) * [-2020.174] (-2024.662) (-2032.379) (-2019.239) -- 0:01:13
      64000 -- (-2020.081) (-2019.763) (-2020.718) [-2020.456] * (-2020.046) (-2020.990) (-2029.568) [-2022.956] -- 0:01:13
      64500 -- (-2019.192) (-2019.493) (-2021.302) [-2020.558] * (-2019.597) [-2019.318] (-2029.506) (-2019.621) -- 0:01:12
      65000 -- (-2020.602) [-2019.942] (-2020.907) (-2023.617) * (-2019.185) (-2021.566) (-2035.734) [-2019.496] -- 0:01:11

      Average standard deviation of split frequencies: 0.030074

      65500 -- [-2019.479] (-2019.090) (-2025.500) (-2022.306) * (-2024.042) (-2020.499) (-2036.961) [-2019.228] -- 0:01:11
      66000 -- [-2020.906] (-2019.903) (-2025.615) (-2026.382) * (-2023.326) [-2020.589] (-2033.327) (-2018.300) -- 0:01:10
      66500 -- [-2020.997] (-2022.700) (-2018.726) (-2024.040) * (-2020.810) (-2019.776) (-2030.216) [-2019.070] -- 0:01:10
      67000 -- [-2020.631] (-2018.670) (-2023.921) (-2021.482) * (-2022.140) (-2023.371) (-2028.198) [-2019.396] -- 0:01:09
      67500 -- (-2020.030) (-2019.303) (-2024.266) [-2019.366] * (-2020.088) (-2025.787) (-2030.414) [-2019.413] -- 0:01:09
      68000 -- [-2020.019] (-2019.199) (-2023.236) (-2023.491) * [-2020.171] (-2026.913) (-2036.182) (-2019.182) -- 0:01:08
      68500 -- (-2019.323) [-2019.329] (-2021.296) (-2023.473) * (-2019.480) (-2021.915) [-2029.480] (-2019.711) -- 0:01:07
      69000 -- (-2020.829) [-2019.849] (-2019.621) (-2019.700) * [-2018.444] (-2018.329) (-2037.308) (-2019.472) -- 0:01:07
      69500 -- (-2021.882) [-2021.332] (-2019.901) (-2018.579) * (-2020.058) [-2021.581] (-2038.235) (-2019.542) -- 0:01:06
      70000 -- (-2020.616) (-2018.763) [-2019.090] (-2018.579) * (-2019.337) (-2019.250) (-2037.185) [-2019.927] -- 0:01:06

      Average standard deviation of split frequencies: 0.025981

      70500 -- (-2021.867) (-2019.257) [-2019.674] (-2019.940) * (-2018.875) [-2019.333] (-2035.864) (-2019.383) -- 0:01:05
      71000 -- (-2023.213) [-2017.984] (-2019.875) (-2018.833) * (-2018.666) (-2018.943) (-2026.895) [-2019.802] -- 0:01:05
      71500 -- (-2019.464) (-2019.440) (-2020.944) [-2020.414] * (-2018.826) [-2019.060] (-2036.254) (-2024.177) -- 0:01:17
      72000 -- [-2019.320] (-2021.410) (-2020.944) (-2018.266) * [-2018.553] (-2018.781) (-2027.141) (-2020.125) -- 0:01:17
      72500 -- (-2021.190) [-2018.269] (-2026.360) (-2018.226) * (-2018.597) (-2020.238) [-2025.925] (-2018.568) -- 0:01:16
      73000 -- (-2022.525) (-2018.192) (-2023.652) [-2019.043] * (-2020.071) (-2024.013) (-2025.722) [-2020.591] -- 0:01:16
      73500 -- (-2021.499) [-2018.621] (-2027.475) (-2020.843) * (-2021.257) [-2018.431] (-2031.971) (-2019.164) -- 0:01:15
      74000 -- (-2021.410) [-2019.364] (-2022.111) (-2018.840) * (-2019.074) (-2019.616) (-2034.138) [-2020.069] -- 0:01:15
      74500 -- (-2019.469) [-2019.785] (-2019.320) (-2019.628) * (-2020.964) (-2019.800) [-2026.988] (-2019.399) -- 0:01:14
      75000 -- [-2020.573] (-2020.005) (-2020.133) (-2020.497) * (-2024.690) [-2019.676] (-2031.927) (-2018.683) -- 0:01:14

      Average standard deviation of split frequencies: 0.025121

      75500 -- (-2019.170) [-2020.560] (-2021.625) (-2023.012) * (-2023.452) (-2019.351) [-2024.762] (-2019.621) -- 0:01:13
      76000 -- [-2019.166] (-2019.130) (-2020.861) (-2019.871) * (-2019.822) (-2022.957) [-2033.418] (-2020.486) -- 0:01:12
      76500 -- [-2020.657] (-2019.022) (-2018.988) (-2020.307) * (-2020.843) (-2019.948) (-2027.715) [-2018.916] -- 0:01:12
      77000 -- (-2018.368) (-2020.813) (-2020.598) [-2020.019] * (-2020.635) (-2019.960) (-2030.542) [-2018.032] -- 0:01:11
      77500 -- (-2018.318) [-2022.630] (-2027.640) (-2022.174) * [-2020.534] (-2019.442) (-2038.097) (-2024.148) -- 0:01:11
      78000 -- [-2018.282] (-2020.827) (-2023.891) (-2022.384) * (-2019.619) [-2018.209] (-2029.081) (-2018.151) -- 0:01:10
      78500 -- (-2018.944) (-2022.363) (-2019.571) [-2020.392] * (-2019.289) (-2019.122) [-2030.319] (-2021.424) -- 0:01:10
      79000 -- (-2018.944) (-2020.580) (-2021.042) [-2020.734] * (-2019.416) (-2019.319) [-2027.137] (-2021.443) -- 0:01:09
      79500 -- (-2020.123) (-2020.483) [-2024.265] (-2020.411) * (-2019.028) [-2020.172] (-2033.004) (-2022.619) -- 0:01:09
      80000 -- (-2020.447) (-2020.551) (-2019.659) [-2019.863] * (-2020.225) (-2020.128) [-2024.704] (-2022.664) -- 0:01:09

      Average standard deviation of split frequencies: 0.026297

      80500 -- (-2024.376) (-2019.409) (-2019.528) [-2020.225] * [-2019.884] (-2025.450) (-2025.348) (-2018.871) -- 0:01:08
      81000 -- (-2022.524) (-2019.233) [-2019.913] (-2019.347) * (-2019.895) (-2023.408) [-2024.401] (-2019.654) -- 0:01:08
      81500 -- (-2019.481) (-2021.400) (-2022.832) [-2019.682] * [-2019.096] (-2023.688) (-2025.123) (-2019.150) -- 0:01:07
      82000 -- (-2018.688) [-2021.192] (-2020.468) (-2020.329) * (-2019.099) (-2026.597) (-2028.027) [-2018.631] -- 0:01:07
      82500 -- [-2018.664] (-2019.090) (-2020.912) (-2019.169) * [-2018.950] (-2021.370) (-2028.390) (-2019.619) -- 0:01:06
      83000 -- [-2018.829] (-2018.502) (-2022.617) (-2019.182) * (-2019.712) (-2020.842) (-2026.700) [-2022.124] -- 0:01:06
      83500 -- (-2019.792) (-2019.542) [-2019.022] (-2025.324) * (-2021.329) [-2018.297] (-2030.094) (-2018.503) -- 0:01:05
      84000 -- [-2022.520] (-2019.836) (-2019.462) (-2020.056) * [-2019.875] (-2022.871) (-2039.271) (-2018.470) -- 0:01:05
      84500 -- (-2021.246) (-2019.663) (-2019.128) [-2018.522] * [-2019.406] (-2019.610) (-2028.970) (-2019.265) -- 0:01:05
      85000 -- (-2022.756) (-2020.569) [-2019.172] (-2018.687) * [-2018.880] (-2019.867) (-2028.387) (-2020.587) -- 0:01:04

      Average standard deviation of split frequencies: 0.027133

      85500 -- (-2021.234) (-2021.240) (-2019.203) [-2019.228] * [-2018.670] (-2019.046) (-2028.849) (-2019.720) -- 0:01:04
      86000 -- [-2019.675] (-2018.740) (-2020.128) (-2019.774) * (-2019.772) (-2019.095) (-2029.599) [-2019.883] -- 0:01:03
      86500 -- [-2021.767] (-2023.148) (-2020.466) (-2019.282) * (-2018.067) (-2021.913) [-2025.276] (-2019.884) -- 0:01:03
      87000 -- [-2020.082] (-2025.182) (-2022.771) (-2018.983) * (-2018.214) (-2021.316) (-2030.139) [-2019.038] -- 0:01:13
      87500 -- (-2020.488) (-2021.335) (-2022.436) [-2021.502] * (-2020.549) [-2022.139] (-2025.341) (-2021.916) -- 0:01:13
      88000 -- (-2021.697) [-2019.945] (-2019.141) (-2021.770) * (-2019.991) (-2020.520) (-2025.939) [-2018.630] -- 0:01:12
      88500 -- (-2019.896) (-2020.429) [-2020.606] (-2019.512) * (-2019.195) (-2022.924) (-2030.653) [-2018.638] -- 0:01:12
      89000 -- (-2021.149) [-2020.779] (-2018.164) (-2018.805) * (-2018.546) (-2019.701) (-2022.451) [-2019.042] -- 0:01:11
      89500 -- (-2023.442) (-2030.098) (-2018.722) [-2019.153] * (-2019.410) (-2020.960) [-2018.750] (-2022.086) -- 0:01:11
      90000 -- (-2025.792) (-2021.953) (-2018.552) [-2020.647] * (-2018.704) (-2020.073) [-2018.257] (-2022.200) -- 0:01:10

      Average standard deviation of split frequencies: 0.031743

      90500 -- (-2020.058) (-2021.847) [-2018.911] (-2021.197) * (-2018.272) [-2018.881] (-2019.101) (-2018.992) -- 0:01:10
      91000 -- (-2019.593) (-2021.847) [-2018.868] (-2020.358) * (-2020.027) (-2020.117) (-2019.343) [-2018.405] -- 0:01:09
      91500 -- (-2020.035) (-2022.092) (-2019.980) [-2020.123] * [-2018.089] (-2021.745) (-2019.254) (-2019.426) -- 0:01:09
      92000 -- (-2022.179) (-2018.130) (-2022.025) [-2022.274] * (-2018.692) [-2020.030] (-2018.848) (-2020.342) -- 0:01:09
      92500 -- (-2024.589) (-2020.004) [-2020.615] (-2022.472) * [-2018.145] (-2018.831) (-2018.694) (-2018.773) -- 0:01:08
      93000 -- [-2024.436] (-2018.747) (-2019.640) (-2021.214) * (-2018.142) [-2019.103] (-2018.559) (-2018.766) -- 0:01:08
      93500 -- (-2025.052) (-2018.747) (-2019.640) [-2022.631] * (-2018.579) [-2019.829] (-2020.000) (-2018.677) -- 0:01:07
      94000 -- [-2019.003] (-2018.190) (-2022.649) (-2022.096) * [-2018.521] (-2018.604) (-2018.301) (-2018.701) -- 0:01:07
      94500 -- (-2020.477) (-2018.100) [-2018.553] (-2023.616) * (-2019.526) (-2018.581) (-2020.465) [-2020.653] -- 0:01:07
      95000 -- (-2023.485) (-2019.725) [-2019.944] (-2019.480) * (-2022.680) [-2020.164] (-2021.292) (-2019.099) -- 0:01:06

      Average standard deviation of split frequencies: 0.034890

      95500 -- (-2019.391) [-2023.352] (-2018.320) (-2022.521) * (-2022.308) (-2018.266) (-2021.292) [-2019.099] -- 0:01:06
      96000 -- (-2018.851) (-2022.506) [-2020.244] (-2021.023) * (-2021.983) [-2018.726] (-2021.803) (-2021.177) -- 0:01:05
      96500 -- (-2018.526) (-2023.555) [-2023.805] (-2018.990) * [-2021.837] (-2019.515) (-2022.037) (-2019.007) -- 0:01:05
      97000 -- (-2018.466) [-2026.674] (-2022.225) (-2020.633) * (-2023.172) (-2022.166) (-2027.563) [-2018.123] -- 0:01:05
      97500 -- (-2022.607) (-2020.992) [-2020.647] (-2023.532) * [-2022.905] (-2021.561) (-2022.360) (-2019.556) -- 0:01:04
      98000 -- (-2021.579) (-2020.866) [-2020.207] (-2022.973) * (-2024.573) (-2021.920) [-2021.666] (-2018.339) -- 0:01:04
      98500 -- (-2020.972) (-2021.230) [-2018.464] (-2022.763) * (-2021.279) (-2022.639) (-2020.783) [-2017.917] -- 0:01:04
      99000 -- [-2020.422] (-2022.353) (-2018.347) (-2023.299) * [-2023.130] (-2018.352) (-2019.617) (-2018.466) -- 0:01:03
      99500 -- (-2021.315) [-2022.296] (-2021.328) (-2019.487) * (-2021.636) (-2019.587) [-2019.816] (-2020.391) -- 0:01:03
      100000 -- (-2019.244) [-2019.586] (-2018.556) (-2020.469) * (-2023.260) [-2021.940] (-2025.788) (-2019.645) -- 0:01:02

      Average standard deviation of split frequencies: 0.029970

      100500 -- (-2019.284) [-2019.098] (-2018.469) (-2022.375) * (-2021.347) (-2019.941) (-2026.115) [-2019.809] -- 0:01:02
      101000 -- [-2019.695] (-2019.632) (-2018.889) (-2019.219) * (-2019.827) (-2018.455) [-2019.829] (-2020.335) -- 0:01:02
      101500 -- [-2018.259] (-2020.421) (-2019.790) (-2018.515) * (-2020.445) (-2019.789) [-2021.337] (-2020.526) -- 0:01:01
      102000 -- (-2021.406) [-2020.269] (-2018.215) (-2018.234) * (-2020.526) (-2019.264) [-2018.033] (-2021.395) -- 0:01:01
      102500 -- (-2020.542) (-2019.377) [-2018.118] (-2018.377) * (-2020.853) (-2020.787) [-2018.496] (-2019.711) -- 0:01:10
      103000 -- (-2019.721) [-2020.373] (-2018.558) (-2018.565) * (-2022.794) [-2019.040] (-2022.263) (-2019.535) -- 0:01:09
      103500 -- [-2019.592] (-2020.215) (-2018.470) (-2018.565) * (-2022.861) (-2019.237) (-2019.820) [-2019.795] -- 0:01:09
      104000 -- (-2018.870) (-2020.638) [-2018.691] (-2018.678) * (-2019.180) (-2019.611) [-2022.179] (-2018.320) -- 0:01:08
      104500 -- [-2019.090] (-2020.730) (-2022.458) (-2018.116) * (-2019.601) (-2018.479) [-2021.047] (-2020.086) -- 0:01:08
      105000 -- [-2019.044] (-2023.181) (-2023.013) (-2018.761) * (-2020.158) (-2018.537) (-2020.235) [-2019.894] -- 0:01:08

      Average standard deviation of split frequencies: 0.029574

      105500 -- (-2018.630) [-2019.031] (-2025.436) (-2019.631) * (-2019.110) (-2018.788) (-2018.936) [-2020.696] -- 0:01:07
      106000 -- (-2019.661) [-2019.111] (-2020.975) (-2019.398) * [-2018.932] (-2020.434) (-2019.242) (-2018.105) -- 0:01:07
      106500 -- [-2019.524] (-2021.276) (-2021.268) (-2018.826) * [-2018.967] (-2021.089) (-2021.212) (-2022.273) -- 0:01:07
      107000 -- (-2019.336) [-2024.251] (-2021.742) (-2023.324) * (-2020.681) [-2019.647] (-2021.193) (-2022.865) -- 0:01:06
      107500 -- (-2018.600) (-2023.669) [-2020.686] (-2020.740) * (-2019.520) [-2019.721] (-2020.012) (-2020.273) -- 0:01:06
      108000 -- [-2019.003] (-2024.342) (-2020.215) (-2020.435) * [-2020.479] (-2020.478) (-2020.663) (-2019.876) -- 0:01:06
      108500 -- (-2019.017) (-2022.759) (-2019.682) [-2018.971] * (-2024.090) (-2021.635) [-2020.774] (-2018.598) -- 0:01:05
      109000 -- (-2019.542) (-2021.808) (-2019.909) [-2020.853] * (-2021.675) (-2021.635) (-2022.623) [-2018.781] -- 0:01:05
      109500 -- [-2019.433] (-2022.537) (-2022.603) (-2019.802) * (-2021.118) (-2021.472) (-2022.363) [-2020.390] -- 0:01:05
      110000 -- (-2019.817) (-2019.636) [-2019.443] (-2019.552) * (-2020.857) (-2019.814) (-2022.454) [-2021.133] -- 0:01:04

      Average standard deviation of split frequencies: 0.027901

      110500 -- (-2020.234) (-2020.762) [-2021.464] (-2020.049) * (-2020.959) (-2018.808) [-2021.727] (-2022.435) -- 0:01:04
      111000 -- (-2020.273) [-2018.856] (-2020.832) (-2019.703) * (-2025.538) (-2018.481) [-2020.035] (-2021.210) -- 0:01:04
      111500 -- (-2023.683) (-2021.789) [-2019.623] (-2019.319) * [-2021.348] (-2017.998) (-2022.909) (-2021.087) -- 0:01:03
      112000 -- (-2019.372) (-2019.845) [-2019.418] (-2021.726) * (-2024.635) (-2023.527) (-2023.446) [-2019.076] -- 0:01:03
      112500 -- [-2019.359] (-2020.334) (-2018.456) (-2020.509) * (-2025.770) (-2023.502) (-2021.108) [-2019.450] -- 0:01:03
      113000 -- (-2018.872) (-2020.266) (-2023.930) [-2018.908] * (-2022.326) (-2019.800) [-2018.372] (-2018.701) -- 0:01:02
      113500 -- (-2020.544) (-2019.138) (-2021.309) [-2019.006] * (-2019.040) [-2019.161] (-2019.887) (-2021.012) -- 0:01:02
      114000 -- [-2019.928] (-2019.133) (-2020.074) (-2019.031) * (-2018.805) (-2019.463) [-2020.030] (-2020.092) -- 0:01:02
      114500 -- (-2018.498) [-2019.977] (-2019.477) (-2023.500) * (-2019.137) (-2018.070) [-2024.052] (-2020.116) -- 0:01:01
      115000 -- (-2020.305) [-2019.325] (-2021.171) (-2025.172) * (-2018.536) (-2023.231) [-2019.623] (-2019.822) -- 0:01:01

      Average standard deviation of split frequencies: 0.025512

      115500 -- (-2018.906) (-2020.922) [-2019.513] (-2031.022) * (-2018.536) (-2023.751) [-2019.129] (-2018.899) -- 0:01:01
      116000 -- (-2019.174) (-2024.744) (-2020.667) [-2028.547] * (-2019.086) (-2021.133) (-2020.500) [-2018.781] -- 0:01:00
      116500 -- [-2020.173] (-2018.849) (-2021.564) (-2023.433) * (-2023.791) (-2021.554) (-2021.551) [-2021.240] -- 0:01:00
      117000 -- [-2021.605] (-2023.222) (-2020.213) (-2020.922) * (-2019.053) (-2021.572) [-2023.047] (-2020.966) -- 0:01:00
      117500 -- (-2024.177) (-2020.537) [-2019.481] (-2018.229) * (-2019.590) (-2020.236) (-2018.120) [-2023.092] -- 0:01:00
      118000 -- (-2020.544) [-2019.949] (-2020.011) (-2018.247) * (-2019.761) (-2025.936) [-2018.117] (-2024.087) -- 0:01:07
      118500 -- (-2020.101) (-2020.162) (-2020.229) [-2018.020] * (-2022.131) (-2025.761) [-2019.006] (-2021.580) -- 0:01:06
      119000 -- (-2020.679) (-2024.420) (-2018.778) [-2018.712] * (-2019.360) (-2023.858) (-2017.876) [-2018.530] -- 0:01:06
      119500 -- (-2021.661) [-2020.669] (-2020.299) (-2021.537) * (-2022.058) (-2020.151) [-2023.188] (-2019.596) -- 0:01:06
      120000 -- (-2022.349) (-2020.322) [-2020.210] (-2021.036) * [-2020.682] (-2020.364) (-2021.981) (-2019.324) -- 0:01:06

      Average standard deviation of split frequencies: 0.024525

      120500 -- (-2021.476) [-2018.222] (-2020.647) (-2023.015) * (-2028.651) (-2021.385) (-2018.337) [-2018.570] -- 0:01:05
      121000 -- (-2021.674) (-2019.504) (-2020.343) [-2019.851] * (-2026.546) [-2021.060] (-2019.470) (-2021.426) -- 0:01:05
      121500 -- (-2019.385) [-2018.319] (-2020.469) (-2018.145) * [-2022.106] (-2018.694) (-2019.624) (-2020.379) -- 0:01:05
      122000 -- (-2022.612) (-2018.571) [-2020.208] (-2022.104) * (-2024.202) (-2020.518) (-2019.116) [-2018.785] -- 0:01:04
      122500 -- (-2019.311) (-2018.420) (-2020.235) [-2022.660] * (-2021.061) (-2021.374) (-2018.316) [-2019.737] -- 0:01:04
      123000 -- (-2020.076) (-2018.425) (-2019.941) [-2024.014] * (-2021.776) (-2025.272) [-2020.181] (-2024.682) -- 0:01:04
      123500 -- [-2024.748] (-2018.522) (-2019.321) (-2020.773) * (-2022.627) [-2018.751] (-2019.975) (-2019.216) -- 0:01:03
      124000 -- [-2023.320] (-2018.368) (-2018.918) (-2019.350) * (-2023.089) (-2019.293) (-2019.132) [-2019.901] -- 0:01:03
      124500 -- (-2023.406) (-2019.434) [-2019.403] (-2018.680) * [-2022.635] (-2019.142) (-2018.483) (-2020.911) -- 0:01:03
      125000 -- (-2019.581) (-2019.811) [-2019.843] (-2018.357) * (-2027.391) (-2018.736) (-2018.354) [-2019.894] -- 0:01:03

      Average standard deviation of split frequencies: 0.024131

      125500 -- (-2019.527) (-2018.553) [-2021.576] (-2018.052) * (-2024.277) (-2018.825) (-2020.810) [-2021.128] -- 0:01:02
      126000 -- (-2019.977) (-2019.886) [-2020.687] (-2019.515) * (-2027.081) [-2024.311] (-2020.824) (-2020.251) -- 0:01:02
      126500 -- [-2020.551] (-2020.338) (-2018.956) (-2021.642) * (-2027.565) (-2022.554) (-2018.732) [-2022.034] -- 0:01:02
      127000 -- (-2018.308) (-2022.245) [-2019.246] (-2021.082) * (-2023.362) (-2018.956) (-2018.439) [-2021.016] -- 0:01:01
      127500 -- (-2018.869) (-2022.740) [-2019.253] (-2018.219) * (-2020.917) (-2018.945) [-2018.373] (-2020.831) -- 0:01:01
      128000 -- (-2019.135) [-2022.802] (-2023.179) (-2019.455) * (-2022.256) [-2020.385] (-2018.734) (-2021.520) -- 0:01:01
      128500 -- (-2020.250) (-2023.167) (-2019.492) [-2019.339] * [-2021.885] (-2019.205) (-2019.130) (-2021.639) -- 0:01:01
      129000 -- [-2018.823] (-2017.981) (-2022.473) (-2019.231) * [-2021.619] (-2019.619) (-2021.379) (-2021.650) -- 0:01:00
      129500 -- (-2019.206) [-2018.896] (-2023.255) (-2019.995) * (-2020.718) (-2020.778) [-2022.903] (-2023.070) -- 0:01:00
      130000 -- (-2019.017) (-2020.315) [-2020.037] (-2020.365) * (-2019.830) [-2019.163] (-2020.905) (-2021.192) -- 0:01:00

      Average standard deviation of split frequencies: 0.022849

      130500 -- (-2020.256) (-2021.017) (-2020.035) [-2018.574] * (-2019.219) (-2018.709) (-2020.392) [-2018.503] -- 0:00:59
      131000 -- (-2019.738) (-2024.118) (-2019.796) [-2020.793] * (-2020.318) (-2023.746) [-2021.784] (-2020.738) -- 0:00:59
      131500 -- (-2022.733) (-2024.696) (-2019.896) [-2018.952] * [-2019.332] (-2018.575) (-2021.301) (-2023.954) -- 0:00:59
      132000 -- (-2022.129) (-2022.339) [-2019.530] (-2021.536) * (-2019.448) (-2019.296) (-2020.121) [-2018.223] -- 0:00:59
      132500 -- (-2026.651) (-2020.124) (-2019.400) [-2025.067] * (-2027.115) (-2018.224) (-2019.878) [-2018.211] -- 0:00:58
      133000 -- (-2019.238) (-2019.225) (-2020.827) [-2022.992] * (-2022.737) (-2021.099) [-2019.875] (-2018.632) -- 0:01:05
      133500 -- (-2019.434) (-2019.198) (-2021.479) [-2020.113] * (-2023.152) (-2018.533) (-2020.270) [-2019.164] -- 0:01:04
      134000 -- (-2019.793) (-2020.165) [-2019.297] (-2019.689) * (-2021.918) (-2018.871) (-2020.010) [-2018.922] -- 0:01:04
      134500 -- [-2019.883] (-2022.864) (-2018.965) (-2020.548) * (-2018.566) [-2019.677] (-2020.565) (-2018.352) -- 0:01:04
      135000 -- [-2020.585] (-2022.785) (-2020.848) (-2023.412) * [-2019.256] (-2019.675) (-2021.053) (-2018.952) -- 0:01:04

      Average standard deviation of split frequencies: 0.025130

      135500 -- [-2024.346] (-2022.491) (-2018.912) (-2023.960) * [-2018.770] (-2018.443) (-2022.213) (-2019.747) -- 0:01:03
      136000 -- [-2020.300] (-2020.870) (-2020.441) (-2021.324) * (-2021.338) (-2019.268) [-2024.617] (-2018.933) -- 0:01:03
      136500 -- (-2020.415) (-2020.097) (-2020.441) [-2022.096] * (-2020.552) (-2020.752) [-2021.909] (-2018.618) -- 0:01:03
      137000 -- (-2019.672) (-2021.714) (-2021.868) [-2021.744] * (-2019.270) [-2018.538] (-2022.119) (-2018.206) -- 0:01:02
      137500 -- (-2019.670) [-2019.898] (-2020.102) (-2021.036) * [-2020.319] (-2018.501) (-2018.998) (-2022.567) -- 0:01:02
      138000 -- [-2019.658] (-2019.659) (-2019.556) (-2021.507) * (-2023.198) [-2018.501] (-2019.243) (-2021.235) -- 0:01:02
      138500 -- (-2021.057) [-2020.579] (-2018.550) (-2022.891) * (-2023.894) (-2018.439) [-2019.103] (-2021.756) -- 0:01:02
      139000 -- (-2022.378) [-2019.615] (-2021.979) (-2020.097) * (-2023.673) [-2020.618] (-2019.776) (-2021.814) -- 0:01:01
      139500 -- (-2022.032) [-2019.748] (-2021.669) (-2021.454) * [-2024.367] (-2020.636) (-2021.675) (-2025.305) -- 0:01:01
      140000 -- (-2019.276) (-2019.897) (-2020.028) [-2019.451] * (-2027.918) [-2019.656] (-2020.986) (-2025.369) -- 0:01:01

      Average standard deviation of split frequencies: 0.026633

      140500 -- (-2019.134) [-2020.462] (-2020.354) (-2020.044) * (-2020.475) [-2022.463] (-2018.959) (-2025.018) -- 0:01:01
      141000 -- (-2023.224) (-2021.452) [-2020.428] (-2020.661) * (-2021.624) (-2020.165) [-2020.771] (-2020.902) -- 0:01:00
      141500 -- [-2019.143] (-2018.101) (-2019.044) (-2020.168) * (-2019.896) [-2019.757] (-2021.688) (-2020.779) -- 0:01:00
      142000 -- [-2019.643] (-2018.768) (-2019.365) (-2021.473) * (-2019.547) (-2019.164) [-2019.185] (-2019.268) -- 0:01:00
      142500 -- (-2019.973) (-2018.735) [-2019.333] (-2021.891) * (-2021.491) (-2019.039) (-2018.476) [-2026.549] -- 0:01:00
      143000 -- (-2019.973) (-2018.106) (-2025.210) [-2020.150] * (-2018.721) (-2018.219) [-2018.230] (-2019.055) -- 0:00:59
      143500 -- (-2019.963) (-2021.372) (-2021.039) [-2020.481] * (-2020.152) [-2020.047] (-2017.943) (-2018.626) -- 0:00:59
      144000 -- [-2019.716] (-2020.308) (-2019.551) (-2020.682) * (-2019.816) (-2018.273) [-2020.093] (-2020.089) -- 0:00:59
      144500 -- (-2019.190) [-2019.267] (-2019.257) (-2019.737) * (-2021.500) (-2018.273) [-2021.107] (-2019.376) -- 0:00:59
      145000 -- (-2018.465) (-2020.497) (-2019.935) [-2021.646] * [-2019.401] (-2019.163) (-2022.676) (-2020.496) -- 0:00:58

      Average standard deviation of split frequencies: 0.028091

      145500 -- (-2020.166) (-2020.456) (-2019.214) [-2022.752] * (-2021.508) (-2019.157) (-2021.511) [-2020.949] -- 0:00:58
      146000 -- (-2018.917) (-2019.064) (-2019.311) [-2020.719] * (-2021.208) [-2021.532] (-2018.143) (-2020.675) -- 0:00:58
      146500 -- (-2018.515) (-2019.214) [-2020.117] (-2022.062) * (-2024.068) (-2029.045) [-2018.145] (-2019.892) -- 0:00:58
      147000 -- [-2020.164] (-2024.083) (-2021.576) (-2021.085) * (-2021.312) (-2021.355) (-2018.699) [-2022.183] -- 0:00:58
      147500 -- (-2019.930) (-2023.740) [-2021.791] (-2019.211) * (-2021.239) (-2018.380) (-2020.936) [-2019.525] -- 0:00:57
      148000 -- (-2019.926) (-2021.126) [-2021.673] (-2023.133) * (-2019.924) (-2019.482) (-2018.750) [-2020.066] -- 0:00:57
      148500 -- (-2020.650) (-2022.104) (-2021.087) [-2020.508] * (-2019.140) [-2019.429] (-2019.947) (-2023.410) -- 0:01:03
      149000 -- (-2019.436) (-2021.231) (-2018.014) [-2021.292] * (-2020.924) (-2019.405) (-2021.624) [-2022.347] -- 0:01:02
      149500 -- (-2018.575) (-2018.912) [-2018.973] (-2019.216) * [-2019.544] (-2019.189) (-2018.530) (-2020.613) -- 0:01:02
      150000 -- [-2018.193] (-2018.930) (-2022.542) (-2019.328) * (-2019.768) [-2020.136] (-2018.250) (-2021.010) -- 0:01:02

      Average standard deviation of split frequencies: 0.028010

      150500 -- (-2018.902) (-2022.613) [-2024.596] (-2020.751) * [-2020.225] (-2019.303) (-2018.281) (-2021.063) -- 0:01:02
      151000 -- (-2019.451) (-2020.550) [-2023.284] (-2023.574) * [-2020.206] (-2019.335) (-2018.108) (-2019.363) -- 0:01:01
      151500 -- (-2019.014) (-2018.685) [-2021.333] (-2020.008) * (-2023.608) (-2019.089) (-2019.140) [-2020.991] -- 0:01:01
      152000 -- (-2018.024) (-2018.338) [-2021.017] (-2022.448) * [-2018.182] (-2027.622) (-2020.175) (-2022.487) -- 0:01:01
      152500 -- (-2020.045) (-2018.241) (-2020.794) [-2022.771] * (-2018.381) (-2025.105) [-2018.686] (-2022.719) -- 0:01:01
      153000 -- (-2018.817) (-2019.591) (-2023.074) [-2022.805] * [-2018.165] (-2019.244) (-2018.478) (-2022.209) -- 0:01:00
      153500 -- (-2024.220) [-2018.647] (-2018.143) (-2020.023) * (-2018.005) (-2019.078) [-2018.605] (-2023.305) -- 0:01:00
      154000 -- [-2021.714] (-2018.700) (-2021.182) (-2019.500) * (-2020.306) (-2021.305) [-2018.301] (-2022.180) -- 0:01:00
      154500 -- (-2019.665) (-2018.700) (-2020.494) [-2018.772] * (-2021.782) (-2018.624) (-2020.937) [-2022.101] -- 0:01:00
      155000 -- (-2019.004) (-2018.846) (-2022.406) [-2018.797] * (-2020.758) [-2019.237] (-2023.223) (-2020.661) -- 0:00:59

      Average standard deviation of split frequencies: 0.027499

      155500 -- (-2019.460) (-2018.371) (-2020.738) [-2018.574] * (-2017.925) (-2018.649) (-2021.762) [-2020.828] -- 0:00:59
      156000 -- (-2019.071) (-2018.496) (-2020.400) [-2019.306] * [-2018.394] (-2018.392) (-2022.357) (-2020.720) -- 0:00:59
      156500 -- [-2018.274] (-2019.235) (-2018.611) (-2020.031) * [-2018.133] (-2021.231) (-2022.977) (-2018.975) -- 0:00:59
      157000 -- (-2020.190) [-2021.047] (-2019.457) (-2019.792) * (-2020.139) [-2018.289] (-2019.234) (-2021.371) -- 0:00:59
      157500 -- (-2018.887) [-2019.213] (-2019.318) (-2024.838) * [-2018.390] (-2019.296) (-2020.522) (-2020.165) -- 0:00:58
      158000 -- (-2018.805) (-2018.628) (-2018.518) [-2021.605] * [-2021.239] (-2020.691) (-2027.391) (-2022.725) -- 0:00:58
      158500 -- (-2020.525) (-2018.544) (-2018.518) [-2021.528] * (-2020.034) [-2020.692] (-2029.327) (-2025.853) -- 0:00:58
      159000 -- (-2020.485) (-2018.719) [-2018.671] (-2019.628) * (-2020.176) (-2021.632) [-2019.567] (-2022.941) -- 0:00:58
      159500 -- (-2021.673) [-2018.410] (-2018.516) (-2020.615) * (-2022.115) (-2018.602) [-2020.031] (-2020.525) -- 0:00:57
      160000 -- (-2019.020) [-2019.035] (-2018.530) (-2023.062) * (-2019.829) (-2019.238) [-2019.962] (-2018.259) -- 0:00:57

      Average standard deviation of split frequencies: 0.027642

      160500 -- (-2018.449) (-2020.551) [-2021.449] (-2023.285) * (-2025.310) (-2020.622) (-2021.926) [-2018.259] -- 0:00:57
      161000 -- (-2018.753) (-2019.017) [-2021.422] (-2022.139) * [-2020.051] (-2020.645) (-2022.334) (-2020.189) -- 0:00:57
      161500 -- (-2018.376) (-2019.802) [-2018.419] (-2019.394) * (-2022.434) [-2019.236] (-2021.234) (-2018.399) -- 0:00:57
      162000 -- (-2018.761) (-2020.795) [-2018.337] (-2019.671) * (-2020.107) [-2020.641] (-2020.831) (-2018.756) -- 0:00:56
      162500 -- (-2018.353) (-2021.451) [-2018.864] (-2019.837) * (-2019.074) [-2022.265] (-2020.587) (-2019.567) -- 0:00:56
      163000 -- [-2019.137] (-2021.067) (-2018.442) (-2022.039) * (-2019.022) [-2020.663] (-2020.752) (-2020.255) -- 0:00:56
      163500 -- [-2018.460] (-2019.218) (-2019.792) (-2018.645) * [-2019.540] (-2023.535) (-2019.834) (-2020.990) -- 0:00:56
      164000 -- (-2018.890) (-2019.213) [-2019.414] (-2020.937) * (-2020.027) [-2023.436] (-2020.935) (-2021.299) -- 0:01:01
      164500 -- (-2019.990) [-2018.491] (-2018.534) (-2019.194) * (-2020.817) (-2021.806) (-2018.191) [-2019.247] -- 0:01:00
      165000 -- (-2019.990) (-2019.575) [-2018.588] (-2019.865) * (-2020.883) (-2021.706) [-2018.195] (-2019.778) -- 0:01:00

      Average standard deviation of split frequencies: 0.025708

      165500 -- (-2020.332) (-2020.050) [-2020.717] (-2019.859) * (-2020.633) (-2020.643) [-2019.456] (-2020.001) -- 0:01:00
      166000 -- [-2020.738] (-2019.999) (-2022.345) (-2019.861) * [-2019.819] (-2019.697) (-2020.867) (-2020.280) -- 0:01:00
      166500 -- (-2019.278) (-2020.020) [-2020.914] (-2018.803) * [-2022.637] (-2024.532) (-2019.656) (-2020.051) -- 0:01:00
      167000 -- [-2022.209] (-2021.967) (-2020.124) (-2021.188) * [-2019.303] (-2020.935) (-2020.502) (-2020.313) -- 0:00:59
      167500 -- (-2018.592) (-2022.590) (-2020.571) [-2019.595] * (-2020.175) (-2022.496) [-2021.420] (-2019.688) -- 0:00:59
      168000 -- (-2018.337) (-2020.571) (-2021.426) [-2022.158] * (-2019.519) [-2019.042] (-2018.255) (-2019.722) -- 0:00:59
      168500 -- (-2018.089) [-2018.902] (-2019.615) (-2024.555) * [-2021.670] (-2019.421) (-2018.255) (-2031.958) -- 0:00:59
      169000 -- (-2018.276) [-2018.936] (-2020.095) (-2019.941) * (-2025.583) [-2018.267] (-2019.015) (-2019.913) -- 0:00:59
      169500 -- (-2017.907) [-2021.350] (-2019.862) (-2020.833) * (-2024.140) (-2018.831) [-2018.378] (-2019.913) -- 0:00:58
      170000 -- [-2018.246] (-2018.019) (-2019.768) (-2020.854) * (-2026.986) (-2019.652) (-2019.201) [-2022.014] -- 0:00:58

      Average standard deviation of split frequencies: 0.025166

      170500 -- (-2021.016) (-2018.344) (-2020.332) [-2020.673] * (-2023.277) [-2019.365] (-2020.185) (-2021.653) -- 0:00:58
      171000 -- (-2020.621) [-2018.344] (-2020.588) (-2020.568) * (-2022.170) (-2019.316) [-2019.427] (-2021.051) -- 0:00:58
      171500 -- [-2020.769] (-2018.146) (-2020.131) (-2020.392) * (-2022.886) (-2019.438) (-2018.947) [-2021.568] -- 0:00:57
      172000 -- (-2020.774) (-2019.607) [-2020.236] (-2021.534) * [-2022.257] (-2020.523) (-2019.537) (-2022.087) -- 0:00:57
      172500 -- (-2019.539) (-2018.416) (-2021.130) [-2021.183] * [-2021.374] (-2018.284) (-2019.773) (-2020.683) -- 0:00:57
      173000 -- [-2020.465] (-2019.375) (-2019.719) (-2019.940) * (-2023.853) (-2018.419) [-2019.668] (-2019.847) -- 0:00:57
      173500 -- [-2020.738] (-2018.633) (-2019.012) (-2020.710) * (-2019.173) (-2018.211) [-2020.764] (-2020.707) -- 0:00:57
      174000 -- (-2020.163) [-2018.435] (-2023.891) (-2023.959) * (-2022.233) (-2023.712) (-2018.998) [-2018.208] -- 0:00:56
      174500 -- [-2021.427] (-2019.371) (-2019.315) (-2020.372) * (-2021.015) (-2022.788) (-2020.844) [-2021.954] -- 0:00:56
      175000 -- [-2023.199] (-2018.336) (-2020.456) (-2020.539) * (-2020.753) (-2019.801) (-2018.992) [-2021.039] -- 0:00:56

      Average standard deviation of split frequencies: 0.024106

      175500 -- (-2022.995) [-2019.054] (-2024.193) (-2020.446) * [-2020.754] (-2020.949) (-2019.032) (-2019.047) -- 0:00:56
      176000 -- (-2023.580) (-2018.969) [-2021.567] (-2021.369) * (-2019.111) [-2022.046] (-2019.262) (-2020.545) -- 0:00:56
      176500 -- (-2023.067) (-2020.733) (-2022.285) [-2022.225] * (-2019.537) (-2023.510) [-2021.112] (-2019.310) -- 0:00:55
      177000 -- [-2019.111] (-2020.771) (-2021.758) (-2020.729) * (-2020.992) [-2025.843] (-2021.572) (-2018.472) -- 0:00:55
      177500 -- (-2019.090) [-2021.214] (-2022.126) (-2020.327) * (-2019.832) (-2023.455) (-2019.717) [-2017.933] -- 0:00:55
      178000 -- (-2021.086) [-2019.268] (-2019.801) (-2021.373) * (-2021.877) [-2021.518] (-2021.216) (-2024.878) -- 0:00:55
      178500 -- (-2022.671) (-2019.836) (-2019.700) [-2019.814] * (-2021.791) (-2021.043) (-2020.944) [-2020.100] -- 0:00:59
      179000 -- (-2022.152) (-2020.557) (-2021.265) [-2019.736] * [-2021.338] (-2020.558) (-2024.217) (-2018.034) -- 0:00:59
      179500 -- (-2022.219) (-2019.820) [-2019.993] (-2018.016) * (-2019.830) (-2019.129) (-2024.838) [-2018.753] -- 0:00:59
      180000 -- (-2020.789) (-2021.753) (-2021.880) [-2019.357] * [-2019.593] (-2018.247) (-2023.997) (-2018.793) -- 0:00:59

      Average standard deviation of split frequencies: 0.023071

      180500 -- [-2020.230] (-2020.119) (-2020.353) (-2018.713) * [-2020.665] (-2018.722) (-2023.840) (-2018.603) -- 0:00:59
      181000 -- (-2020.275) (-2019.767) [-2018.958] (-2018.319) * [-2020.132] (-2020.535) (-2021.258) (-2021.981) -- 0:00:58
      181500 -- (-2019.086) (-2020.225) (-2020.718) [-2018.319] * (-2019.945) (-2023.276) (-2020.631) [-2021.175] -- 0:00:58
      182000 -- (-2020.626) [-2020.427] (-2019.779) (-2020.452) * (-2022.274) [-2020.233] (-2020.591) (-2023.764) -- 0:00:58
      182500 -- [-2022.429] (-2021.296) (-2020.331) (-2022.035) * (-2022.053) [-2019.442] (-2019.307) (-2022.000) -- 0:00:58
      183000 -- [-2018.550] (-2021.262) (-2020.331) (-2020.391) * [-2022.243] (-2018.491) (-2019.803) (-2021.123) -- 0:00:58
      183500 -- (-2019.585) (-2022.191) [-2023.739] (-2019.051) * (-2024.236) [-2020.632] (-2019.730) (-2020.159) -- 0:00:57
      184000 -- (-2019.821) (-2024.817) [-2020.701] (-2018.259) * (-2022.329) (-2020.167) [-2019.638] (-2020.868) -- 0:00:57
      184500 -- (-2022.258) (-2019.595) (-2020.766) [-2017.950] * [-2021.910] (-2019.218) (-2018.889) (-2019.807) -- 0:00:57
      185000 -- (-2021.096) [-2021.635] (-2021.978) (-2018.342) * (-2022.694) (-2019.283) (-2021.716) [-2019.891] -- 0:00:57

      Average standard deviation of split frequencies: 0.020909

      185500 -- (-2020.992) (-2020.285) (-2020.451) [-2018.739] * (-2020.067) (-2020.200) (-2024.255) [-2019.561] -- 0:00:57
      186000 -- (-2023.686) [-2020.893] (-2020.455) (-2022.543) * (-2020.642) (-2018.362) (-2024.840) [-2022.960] -- 0:00:56
      186500 -- (-2024.229) (-2022.348) (-2028.331) [-2021.693] * (-2018.771) (-2020.338) (-2025.947) [-2018.548] -- 0:00:56
      187000 -- [-2024.100] (-2020.364) (-2029.114) (-2018.620) * (-2023.115) (-2020.968) [-2022.516] (-2019.185) -- 0:00:56
      187500 -- (-2022.401) [-2021.263] (-2021.753) (-2020.848) * (-2023.770) (-2020.601) (-2018.867) [-2019.085] -- 0:00:56
      188000 -- (-2022.471) (-2021.727) (-2020.821) [-2021.004] * (-2019.465) (-2019.311) [-2020.373] (-2022.075) -- 0:00:56
      188500 -- (-2021.005) (-2022.961) [-2019.522] (-2020.892) * (-2019.814) [-2019.372] (-2020.349) (-2021.478) -- 0:00:55
      189000 -- (-2022.958) (-2023.731) (-2019.303) [-2018.206] * (-2022.425) [-2018.825] (-2019.757) (-2018.970) -- 0:00:55
      189500 -- (-2023.262) (-2023.699) (-2022.547) [-2018.783] * (-2019.847) (-2018.509) (-2020.326) [-2019.593] -- 0:00:55
      190000 -- (-2024.183) (-2024.454) (-2019.678) [-2019.075] * (-2021.280) (-2018.548) [-2020.044] (-2020.971) -- 0:00:55

      Average standard deviation of split frequencies: 0.020521

      190500 -- (-2023.809) (-2021.736) (-2018.578) [-2020.281] * [-2020.301] (-2017.938) (-2023.099) (-2020.164) -- 0:00:55
      191000 -- [-2024.148] (-2021.710) (-2018.672) (-2019.793) * (-2020.595) [-2019.838] (-2022.409) (-2021.282) -- 0:00:55
      191500 -- (-2028.700) (-2022.750) (-2019.053) [-2024.108] * (-2020.676) [-2019.030] (-2022.961) (-2022.072) -- 0:00:54
      192000 -- (-2019.960) (-2021.705) (-2023.347) [-2018.312] * [-2019.515] (-2018.993) (-2022.595) (-2020.159) -- 0:00:58
      192500 -- (-2021.028) (-2022.513) [-2018.426] (-2021.379) * (-2018.937) (-2019.263) (-2019.264) [-2020.289] -- 0:00:58
      193000 -- (-2019.188) [-2018.995] (-2019.170) (-2020.177) * [-2020.520] (-2021.722) (-2019.041) (-2020.465) -- 0:00:58
      193500 -- [-2021.670] (-2019.692) (-2019.168) (-2019.460) * (-2020.781) (-2030.829) (-2020.194) [-2020.440] -- 0:00:58
      194000 -- (-2019.421) (-2021.023) (-2018.735) [-2019.749] * (-2018.734) [-2021.250] (-2018.930) (-2020.540) -- 0:00:58
      194500 -- (-2019.910) (-2018.751) [-2021.244] (-2019.428) * [-2018.705] (-2025.423) (-2019.941) (-2018.595) -- 0:00:57
      195000 -- (-2020.485) [-2018.913] (-2023.429) (-2021.421) * [-2019.078] (-2025.530) (-2018.461) (-2018.419) -- 0:00:57

      Average standard deviation of split frequencies: 0.018735

      195500 -- (-2021.072) [-2018.471] (-2021.429) (-2021.388) * (-2019.084) [-2020.999] (-2018.803) (-2018.538) -- 0:00:57
      196000 -- (-2023.513) [-2018.683] (-2018.689) (-2020.889) * [-2021.149] (-2020.357) (-2022.596) (-2019.639) -- 0:00:57
      196500 -- (-2022.262) [-2018.548] (-2021.729) (-2018.806) * [-2021.810] (-2021.149) (-2024.171) (-2018.554) -- 0:00:57
      197000 -- (-2019.579) (-2019.633) (-2018.199) [-2019.547] * [-2022.325] (-2020.486) (-2021.193) (-2020.624) -- 0:00:57
      197500 -- (-2021.650) (-2019.437) [-2018.189] (-2018.566) * (-2019.795) (-2018.438) (-2019.549) [-2018.601] -- 0:00:56
      198000 -- (-2019.286) (-2021.450) (-2019.042) [-2018.768] * (-2019.605) (-2018.593) (-2020.391) [-2018.703] -- 0:00:56
      198500 -- (-2020.747) (-2023.484) (-2021.094) [-2020.085] * (-2020.142) [-2019.996] (-2021.473) (-2020.254) -- 0:00:56
      199000 -- (-2018.668) (-2023.780) [-2021.094] (-2021.590) * [-2020.743] (-2019.264) (-2020.591) (-2019.943) -- 0:00:56
      199500 -- (-2019.535) [-2023.233] (-2023.523) (-2021.110) * (-2021.526) (-2022.185) (-2021.592) [-2018.783] -- 0:00:56
      200000 -- (-2019.599) (-2022.609) [-2020.714] (-2022.339) * (-2025.092) (-2022.171) [-2021.861] (-2021.431) -- 0:00:55

      Average standard deviation of split frequencies: 0.018052

      200500 -- [-2020.798] (-2018.769) (-2020.857) (-2021.717) * [-2020.585] (-2027.317) (-2023.806) (-2019.995) -- 0:00:55
      201000 -- (-2020.014) [-2018.500] (-2020.516) (-2022.507) * (-2021.315) (-2018.471) [-2020.940] (-2020.671) -- 0:00:55
      201500 -- (-2024.636) (-2018.537) [-2020.934] (-2022.250) * (-2021.991) (-2019.206) [-2020.865] (-2019.271) -- 0:00:55
      202000 -- (-2020.677) (-2019.515) (-2020.143) [-2020.222] * (-2019.023) [-2019.827] (-2020.085) (-2018.807) -- 0:00:55
      202500 -- (-2018.417) [-2022.804] (-2020.833) (-2018.952) * (-2019.295) (-2021.548) [-2019.022] (-2022.504) -- 0:00:55
      203000 -- (-2023.782) [-2020.724] (-2020.130) (-2020.659) * [-2018.241] (-2020.381) (-2019.471) (-2019.787) -- 0:00:54
      203500 -- (-2019.233) [-2019.990] (-2022.630) (-2020.798) * (-2020.039) [-2019.597] (-2019.261) (-2019.756) -- 0:00:54
      204000 -- [-2021.831] (-2019.990) (-2019.200) (-2021.393) * (-2020.068) (-2022.721) (-2021.241) [-2019.934] -- 0:00:54
      204500 -- (-2019.888) [-2021.579] (-2018.979) (-2020.766) * (-2019.847) (-2022.196) [-2019.664] (-2022.019) -- 0:00:54
      205000 -- (-2021.095) (-2020.007) [-2019.291] (-2020.780) * (-2019.237) (-2022.876) (-2020.646) [-2019.175] -- 0:00:54

      Average standard deviation of split frequencies: 0.016705

      205500 -- (-2019.677) [-2019.359] (-2019.268) (-2022.494) * (-2021.590) (-2021.048) (-2020.680) [-2018.634] -- 0:00:57
      206000 -- (-2018.455) [-2021.354] (-2018.608) (-2025.226) * (-2023.669) (-2020.347) [-2022.432] (-2018.750) -- 0:00:57
      206500 -- (-2020.614) [-2020.839] (-2018.628) (-2021.695) * (-2030.787) (-2019.587) [-2019.699] (-2019.933) -- 0:00:57
      207000 -- [-2020.067] (-2023.941) (-2020.123) (-2022.302) * (-2024.234) (-2018.855) (-2020.108) [-2019.051] -- 0:00:57
      207500 -- (-2018.296) (-2019.717) [-2020.361] (-2020.454) * [-2023.921] (-2018.855) (-2020.916) (-2019.059) -- 0:00:57
      208000 -- (-2024.395) (-2021.288) (-2021.815) [-2018.225] * (-2019.824) (-2024.208) (-2019.743) [-2020.352] -- 0:00:57
      208500 -- (-2023.137) (-2022.809) (-2020.548) [-2018.379] * (-2021.780) (-2021.727) [-2020.679] (-2021.523) -- 0:00:56
      209000 -- (-2019.069) [-2019.700] (-2019.166) (-2019.210) * (-2020.880) (-2023.812) (-2023.225) [-2023.169] -- 0:00:56
      209500 -- [-2019.157] (-2021.324) (-2020.253) (-2020.829) * (-2021.116) [-2022.197] (-2023.010) (-2019.660) -- 0:00:56
      210000 -- (-2019.745) (-2024.377) (-2021.131) [-2024.874] * (-2020.199) (-2019.561) (-2019.632) [-2020.447] -- 0:00:56

      Average standard deviation of split frequencies: 0.015440

      210500 -- (-2019.687) (-2022.330) [-2021.108] (-2023.050) * (-2020.678) (-2020.023) [-2020.866] (-2021.083) -- 0:00:56
      211000 -- (-2021.506) [-2020.515] (-2019.808) (-2022.804) * (-2023.029) (-2022.838) (-2020.011) [-2020.081] -- 0:00:56
      211500 -- (-2019.564) (-2020.515) (-2020.314) [-2024.304] * (-2022.256) (-2022.124) [-2018.590] (-2020.089) -- 0:00:55
      212000 -- (-2021.643) (-2023.446) [-2020.107] (-2023.228) * [-2019.616] (-2021.370) (-2018.577) (-2018.846) -- 0:00:55
      212500 -- [-2027.877] (-2027.845) (-2019.854) (-2020.020) * (-2019.934) (-2020.459) [-2019.037] (-2018.734) -- 0:00:55
      213000 -- (-2029.428) (-2025.770) [-2019.651] (-2020.848) * (-2020.234) (-2020.460) (-2018.884) [-2018.608] -- 0:00:55
      213500 -- [-2019.504] (-2028.076) (-2022.110) (-2018.875) * (-2020.382) (-2021.880) (-2019.127) [-2018.387] -- 0:00:55
      214000 -- (-2018.791) (-2021.894) (-2023.404) [-2020.321] * (-2020.026) [-2020.770] (-2018.900) (-2020.461) -- 0:00:55
      214500 -- (-2020.846) (-2020.078) [-2023.195] (-2021.882) * (-2019.975) (-2021.808) (-2018.880) [-2019.202] -- 0:00:54
      215000 -- (-2020.593) [-2024.117] (-2020.098) (-2019.434) * (-2019.975) (-2021.754) [-2018.925] (-2018.748) -- 0:00:54

      Average standard deviation of split frequencies: 0.016914

      215500 -- (-2020.039) (-2022.000) [-2022.202] (-2020.261) * (-2019.778) (-2022.673) (-2017.981) [-2018.393] -- 0:00:54
      216000 -- [-2019.412] (-2018.396) (-2019.826) (-2019.944) * (-2021.544) (-2020.340) [-2019.123] (-2019.552) -- 0:00:54
      216500 -- [-2020.340] (-2018.710) (-2022.363) (-2020.032) * (-2020.139) [-2020.695] (-2020.247) (-2020.321) -- 0:00:54
      217000 -- (-2021.160) [-2018.594] (-2025.261) (-2020.090) * (-2020.539) [-2021.048] (-2020.239) (-2020.068) -- 0:00:54
      217500 -- (-2020.548) (-2023.591) (-2021.647) [-2018.715] * (-2020.239) (-2022.256) [-2019.642] (-2018.399) -- 0:00:53
      218000 -- (-2021.260) (-2020.588) [-2019.918] (-2019.062) * (-2021.608) (-2020.266) [-2021.126] (-2019.822) -- 0:00:53
      218500 -- (-2024.042) (-2020.525) [-2020.318] (-2018.927) * (-2020.701) (-2018.794) [-2018.111] (-2019.689) -- 0:00:53
      219000 -- (-2021.891) (-2019.849) [-2022.102] (-2021.115) * (-2020.444) (-2019.261) [-2018.057] (-2022.057) -- 0:00:53
      219500 -- (-2019.613) (-2018.178) [-2018.790] (-2020.289) * [-2020.900] (-2019.681) (-2018.289) (-2022.120) -- 0:00:53
      220000 -- (-2019.978) (-2019.767) (-2019.234) [-2020.560] * (-2020.823) [-2020.218] (-2020.394) (-2019.373) -- 0:00:53

      Average standard deviation of split frequencies: 0.018586

      220500 -- [-2020.464] (-2019.565) (-2018.958) (-2019.405) * (-2020.998) (-2020.366) [-2018.920] (-2023.608) -- 0:00:56
      221000 -- (-2021.486) [-2019.667] (-2019.102) (-2018.918) * (-2023.382) [-2021.392] (-2022.029) (-2020.830) -- 0:00:56
      221500 -- (-2027.003) (-2019.076) (-2019.855) [-2019.160] * [-2020.526] (-2021.001) (-2021.455) (-2020.534) -- 0:00:56
      222000 -- (-2032.156) (-2019.370) [-2019.188] (-2018.772) * (-2019.580) [-2022.351] (-2020.069) (-2024.378) -- 0:00:56
      222500 -- (-2024.946) [-2020.962] (-2019.162) (-2018.445) * (-2019.607) (-2020.302) [-2021.008] (-2021.162) -- 0:00:55
      223000 -- (-2018.656) (-2021.343) (-2021.737) [-2018.527] * (-2019.626) (-2019.562) [-2019.105] (-2023.091) -- 0:00:55
      223500 -- (-2021.497) [-2020.450] (-2024.282) (-2021.603) * (-2018.873) [-2018.770] (-2020.013) (-2019.894) -- 0:00:55
      224000 -- [-2021.618] (-2020.950) (-2019.908) (-2018.828) * (-2019.700) [-2018.710] (-2019.179) (-2019.564) -- 0:00:55
      224500 -- (-2023.369) [-2019.708] (-2019.272) (-2020.599) * (-2019.252) (-2020.140) (-2019.594) [-2021.964] -- 0:00:55
      225000 -- (-2021.116) (-2019.038) (-2018.723) [-2018.352] * (-2019.233) (-2021.309) (-2019.873) [-2023.984] -- 0:00:55

      Average standard deviation of split frequencies: 0.017730

      225500 -- (-2021.098) (-2018.710) [-2020.999] (-2023.427) * (-2018.723) (-2019.931) (-2022.902) [-2020.036] -- 0:00:54
      226000 -- [-2023.275] (-2018.573) (-2021.316) (-2021.414) * (-2018.921) [-2022.183] (-2026.014) (-2019.961) -- 0:00:54
      226500 -- (-2020.587) (-2019.214) (-2021.155) [-2018.302] * (-2019.748) [-2023.170] (-2028.227) (-2019.799) -- 0:00:54
      227000 -- [-2020.390] (-2019.669) (-2021.238) (-2022.135) * (-2020.233) (-2024.706) (-2020.721) [-2019.009] -- 0:00:54
      227500 -- (-2024.843) (-2022.476) (-2023.553) [-2021.156] * (-2021.756) (-2023.597) (-2020.329) [-2018.443] -- 0:00:54
      228000 -- (-2020.401) (-2022.974) (-2023.876) [-2019.384] * (-2023.706) (-2021.518) [-2020.327] (-2018.953) -- 0:00:54
      228500 -- (-2020.492) (-2020.079) [-2020.693] (-2019.127) * [-2021.940] (-2022.223) (-2019.346) (-2019.159) -- 0:00:54
      229000 -- [-2021.806] (-2025.845) (-2024.891) (-2024.990) * [-2019.509] (-2024.871) (-2019.595) (-2019.949) -- 0:00:53
      229500 -- (-2022.782) (-2023.495) [-2018.800] (-2024.743) * [-2019.283] (-2025.198) (-2019.901) (-2021.732) -- 0:00:53
      230000 -- (-2022.119) (-2020.688) [-2018.575] (-2021.595) * (-2023.719) (-2024.541) [-2020.143] (-2021.008) -- 0:00:53

      Average standard deviation of split frequencies: 0.016564

      230500 -- (-2021.448) [-2022.625] (-2018.305) (-2022.030) * (-2022.128) (-2023.280) (-2020.263) [-2022.418] -- 0:00:53
      231000 -- (-2025.142) [-2020.252] (-2019.630) (-2019.753) * [-2022.273] (-2021.319) (-2020.035) (-2022.947) -- 0:00:53
      231500 -- (-2021.808) (-2018.476) [-2018.691] (-2022.147) * (-2022.742) [-2020.682] (-2020.201) (-2022.437) -- 0:00:53
      232000 -- (-2023.655) (-2018.926) (-2020.562) [-2021.973] * (-2018.199) (-2018.516) (-2020.317) [-2022.766] -- 0:00:52
      232500 -- (-2019.453) (-2021.384) (-2022.342) [-2019.832] * (-2019.827) (-2020.619) (-2020.552) [-2023.000] -- 0:00:52
      233000 -- (-2019.438) [-2019.724] (-2025.477) (-2019.225) * (-2020.892) (-2019.783) (-2022.279) [-2023.101] -- 0:00:52
      233500 -- (-2018.859) (-2019.538) [-2020.032] (-2019.157) * [-2020.375] (-2019.850) (-2020.096) (-2021.612) -- 0:00:52
      234000 -- (-2018.951) [-2018.803] (-2020.675) (-2018.457) * [-2018.650] (-2017.997) (-2020.536) (-2025.456) -- 0:00:52
      234500 -- (-2018.679) (-2018.635) [-2024.006] (-2020.281) * (-2018.775) [-2018.075] (-2022.411) (-2020.905) -- 0:00:52
      235000 -- (-2021.160) (-2018.877) (-2022.322) [-2021.717] * (-2021.473) (-2019.724) (-2019.357) [-2021.352] -- 0:00:52

      Average standard deviation of split frequencies: 0.016400

      235500 -- [-2019.983] (-2020.227) (-2022.982) (-2020.718) * (-2026.593) (-2019.736) (-2018.909) [-2019.476] -- 0:00:55
      236000 -- (-2018.125) [-2022.105] (-2022.002) (-2021.441) * (-2025.269) [-2018.097] (-2018.848) (-2020.368) -- 0:00:55
      236500 -- [-2019.806] (-2019.630) (-2022.359) (-2021.389) * (-2021.747) [-2018.317] (-2018.005) (-2019.720) -- 0:00:54
      237000 -- (-2019.790) (-2018.526) (-2020.934) [-2020.853] * (-2022.797) [-2018.502] (-2021.933) (-2019.622) -- 0:00:54
      237500 -- (-2020.664) [-2018.583] (-2019.043) (-2024.576) * [-2022.206] (-2019.060) (-2023.035) (-2024.232) -- 0:00:54
      238000 -- [-2019.496] (-2021.501) (-2019.320) (-2020.801) * [-2019.954] (-2020.132) (-2020.763) (-2021.092) -- 0:00:54
      238500 -- (-2019.828) (-2018.953) (-2020.118) [-2020.113] * (-2021.589) (-2021.863) (-2019.728) [-2019.827] -- 0:00:54
      239000 -- (-2024.487) (-2020.653) [-2019.528] (-2020.112) * [-2021.311] (-2019.950) (-2019.235) (-2019.695) -- 0:00:54
      239500 -- (-2022.935) (-2020.080) (-2022.062) [-2019.291] * (-2019.485) [-2018.842] (-2018.920) (-2019.985) -- 0:00:53
      240000 -- (-2022.232) [-2019.661] (-2023.837) (-2026.021) * (-2019.250) [-2019.145] (-2019.168) (-2020.830) -- 0:00:53

      Average standard deviation of split frequencies: 0.016082

      240500 -- (-2019.940) (-2019.638) [-2019.698] (-2024.050) * (-2018.818) [-2019.857] (-2018.354) (-2019.170) -- 0:00:53
      241000 -- [-2020.205] (-2024.486) (-2018.898) (-2020.601) * (-2018.859) (-2020.434) [-2018.886] (-2020.240) -- 0:00:53
      241500 -- [-2024.827] (-2026.102) (-2018.713) (-2022.171) * [-2026.502] (-2021.866) (-2018.138) (-2022.601) -- 0:00:53
      242000 -- [-2021.298] (-2023.479) (-2021.343) (-2020.320) * (-2019.448) (-2019.556) [-2019.534] (-2019.225) -- 0:00:53
      242500 -- (-2022.817) (-2020.279) (-2021.983) [-2019.909] * [-2026.042] (-2020.590) (-2019.710) (-2019.322) -- 0:00:53
      243000 -- [-2019.985] (-2025.028) (-2021.854) (-2019.910) * (-2023.240) (-2021.534) [-2019.232] (-2019.450) -- 0:00:52
      243500 -- (-2018.933) (-2020.600) (-2021.957) [-2021.394] * [-2022.322] (-2020.663) (-2018.490) (-2021.094) -- 0:00:52
      244000 -- (-2018.654) (-2019.210) [-2020.312] (-2020.201) * (-2019.875) (-2020.110) [-2020.799] (-2021.980) -- 0:00:52
      244500 -- (-2020.220) (-2021.280) (-2024.234) [-2021.143] * (-2019.564) (-2019.602) [-2018.294] (-2020.698) -- 0:00:52
      245000 -- (-2018.732) (-2019.954) [-2020.258] (-2021.483) * (-2019.636) (-2020.461) [-2018.164] (-2019.239) -- 0:00:52

      Average standard deviation of split frequencies: 0.014624

      245500 -- (-2018.760) (-2020.187) [-2020.523] (-2023.916) * [-2026.135] (-2022.714) (-2018.181) (-2020.534) -- 0:00:52
      246000 -- (-2020.111) (-2019.744) [-2019.756] (-2021.435) * [-2019.352] (-2020.959) (-2018.576) (-2020.355) -- 0:00:52
      246500 -- (-2019.484) (-2019.698) [-2024.102] (-2024.085) * (-2018.525) [-2018.409] (-2018.151) (-2020.950) -- 0:00:51
      247000 -- (-2021.373) (-2019.744) (-2023.485) [-2019.734] * (-2019.065) [-2021.385] (-2018.873) (-2019.157) -- 0:00:51
      247500 -- (-2018.992) [-2020.057] (-2022.028) (-2019.012) * (-2021.051) (-2020.537) (-2018.767) [-2018.973] -- 0:00:51
      248000 -- (-2020.219) (-2020.130) [-2018.960] (-2021.531) * [-2021.051] (-2019.813) (-2018.066) (-2018.623) -- 0:00:51
      248500 -- [-2018.173] (-2019.928) (-2019.155) (-2020.864) * (-2019.295) (-2018.926) [-2020.040] (-2019.110) -- 0:00:51
      249000 -- (-2019.427) (-2020.396) (-2019.582) [-2018.697] * [-2019.295] (-2020.273) (-2023.935) (-2019.039) -- 0:00:51
      249500 -- (-2020.682) (-2021.972) [-2019.749] (-2020.506) * (-2020.398) [-2020.048] (-2022.708) (-2018.798) -- 0:00:51
      250000 -- (-2020.354) (-2020.730) (-2021.588) [-2022.668] * (-2020.411) [-2019.046] (-2025.545) (-2020.145) -- 0:00:51

      Average standard deviation of split frequencies: 0.014946

      250500 -- (-2019.603) [-2022.208] (-2021.692) (-2022.156) * (-2018.848) (-2019.178) (-2024.048) [-2023.880] -- 0:00:50
      251000 -- (-2017.965) (-2020.929) [-2019.572] (-2019.612) * [-2023.009] (-2020.349) (-2020.112) (-2020.286) -- 0:00:53
      251500 -- (-2020.682) (-2020.048) (-2023.410) [-2019.237] * (-2021.937) (-2022.478) [-2027.138] (-2020.529) -- 0:00:53
      252000 -- [-2021.809] (-2021.489) (-2020.036) (-2019.630) * (-2021.955) [-2018.603] (-2025.583) (-2021.158) -- 0:00:53
      252500 -- [-2020.095] (-2021.405) (-2021.517) (-2018.714) * [-2020.518] (-2019.074) (-2021.043) (-2022.107) -- 0:00:53
      253000 -- (-2019.378) (-2020.746) (-2022.412) [-2019.519] * (-2019.394) (-2019.385) (-2019.873) [-2020.690] -- 0:00:53
      253500 -- (-2020.637) [-2022.326] (-2019.506) (-2019.530) * (-2019.392) [-2018.430] (-2020.432) (-2023.964) -- 0:00:53
      254000 -- (-2020.653) (-2023.971) (-2023.831) [-2019.765] * (-2018.945) (-2019.642) [-2020.338] (-2019.549) -- 0:00:52
      254500 -- [-2021.369] (-2025.544) (-2020.489) (-2022.278) * (-2020.066) (-2020.203) (-2019.804) [-2019.685] -- 0:00:52
      255000 -- (-2019.932) (-2023.660) [-2018.980] (-2018.673) * (-2019.524) (-2019.991) [-2020.850] (-2020.916) -- 0:00:52

      Average standard deviation of split frequencies: 0.013973

      255500 -- (-2023.585) (-2024.564) [-2019.445] (-2019.264) * [-2019.017] (-2019.934) (-2022.034) (-2019.570) -- 0:00:52
      256000 -- [-2018.873] (-2024.890) (-2020.660) (-2018.421) * [-2028.560] (-2019.361) (-2020.176) (-2019.541) -- 0:00:52
      256500 -- (-2019.628) (-2021.941) [-2021.753] (-2018.909) * (-2022.959) [-2019.264] (-2020.018) (-2019.198) -- 0:00:52
      257000 -- (-2018.845) (-2022.725) (-2022.045) [-2019.443] * (-2022.949) (-2020.012) [-2021.212] (-2021.151) -- 0:00:52
      257500 -- (-2020.519) (-2019.848) [-2020.837] (-2021.127) * (-2023.042) (-2020.645) (-2024.735) [-2021.397] -- 0:00:51
      258000 -- (-2019.655) (-2019.477) (-2021.832) [-2019.859] * (-2019.926) (-2022.301) (-2020.730) [-2020.444] -- 0:00:51
      258500 -- (-2019.758) [-2018.843] (-2020.110) (-2019.888) * (-2019.964) [-2021.915] (-2021.798) (-2017.893) -- 0:00:51
      259000 -- (-2022.827) (-2019.587) (-2019.245) [-2023.323] * (-2020.923) [-2021.740] (-2018.873) (-2018.366) -- 0:00:51
      259500 -- (-2022.444) (-2019.451) [-2020.066] (-2021.357) * (-2020.670) (-2021.132) (-2019.593) [-2018.923] -- 0:00:51
      260000 -- (-2023.502) [-2020.212] (-2019.891) (-2018.585) * (-2020.398) (-2022.369) [-2020.686] (-2018.915) -- 0:00:51

      Average standard deviation of split frequencies: 0.013723

      260500 -- [-2020.503] (-2020.417) (-2020.321) (-2018.456) * (-2021.663) (-2021.966) (-2020.188) [-2018.910] -- 0:00:51
      261000 -- (-2020.542) (-2020.061) (-2019.182) [-2018.767] * (-2018.690) (-2023.180) [-2019.196] (-2020.145) -- 0:00:50
      261500 -- (-2019.796) (-2019.867) [-2019.436] (-2022.752) * (-2025.774) (-2024.589) (-2019.739) [-2018.504] -- 0:00:50
      262000 -- (-2020.781) (-2020.361) (-2019.918) [-2021.761] * (-2019.778) (-2022.050) (-2019.508) [-2018.488] -- 0:00:50
      262500 -- (-2020.104) (-2019.266) [-2018.359] (-2023.893) * [-2020.020] (-2019.870) (-2018.978) (-2018.949) -- 0:00:50
      263000 -- (-2018.654) [-2022.046] (-2020.974) (-2023.787) * (-2019.886) (-2020.021) (-2020.242) [-2019.269] -- 0:00:50
      263500 -- [-2019.264] (-2024.911) (-2018.944) (-2024.181) * [-2020.535] (-2018.867) (-2021.708) (-2019.437) -- 0:00:50
      264000 -- (-2019.282) (-2020.739) [-2018.536] (-2020.754) * (-2020.558) (-2023.582) [-2020.491] (-2019.021) -- 0:00:50
      264500 -- (-2019.250) (-2019.123) (-2019.693) [-2025.040] * (-2019.370) (-2020.208) [-2021.188] (-2020.017) -- 0:00:50
      265000 -- (-2019.354) (-2019.526) (-2021.623) [-2026.510] * (-2023.223) (-2022.516) [-2020.018] (-2020.612) -- 0:00:49

      Average standard deviation of split frequencies: 0.014907

      265500 -- (-2019.354) [-2019.229] (-2022.873) (-2019.304) * (-2021.519) (-2022.005) [-2019.239] (-2018.825) -- 0:00:49
      266000 -- [-2021.778] (-2019.226) (-2022.361) (-2020.934) * (-2022.560) (-2019.111) [-2019.291] (-2017.831) -- 0:00:49
      266500 -- (-2018.861) (-2019.620) [-2023.536] (-2020.950) * (-2024.613) [-2021.688] (-2021.014) (-2017.957) -- 0:00:52
      267000 -- [-2019.163] (-2021.175) (-2019.833) (-2018.492) * [-2021.574] (-2022.740) (-2020.387) (-2019.614) -- 0:00:52
      267500 -- (-2018.535) [-2020.703] (-2025.967) (-2018.428) * (-2022.815) [-2023.112] (-2021.907) (-2020.474) -- 0:00:52
      268000 -- (-2018.566) [-2020.173] (-2019.331) (-2018.213) * (-2018.840) (-2023.225) (-2021.770) [-2018.178] -- 0:00:51
      268500 -- (-2020.227) (-2018.783) [-2020.897] (-2018.512) * (-2020.783) (-2021.676) (-2030.065) [-2018.295] -- 0:00:51
      269000 -- (-2018.745) (-2018.697) (-2019.860) [-2018.789] * (-2027.692) (-2021.886) (-2019.671) [-2018.298] -- 0:00:51
      269500 -- [-2019.786] (-2019.115) (-2019.578) (-2018.973) * (-2021.746) (-2021.060) [-2019.740] (-2018.759) -- 0:00:51
      270000 -- (-2018.582) (-2019.216) [-2019.212] (-2021.771) * (-2021.576) (-2021.181) [-2020.138] (-2019.336) -- 0:00:51

      Average standard deviation of split frequencies: 0.014548

      270500 -- (-2020.516) (-2020.641) (-2021.584) [-2022.094] * [-2019.746] (-2020.683) (-2022.606) (-2018.912) -- 0:00:51
      271000 -- (-2020.622) [-2021.092] (-2020.151) (-2021.085) * [-2018.763] (-2019.594) (-2022.553) (-2019.845) -- 0:00:51
      271500 -- [-2024.305] (-2023.746) (-2022.045) (-2021.433) * (-2018.492) (-2021.304) (-2027.317) [-2023.603] -- 0:00:50
      272000 -- [-2019.767] (-2021.172) (-2020.209) (-2020.493) * [-2018.365] (-2021.101) (-2020.508) (-2025.023) -- 0:00:50
      272500 -- [-2018.806] (-2019.625) (-2020.173) (-2020.142) * (-2018.587) [-2019.679] (-2019.932) (-2021.185) -- 0:00:50
      273000 -- (-2019.384) [-2018.946] (-2020.126) (-2022.373) * (-2018.829) [-2021.277] (-2019.544) (-2020.641) -- 0:00:50
      273500 -- [-2018.829] (-2019.894) (-2020.756) (-2020.240) * (-2021.074) [-2020.465] (-2020.151) (-2019.305) -- 0:00:50
      274000 -- (-2022.439) [-2021.585] (-2022.340) (-2019.792) * [-2023.466] (-2020.709) (-2019.158) (-2023.427) -- 0:00:50
      274500 -- [-2020.574] (-2020.668) (-2021.000) (-2020.284) * (-2023.628) [-2020.186] (-2019.765) (-2018.747) -- 0:00:50
      275000 -- (-2020.438) (-2020.630) [-2020.729] (-2019.243) * (-2018.369) (-2019.407) [-2018.151] (-2018.759) -- 0:00:50

      Average standard deviation of split frequencies: 0.015271

      275500 -- (-2019.791) (-2019.810) (-2024.589) [-2020.390] * (-2019.236) (-2024.596) (-2018.418) [-2018.663] -- 0:00:49
      276000 -- (-2019.764) (-2026.258) (-2024.465) [-2020.196] * [-2019.446] (-2022.111) (-2018.757) (-2018.587) -- 0:00:49
      276500 -- (-2022.124) [-2026.862] (-2025.210) (-2020.652) * (-2019.217) (-2021.134) [-2019.921] (-2025.309) -- 0:00:49
      277000 -- [-2022.401] (-2023.043) (-2024.697) (-2021.861) * (-2018.537) (-2019.145) [-2020.092] (-2025.059) -- 0:00:49
      277500 -- (-2019.081) (-2026.350) [-2023.813] (-2019.768) * (-2022.082) (-2018.371) [-2019.938] (-2024.243) -- 0:00:49
      278000 -- (-2019.672) [-2023.054] (-2023.031) (-2020.044) * (-2018.638) (-2018.197) [-2020.842] (-2019.649) -- 0:00:49
      278500 -- (-2019.707) [-2021.610] (-2024.116) (-2023.405) * (-2020.205) (-2019.642) [-2023.354] (-2021.470) -- 0:00:49
      279000 -- (-2022.383) (-2019.537) (-2022.476) [-2021.097] * (-2022.095) [-2019.533] (-2022.137) (-2020.432) -- 0:00:49
      279500 -- [-2018.817] (-2019.686) (-2023.138) (-2020.659) * [-2021.744] (-2018.612) (-2020.149) (-2020.057) -- 0:00:48
      280000 -- (-2020.011) (-2019.648) (-2018.787) [-2019.780] * (-2021.258) (-2019.333) [-2020.203] (-2023.175) -- 0:00:48

      Average standard deviation of split frequencies: 0.014030

      280500 -- (-2023.354) (-2022.584) (-2021.460) [-2022.209] * (-2024.484) (-2021.391) [-2021.017] (-2021.311) -- 0:00:48
      281000 -- (-2019.721) (-2024.200) (-2020.845) [-2023.809] * (-2018.875) [-2021.628] (-2021.219) (-2020.604) -- 0:00:48
      281500 -- [-2019.223] (-2024.242) (-2021.501) (-2021.460) * (-2019.958) (-2022.910) [-2021.358] (-2019.557) -- 0:00:51
      282000 -- [-2018.542] (-2024.518) (-2021.720) (-2021.290) * (-2020.442) (-2025.213) (-2020.100) [-2020.418] -- 0:00:50
      282500 -- (-2019.159) [-2017.962] (-2020.338) (-2023.189) * (-2019.865) (-2020.579) (-2019.578) [-2020.450] -- 0:00:50
      283000 -- [-2021.385] (-2019.153) (-2021.205) (-2021.985) * (-2022.283) (-2020.630) (-2020.314) [-2018.794] -- 0:00:50
      283500 -- [-2018.079] (-2018.488) (-2018.825) (-2022.031) * [-2020.413] (-2021.255) (-2021.232) (-2019.535) -- 0:00:50
      284000 -- (-2018.321) [-2018.095] (-2023.429) (-2022.733) * (-2020.367) [-2021.800] (-2022.239) (-2019.529) -- 0:00:50
      284500 -- [-2018.594] (-2018.117) (-2020.971) (-2023.826) * [-2020.377] (-2021.244) (-2024.166) (-2019.995) -- 0:00:50
      285000 -- (-2018.238) [-2019.021] (-2019.658) (-2018.378) * (-2021.331) [-2021.628] (-2020.203) (-2022.125) -- 0:00:50

      Average standard deviation of split frequencies: 0.013089

      285500 -- (-2018.216) [-2019.748] (-2019.894) (-2019.039) * (-2022.432) (-2020.526) (-2021.654) [-2020.659] -- 0:00:50
      286000 -- (-2018.448) (-2018.829) (-2022.226) [-2020.029] * [-2019.272] (-2019.525) (-2021.503) (-2020.592) -- 0:00:49
      286500 -- (-2020.077) (-2018.354) [-2022.131] (-2020.448) * (-2019.943) [-2019.928] (-2020.964) (-2021.146) -- 0:00:49
      287000 -- (-2021.122) (-2018.599) (-2022.445) [-2019.512] * (-2019.980) [-2021.247] (-2022.094) (-2020.241) -- 0:00:49
      287500 -- (-2025.308) [-2019.757] (-2021.170) (-2020.951) * (-2020.742) (-2019.757) [-2020.484] (-2022.911) -- 0:00:49
      288000 -- (-2025.003) [-2025.706] (-2023.746) (-2020.599) * (-2021.524) [-2020.463] (-2018.933) (-2024.552) -- 0:00:49
      288500 -- (-2026.896) [-2019.489] (-2021.690) (-2020.560) * (-2020.832) (-2019.591) [-2020.231] (-2023.988) -- 0:00:49
      289000 -- (-2019.697) (-2019.125) [-2019.931] (-2018.605) * (-2020.700) [-2019.627] (-2020.170) (-2022.980) -- 0:00:49
      289500 -- [-2019.807] (-2021.245) (-2020.559) (-2022.599) * [-2020.699] (-2019.647) (-2018.439) (-2022.990) -- 0:00:49
      290000 -- [-2021.228] (-2020.431) (-2023.701) (-2021.919) * [-2018.614] (-2019.261) (-2021.969) (-2023.234) -- 0:00:48

      Average standard deviation of split frequencies: 0.013070

      290500 -- (-2018.682) (-2020.811) [-2020.140] (-2018.800) * (-2018.997) (-2019.374) (-2024.716) [-2023.632] -- 0:00:48
      291000 -- (-2018.895) [-2022.396] (-2020.291) (-2018.697) * [-2019.089] (-2020.138) (-2023.126) (-2022.034) -- 0:00:48
      291500 -- (-2021.082) (-2025.090) (-2019.385) [-2018.661] * (-2021.433) (-2019.160) (-2019.774) [-2018.825] -- 0:00:48
      292000 -- (-2021.339) [-2021.371] (-2025.915) (-2018.576) * (-2021.487) [-2020.229] (-2022.096) (-2019.857) -- 0:00:48
      292500 -- (-2021.323) (-2024.698) [-2023.086] (-2021.454) * [-2019.373] (-2019.144) (-2020.641) (-2023.167) -- 0:00:48
      293000 -- [-2022.525] (-2023.826) (-2020.982) (-2021.901) * [-2019.117] (-2018.712) (-2019.059) (-2021.424) -- 0:00:48
      293500 -- (-2020.240) (-2020.028) (-2034.663) [-2020.810] * (-2021.290) (-2018.725) [-2020.238] (-2024.252) -- 0:00:48
      294000 -- (-2019.259) (-2019.994) [-2018.038] (-2018.995) * (-2023.140) (-2020.053) (-2020.055) [-2018.759] -- 0:00:48
      294500 -- [-2020.639] (-2021.423) (-2021.263) (-2024.669) * (-2022.345) [-2018.826] (-2020.801) (-2019.658) -- 0:00:47
      295000 -- (-2020.374) [-2021.254] (-2020.195) (-2023.172) * (-2023.956) (-2018.844) (-2024.459) [-2019.111] -- 0:00:47

      Average standard deviation of split frequencies: 0.012834

      295500 -- (-2019.801) (-2021.254) [-2020.821] (-2022.728) * (-2021.421) [-2018.359] (-2021.317) (-2019.040) -- 0:00:47
      296000 -- [-2019.678] (-2025.534) (-2020.150) (-2021.751) * (-2021.880) [-2019.573] (-2024.262) (-2021.203) -- 0:00:47
      296500 -- [-2019.292] (-2019.289) (-2019.383) (-2023.765) * (-2022.541) [-2018.374] (-2020.740) (-2021.920) -- 0:00:47
      297000 -- (-2019.650) [-2021.558] (-2020.520) (-2021.040) * [-2019.976] (-2020.946) (-2022.007) (-2024.652) -- 0:00:49
      297500 -- (-2020.598) (-2019.309) [-2021.967] (-2018.297) * (-2023.501) (-2019.538) (-2022.148) [-2022.156] -- 0:00:49
      298000 -- [-2023.729] (-2022.507) (-2023.685) (-2018.337) * (-2025.948) (-2019.671) (-2021.524) [-2021.995] -- 0:00:49
      298500 -- (-2022.143) (-2019.348) [-2019.047] (-2018.319) * (-2025.754) (-2019.656) [-2020.018] (-2019.739) -- 0:00:49
      299000 -- (-2019.355) (-2021.565) (-2018.699) [-2018.827] * [-2022.501] (-2022.264) (-2022.157) (-2019.069) -- 0:00:49
      299500 -- (-2021.362) (-2022.810) (-2019.723) [-2020.394] * [-2018.347] (-2022.992) (-2021.405) (-2021.205) -- 0:00:49
      300000 -- (-2020.465) [-2022.781] (-2020.567) (-2021.705) * [-2017.989] (-2018.796) (-2019.914) (-2019.448) -- 0:00:48

      Average standard deviation of split frequencies: 0.013033

      300500 -- (-2022.286) (-2020.495) (-2020.567) [-2020.920] * [-2018.030] (-2021.065) (-2019.752) (-2020.314) -- 0:00:48
      301000 -- (-2022.286) [-2020.194] (-2020.632) (-2019.333) * (-2018.903) [-2023.099] (-2019.172) (-2020.332) -- 0:00:48
      301500 -- (-2018.482) [-2019.910] (-2019.087) (-2020.592) * (-2019.550) (-2021.103) (-2019.074) [-2020.707] -- 0:00:48
      302000 -- (-2018.516) [-2020.571] (-2019.817) (-2019.268) * [-2021.051] (-2023.368) (-2020.246) (-2018.067) -- 0:00:48
      302500 -- (-2018.503) [-2018.895] (-2022.169) (-2018.599) * (-2022.524) (-2020.605) [-2021.001] (-2021.137) -- 0:00:48
      303000 -- (-2020.364) [-2021.092] (-2019.755) (-2019.330) * (-2019.841) [-2020.810] (-2020.832) (-2019.913) -- 0:00:48
      303500 -- (-2019.892) [-2021.446] (-2020.417) (-2019.222) * (-2022.701) (-2019.254) [-2019.673] (-2023.268) -- 0:00:48
      304000 -- [-2019.411] (-2020.179) (-2019.620) (-2019.222) * [-2019.338] (-2020.148) (-2020.334) (-2021.377) -- 0:00:48
      304500 -- (-2021.944) (-2020.680) (-2022.586) [-2019.515] * [-2019.486] (-2019.163) (-2020.437) (-2019.265) -- 0:00:47
      305000 -- [-2020.745] (-2020.080) (-2019.185) (-2020.896) * (-2020.304) (-2018.540) [-2019.306] (-2021.546) -- 0:00:47

      Average standard deviation of split frequencies: 0.012806

      305500 -- (-2021.884) (-2019.969) (-2019.612) [-2020.800] * (-2019.606) [-2018.511] (-2020.292) (-2019.810) -- 0:00:47
      306000 -- (-2019.343) (-2019.016) [-2018.376] (-2020.963) * (-2020.207) (-2018.053) [-2020.567] (-2020.418) -- 0:00:47
      306500 -- (-2019.355) [-2019.240] (-2021.687) (-2020.543) * (-2019.786) (-2019.973) [-2020.611] (-2020.203) -- 0:00:47
      307000 -- (-2020.583) [-2018.914] (-2022.415) (-2020.011) * (-2022.326) (-2020.035) [-2019.835] (-2027.472) -- 0:00:47
      307500 -- (-2021.629) (-2021.108) (-2022.106) [-2019.926] * (-2022.408) [-2017.954] (-2019.330) (-2024.965) -- 0:00:47
      308000 -- (-2021.126) (-2020.056) [-2021.374] (-2026.493) * (-2022.625) [-2019.032] (-2019.738) (-2020.868) -- 0:00:47
      308500 -- (-2021.368) (-2018.762) (-2019.941) [-2022.135] * (-2023.492) (-2019.530) [-2019.971] (-2021.026) -- 0:00:47
      309000 -- (-2027.741) (-2021.016) (-2025.094) [-2021.310] * (-2023.430) (-2019.171) (-2018.909) [-2019.812] -- 0:00:46
      309500 -- [-2019.276] (-2021.243) (-2021.777) (-2022.906) * (-2020.874) [-2019.106] (-2018.840) (-2019.294) -- 0:00:46
      310000 -- (-2019.401) (-2020.624) (-2021.759) [-2019.862] * (-2019.395) [-2018.186] (-2019.696) (-2019.348) -- 0:00:46

      Average standard deviation of split frequencies: 0.012228

      310500 -- [-2019.278] (-2020.304) (-2021.217) (-2019.769) * (-2019.451) [-2018.656] (-2020.839) (-2020.816) -- 0:00:46
      311000 -- [-2021.405] (-2019.673) (-2024.446) (-2019.079) * [-2018.274] (-2019.173) (-2020.844) (-2020.750) -- 0:00:46
      311500 -- (-2022.991) (-2018.659) [-2020.530] (-2020.839) * (-2019.794) (-2023.937) [-2019.076] (-2020.660) -- 0:00:48
      312000 -- (-2024.614) (-2019.160) (-2020.467) [-2020.078] * (-2020.213) (-2019.207) (-2021.171) [-2020.627] -- 0:00:48
      312500 -- [-2020.312] (-2019.019) (-2021.318) (-2023.312) * (-2018.434) (-2023.484) [-2020.448] (-2021.757) -- 0:00:48
      313000 -- (-2022.272) (-2022.656) [-2021.023] (-2024.717) * (-2018.783) (-2019.443) [-2021.150] (-2020.315) -- 0:00:48
      313500 -- (-2021.094) (-2021.767) [-2018.133] (-2022.746) * [-2020.308] (-2019.493) (-2023.177) (-2018.623) -- 0:00:48
      314000 -- [-2021.518] (-2020.511) (-2020.338) (-2020.231) * (-2021.882) [-2018.801] (-2020.685) (-2019.230) -- 0:00:48
      314500 -- [-2020.197] (-2020.153) (-2020.732) (-2030.829) * [-2022.233] (-2020.760) (-2019.862) (-2020.702) -- 0:00:47
      315000 -- (-2020.748) (-2018.587) [-2025.446] (-2022.382) * (-2021.873) (-2022.753) [-2018.194] (-2019.171) -- 0:00:47

      Average standard deviation of split frequencies: 0.013689

      315500 -- (-2021.455) [-2018.293] (-2021.366) (-2023.707) * (-2021.505) (-2022.762) (-2018.824) [-2020.018] -- 0:00:47
      316000 -- [-2020.033] (-2022.365) (-2020.931) (-2021.506) * (-2021.396) (-2021.881) (-2023.094) [-2018.081] -- 0:00:47
      316500 -- (-2019.482) (-2021.330) [-2024.176] (-2019.393) * [-2021.558] (-2020.894) (-2018.635) (-2018.108) -- 0:00:47
      317000 -- (-2022.134) (-2021.813) [-2020.552] (-2024.066) * [-2020.260] (-2021.114) (-2019.266) (-2018.230) -- 0:00:47
      317500 -- [-2018.592] (-2025.828) (-2022.370) (-2018.600) * (-2021.596) (-2019.900) (-2021.453) [-2018.409] -- 0:00:47
      318000 -- [-2019.052] (-2022.708) (-2023.713) (-2019.713) * (-2022.019) (-2018.667) (-2021.331) [-2018.010] -- 0:00:47
      318500 -- (-2021.028) (-2021.565) [-2021.791] (-2020.255) * (-2023.336) [-2018.673] (-2022.616) (-2019.103) -- 0:00:47
      319000 -- (-2020.201) (-2025.437) (-2022.860) [-2018.417] * [-2022.418] (-2020.279) (-2022.500) (-2020.138) -- 0:00:46
      319500 -- (-2020.966) (-2025.340) (-2021.410) [-2019.590] * [-2020.115] (-2018.687) (-2020.275) (-2020.668) -- 0:00:46
      320000 -- (-2020.476) (-2019.823) (-2022.748) [-2020.375] * (-2019.397) [-2018.593] (-2020.618) (-2020.589) -- 0:00:46

      Average standard deviation of split frequencies: 0.014058

      320500 -- [-2018.733] (-2020.267) (-2022.956) (-2020.860) * (-2021.172) [-2020.638] (-2020.249) (-2022.759) -- 0:00:46
      321000 -- (-2020.073) (-2020.312) (-2020.196) [-2022.246] * (-2026.746) (-2020.871) [-2023.329] (-2020.854) -- 0:00:46
      321500 -- [-2019.563] (-2020.104) (-2019.646) (-2021.048) * (-2027.152) [-2019.835] (-2022.072) (-2021.595) -- 0:00:46
      322000 -- [-2019.082] (-2020.152) (-2020.001) (-2021.837) * (-2022.492) (-2019.374) [-2019.797] (-2020.280) -- 0:00:46
      322500 -- [-2021.124] (-2021.432) (-2021.700) (-2023.601) * (-2019.303) (-2019.980) [-2019.523] (-2018.434) -- 0:00:46
      323000 -- (-2020.959) (-2021.268) [-2020.047] (-2021.375) * (-2019.011) (-2022.028) [-2019.519] (-2021.248) -- 0:00:46
      323500 -- [-2019.575] (-2020.721) (-2020.304) (-2022.286) * [-2020.214] (-2020.035) (-2020.373) (-2022.816) -- 0:00:46
      324000 -- [-2018.305] (-2019.463) (-2020.299) (-2025.229) * [-2020.828] (-2019.102) (-2020.963) (-2020.092) -- 0:00:45
      324500 -- [-2021.742] (-2018.390) (-2021.753) (-2020.064) * (-2020.538) (-2018.730) (-2018.849) [-2020.825] -- 0:00:45
      325000 -- (-2021.627) (-2019.220) (-2021.689) [-2019.785] * (-2020.349) [-2018.872] (-2018.970) (-2020.841) -- 0:00:45

      Average standard deviation of split frequencies: 0.011823

      325500 -- (-2024.024) [-2019.070] (-2023.163) (-2019.038) * (-2018.270) (-2022.605) [-2019.345] (-2019.529) -- 0:00:45
      326000 -- (-2022.276) [-2023.193] (-2020.291) (-2019.177) * (-2018.271) [-2019.972] (-2021.012) (-2019.505) -- 0:00:45
      326500 -- (-2023.150) (-2023.164) (-2025.460) [-2022.019] * (-2018.771) (-2019.249) [-2020.177] (-2018.221) -- 0:00:45
      327000 -- (-2019.619) (-2022.465) (-2019.425) [-2018.932] * [-2018.189] (-2019.014) (-2022.315) (-2020.618) -- 0:00:47
      327500 -- [-2019.953] (-2021.394) (-2018.553) (-2019.554) * (-2017.742) (-2018.431) (-2024.326) [-2018.404] -- 0:00:47
      328000 -- (-2020.627) [-2020.404] (-2020.645) (-2019.552) * (-2019.108) (-2021.365) [-2020.183] (-2018.380) -- 0:00:47
      328500 -- [-2019.149] (-2022.571) (-2021.351) (-2020.902) * (-2019.003) [-2020.671] (-2019.427) (-2021.938) -- 0:00:47
      329000 -- [-2018.879] (-2019.637) (-2020.244) (-2018.485) * (-2019.356) (-2018.793) (-2019.910) [-2022.833] -- 0:00:46
      329500 -- (-2020.400) [-2020.319] (-2019.645) (-2018.493) * (-2020.029) [-2018.433] (-2022.441) (-2019.019) -- 0:00:46
      330000 -- (-2019.052) (-2019.076) [-2021.809] (-2019.297) * (-2021.470) (-2018.636) (-2022.037) [-2019.218] -- 0:00:46

      Average standard deviation of split frequencies: 0.011672

      330500 -- (-2020.886) (-2019.511) [-2019.709] (-2019.405) * (-2021.765) [-2018.793] (-2020.504) (-2026.270) -- 0:00:46
      331000 -- (-2023.090) (-2019.510) [-2018.572] (-2019.352) * (-2021.324) (-2019.323) (-2018.982) [-2021.433] -- 0:00:46
      331500 -- (-2025.565) [-2018.445] (-2021.859) (-2021.360) * (-2021.057) (-2021.471) [-2019.320] (-2021.292) -- 0:00:46
      332000 -- (-2030.923) (-2018.578) (-2020.848) [-2021.236] * [-2023.228] (-2021.524) (-2019.506) (-2024.143) -- 0:00:46
      332500 -- (-2020.476) (-2020.190) [-2022.945] (-2024.608) * [-2020.020] (-2021.057) (-2023.031) (-2019.845) -- 0:00:46
      333000 -- (-2019.243) (-2018.945) [-2022.017] (-2019.044) * (-2019.379) (-2020.522) (-2024.214) [-2021.439] -- 0:00:46
      333500 -- [-2020.465] (-2019.508) (-2021.159) (-2020.082) * (-2020.720) (-2022.386) (-2020.195) [-2021.224] -- 0:00:45
      334000 -- (-2018.887) [-2019.979] (-2021.733) (-2020.657) * (-2023.242) (-2021.398) [-2022.372] (-2021.115) -- 0:00:45
      334500 -- (-2019.239) (-2021.855) (-2021.566) [-2019.780] * (-2020.468) [-2019.385] (-2020.783) (-2019.741) -- 0:00:45
      335000 -- (-2019.443) [-2021.534] (-2021.024) (-2021.944) * (-2020.354) [-2018.936] (-2021.150) (-2021.928) -- 0:00:45

      Average standard deviation of split frequencies: 0.011049

      335500 -- (-2021.857) [-2023.362] (-2020.055) (-2020.131) * (-2020.002) (-2018.650) [-2022.853] (-2023.679) -- 0:00:45
      336000 -- (-2023.708) [-2021.020] (-2018.988) (-2020.918) * [-2021.624] (-2018.891) (-2021.516) (-2022.241) -- 0:00:45
      336500 -- (-2023.033) (-2021.337) [-2018.961] (-2022.080) * (-2022.485) [-2019.194] (-2022.242) (-2022.195) -- 0:00:45
      337000 -- (-2024.596) [-2020.586] (-2018.962) (-2018.969) * (-2018.778) [-2018.653] (-2020.770) (-2021.508) -- 0:00:45
      337500 -- [-2019.640] (-2020.236) (-2019.355) (-2022.087) * (-2020.507) [-2019.749] (-2021.485) (-2019.210) -- 0:00:45
      338000 -- (-2019.934) (-2018.563) [-2020.613] (-2020.673) * (-2020.024) (-2018.627) [-2022.112] (-2019.728) -- 0:00:45
      338500 -- (-2019.488) [-2023.016] (-2019.354) (-2019.669) * [-2019.844] (-2019.588) (-2022.706) (-2020.426) -- 0:00:44
      339000 -- (-2019.530) (-2023.812) (-2019.866) [-2022.555] * [-2019.525] (-2018.559) (-2021.520) (-2021.590) -- 0:00:44
      339500 -- (-2019.104) (-2020.187) [-2019.553] (-2021.200) * (-2019.493) [-2018.531] (-2018.883) (-2020.644) -- 0:00:44
      340000 -- (-2020.900) (-2022.753) (-2020.700) [-2018.754] * (-2019.572) [-2018.531] (-2020.589) (-2020.254) -- 0:00:44

      Average standard deviation of split frequencies: 0.010205

      340500 -- (-2021.731) [-2018.129] (-2018.031) (-2021.449) * (-2018.749) (-2019.135) [-2019.815] (-2021.083) -- 0:00:44
      341000 -- [-2020.430] (-2018.475) (-2024.028) (-2018.881) * (-2018.789) [-2018.934] (-2019.980) (-2022.364) -- 0:00:44
      341500 -- (-2019.817) [-2019.281] (-2021.197) (-2021.083) * (-2021.114) [-2019.152] (-2018.955) (-2019.459) -- 0:00:44
      342000 -- (-2019.568) (-2019.131) (-2020.458) [-2020.353] * (-2021.916) (-2020.515) [-2021.287] (-2018.646) -- 0:00:46
      342500 -- (-2022.328) (-2019.863) (-2021.167) [-2020.133] * (-2019.225) [-2019.094] (-2019.350) (-2019.478) -- 0:00:46
      343000 -- (-2020.801) [-2018.457] (-2020.015) (-2018.846) * [-2019.236] (-2019.346) (-2019.342) (-2019.450) -- 0:00:45
      343500 -- [-2019.453] (-2020.067) (-2019.916) (-2018.653) * [-2019.461] (-2020.127) (-2021.095) (-2019.584) -- 0:00:45
      344000 -- (-2019.588) (-2022.536) (-2020.252) [-2019.602] * (-2023.907) (-2023.227) [-2018.862] (-2020.311) -- 0:00:45
      344500 -- [-2023.526] (-2020.896) (-2020.397) (-2021.022) * (-2023.581) (-2020.722) (-2018.944) [-2018.851] -- 0:00:45
      345000 -- [-2019.465] (-2021.872) (-2021.647) (-2020.453) * (-2020.745) (-2020.091) (-2018.152) [-2023.362] -- 0:00:45

      Average standard deviation of split frequencies: 0.008575

      345500 -- (-2019.114) [-2019.625] (-2019.009) (-2021.596) * (-2024.164) (-2019.815) (-2019.430) [-2021.124] -- 0:00:45
      346000 -- (-2022.400) [-2022.596] (-2021.547) (-2022.971) * (-2020.889) (-2019.467) (-2020.419) [-2019.177] -- 0:00:45
      346500 -- (-2019.011) (-2023.335) (-2021.730) [-2021.414] * (-2018.431) (-2019.410) [-2021.583] (-2019.542) -- 0:00:45
      347000 -- (-2020.147) (-2022.891) [-2019.727] (-2022.249) * (-2018.715) (-2021.062) [-2021.663] (-2021.311) -- 0:00:45
      347500 -- (-2020.400) (-2021.590) [-2019.868] (-2021.594) * (-2019.383) (-2019.272) [-2020.217] (-2021.086) -- 0:00:45
      348000 -- (-2020.510) (-2020.249) (-2021.404) [-2023.388] * [-2018.789] (-2022.082) (-2019.660) (-2019.464) -- 0:00:44
      348500 -- [-2020.567] (-2020.936) (-2019.312) (-2021.259) * (-2019.624) (-2021.893) [-2018.981] (-2021.597) -- 0:00:44
      349000 -- (-2020.658) (-2020.970) [-2018.608] (-2021.609) * (-2020.481) (-2020.278) (-2019.949) [-2020.880] -- 0:00:44
      349500 -- [-2021.138] (-2020.226) (-2019.226) (-2024.391) * (-2018.691) (-2020.905) [-2019.665] (-2019.816) -- 0:00:44
      350000 -- (-2023.451) [-2018.293] (-2018.269) (-2022.763) * (-2020.733) [-2018.139] (-2019.152) (-2020.075) -- 0:00:44

      Average standard deviation of split frequencies: 0.008066

      350500 -- (-2022.944) [-2018.392] (-2019.435) (-2019.319) * (-2028.025) (-2018.639) [-2019.991] (-2022.996) -- 0:00:44
      351000 -- (-2020.615) (-2020.007) (-2024.884) [-2022.118] * (-2022.014) (-2020.283) (-2018.729) [-2021.510] -- 0:00:44
      351500 -- (-2021.144) (-2021.431) (-2021.383) [-2019.244] * (-2020.353) (-2020.355) [-2018.378] (-2019.194) -- 0:00:44
      352000 -- (-2020.525) (-2020.998) (-2020.315) [-2019.196] * (-2023.238) [-2019.191] (-2018.081) (-2019.185) -- 0:00:44
      352500 -- (-2020.528) (-2020.066) [-2021.232] (-2021.026) * (-2032.389) (-2019.679) (-2018.427) [-2018.320] -- 0:00:44
      353000 -- (-2020.067) (-2025.467) [-2019.570] (-2020.299) * (-2023.616) (-2021.681) [-2020.156] (-2018.946) -- 0:00:43
      353500 -- (-2018.392) (-2021.753) [-2019.715] (-2018.544) * [-2018.735] (-2020.360) (-2018.807) (-2019.540) -- 0:00:43
      354000 -- [-2018.899] (-2022.196) (-2019.925) (-2018.170) * (-2021.452) [-2019.622] (-2019.056) (-2019.443) -- 0:00:43
      354500 -- [-2018.882] (-2030.055) (-2020.217) (-2018.251) * (-2020.442) [-2019.943] (-2021.222) (-2019.442) -- 0:00:43
      355000 -- (-2019.521) [-2022.205] (-2019.429) (-2020.476) * [-2022.844] (-2018.582) (-2021.349) (-2021.430) -- 0:00:43

      Average standard deviation of split frequencies: 0.008101

      355500 -- (-2020.550) (-2022.305) [-2021.524] (-2019.036) * (-2020.948) (-2018.401) (-2022.795) [-2021.939] -- 0:00:43
      356000 -- (-2020.734) (-2022.169) (-2020.517) [-2018.687] * (-2019.324) [-2018.457] (-2019.899) (-2020.114) -- 0:00:43
      356500 -- (-2019.943) (-2024.093) [-2018.516] (-2019.377) * (-2020.749) [-2021.155] (-2020.503) (-2018.907) -- 0:00:43
      357000 -- (-2022.646) [-2020.279] (-2019.995) (-2020.417) * [-2022.231] (-2019.048) (-2020.613) (-2020.781) -- 0:00:43
      357500 -- (-2022.762) (-2020.814) [-2024.093] (-2022.147) * (-2019.086) (-2020.006) (-2023.012) [-2022.572] -- 0:00:44
      358000 -- [-2025.690] (-2020.324) (-2021.461) (-2021.006) * [-2019.036] (-2024.694) (-2020.913) (-2028.568) -- 0:00:44
      358500 -- [-2021.670] (-2018.650) (-2019.892) (-2021.280) * (-2019.975) (-2021.794) (-2027.841) [-2020.855] -- 0:00:44
      359000 -- (-2026.512) [-2020.032] (-2019.378) (-2019.411) * (-2024.062) (-2020.109) (-2026.145) [-2023.682] -- 0:00:44
      359500 -- (-2020.986) [-2019.647] (-2018.437) (-2020.279) * (-2021.766) (-2021.471) (-2023.969) [-2020.922] -- 0:00:44
      360000 -- [-2021.254] (-2019.388) (-2018.791) (-2019.696) * (-2021.201) (-2020.171) (-2023.425) [-2018.854] -- 0:00:44

      Average standard deviation of split frequencies: 0.009149

      360500 -- (-2021.149) (-2019.789) (-2019.357) [-2018.527] * [-2019.861] (-2019.141) (-2020.396) (-2018.467) -- 0:00:44
      361000 -- (-2018.807) [-2018.265] (-2019.296) (-2018.527) * (-2018.786) (-2018.335) (-2031.774) [-2020.107] -- 0:00:44
      361500 -- (-2018.472) [-2018.792] (-2019.423) (-2018.644) * [-2018.268] (-2018.445) (-2019.559) (-2018.218) -- 0:00:44
      362000 -- (-2019.147) (-2020.601) [-2019.956] (-2018.396) * [-2020.355] (-2018.389) (-2024.094) (-2019.774) -- 0:00:44
      362500 -- (-2018.955) [-2023.663] (-2019.218) (-2018.396) * (-2018.900) (-2018.683) [-2025.500] (-2018.207) -- 0:00:43
      363000 -- [-2019.307] (-2021.173) (-2019.652) (-2018.641) * [-2020.426] (-2020.531) (-2019.088) (-2018.201) -- 0:00:43
      363500 -- (-2019.091) [-2020.474] (-2024.317) (-2018.266) * [-2019.874] (-2020.758) (-2021.624) (-2018.756) -- 0:00:43
      364000 -- (-2019.349) (-2020.649) (-2023.564) [-2018.206] * [-2019.889] (-2019.030) (-2030.484) (-2021.714) -- 0:00:43
      364500 -- (-2020.566) (-2019.237) (-2023.121) [-2018.206] * (-2022.975) (-2019.054) (-2019.580) [-2019.179] -- 0:00:43
      365000 -- (-2028.265) (-2020.168) (-2026.774) [-2018.659] * (-2021.026) (-2019.039) (-2021.359) [-2018.964] -- 0:00:43

      Average standard deviation of split frequencies: 0.008637

      365500 -- (-2022.544) (-2020.725) (-2025.581) [-2021.362] * (-2020.286) (-2020.158) [-2020.809] (-2018.963) -- 0:00:43
      366000 -- [-2021.137] (-2021.425) (-2019.639) (-2022.267) * (-2019.497) (-2020.890) [-2019.040] (-2017.864) -- 0:00:43
      366500 -- (-2020.941) (-2021.629) [-2020.648] (-2024.610) * [-2019.726] (-2019.515) (-2019.209) (-2017.864) -- 0:00:43
      367000 -- (-2019.918) [-2019.539] (-2022.318) (-2021.211) * (-2019.127) (-2019.515) (-2022.556) [-2021.335] -- 0:00:43
      367500 -- (-2018.066) [-2022.507] (-2020.116) (-2022.711) * (-2019.455) [-2019.076] (-2019.394) (-2019.887) -- 0:00:43
      368000 -- (-2019.120) (-2019.227) (-2019.845) [-2022.539] * (-2020.829) [-2020.029] (-2020.093) (-2020.432) -- 0:00:42
      368500 -- (-2018.790) (-2020.170) (-2018.065) [-2021.452] * (-2021.210) [-2019.679] (-2019.001) (-2018.879) -- 0:00:42
      369000 -- (-2018.729) [-2019.522] (-2019.031) (-2020.999) * (-2018.461) (-2019.656) (-2019.377) [-2018.995] -- 0:00:42
      369500 -- [-2018.959] (-2020.211) (-2019.501) (-2020.281) * (-2018.140) [-2019.385] (-2020.961) (-2018.562) -- 0:00:42
      370000 -- (-2020.481) (-2022.360) [-2019.271] (-2018.907) * (-2019.757) (-2022.946) (-2023.088) [-2019.550] -- 0:00:42

      Average standard deviation of split frequencies: 0.008828

      370500 -- (-2022.529) (-2024.801) [-2022.253] (-2018.393) * [-2020.417] (-2019.443) (-2019.708) (-2018.554) -- 0:00:42
      371000 -- (-2021.103) (-2021.183) (-2019.623) [-2020.805] * (-2023.328) (-2018.499) (-2022.181) [-2018.779] -- 0:00:42
      371500 -- (-2021.469) (-2020.219) [-2019.346] (-2019.891) * (-2022.789) (-2018.499) [-2019.980] (-2020.535) -- 0:00:42
      372000 -- [-2020.449] (-2021.512) (-2019.222) (-2022.626) * (-2023.878) [-2020.781] (-2021.054) (-2019.228) -- 0:00:42
      372500 -- (-2022.497) (-2023.265) (-2020.692) [-2019.202] * (-2018.971) (-2023.064) [-2020.439] (-2019.486) -- 0:00:42
      373000 -- (-2020.719) (-2019.501) [-2020.884] (-2024.468) * (-2019.370) (-2022.874) (-2018.851) [-2019.081] -- 0:00:43
      373500 -- (-2019.057) (-2019.620) (-2020.096) [-2019.894] * (-2018.488) (-2020.110) (-2019.319) [-2020.474] -- 0:00:43
      374000 -- [-2020.138] (-2020.342) (-2019.141) (-2018.666) * (-2018.130) (-2020.934) (-2018.502) [-2018.574] -- 0:00:43
      374500 -- (-2018.467) [-2019.652] (-2018.920) (-2019.463) * (-2018.880) (-2022.288) [-2018.321] (-2019.526) -- 0:00:43
      375000 -- (-2021.128) [-2018.515] (-2020.351) (-2019.493) * [-2020.574] (-2021.105) (-2018.328) (-2019.664) -- 0:00:43

      Average standard deviation of split frequencies: 0.009440

      375500 -- [-2021.063] (-2019.810) (-2023.246) (-2021.130) * (-2022.060) (-2021.126) [-2018.983] (-2023.250) -- 0:00:43
      376000 -- [-2020.576] (-2020.074) (-2020.700) (-2018.756) * (-2023.267) (-2021.411) (-2019.407) [-2019.021] -- 0:00:43
      376500 -- (-2020.655) (-2020.549) [-2019.596] (-2020.633) * (-2019.385) [-2019.837] (-2019.645) (-2019.850) -- 0:00:43
      377000 -- (-2020.750) [-2020.826] (-2019.826) (-2019.612) * (-2018.404) (-2021.065) [-2019.120] (-2022.708) -- 0:00:42
      377500 -- (-2021.493) (-2018.651) [-2018.996] (-2018.981) * [-2019.529] (-2020.840) (-2021.164) (-2021.644) -- 0:00:42
      378000 -- (-2019.710) (-2019.846) (-2022.090) [-2018.430] * [-2018.912] (-2019.271) (-2023.435) (-2024.485) -- 0:00:42
      378500 -- [-2020.078] (-2019.863) (-2020.871) (-2017.877) * (-2020.602) [-2021.055] (-2025.330) (-2020.787) -- 0:00:42
      379000 -- (-2020.141) (-2021.524) [-2021.770] (-2018.302) * [-2019.881] (-2024.249) (-2021.123) (-2020.484) -- 0:00:42
      379500 -- (-2019.988) (-2023.591) [-2021.770] (-2017.943) * (-2020.281) (-2023.575) (-2020.706) [-2020.189] -- 0:00:42
      380000 -- (-2019.784) (-2020.677) [-2021.770] (-2018.616) * (-2022.811) (-2020.776) [-2021.236] (-2019.746) -- 0:00:42

      Average standard deviation of split frequencies: 0.010294

      380500 -- (-2019.572) [-2018.416] (-2018.719) (-2021.