--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 16:18:17 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0208/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -600.52 -613.77
2 -600.52 -609.92
--------------------------------------
TOTAL -600.52 -613.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.298624 0.015739 0.112103 0.543842 0.274100 914.82 1004.15 1.000
r(A<->C){all} 0.250261 0.016986 0.000969 0.491888 0.237398 312.48 316.76 1.003
r(A<->G){all} 0.203171 0.014810 0.001069 0.433390 0.185778 297.00 420.38 1.000
r(A<->T){all} 0.112348 0.008344 0.000056 0.294181 0.090325 282.47 302.57 1.002
r(C<->G){all} 0.162278 0.010000 0.000281 0.358641 0.146816 281.68 368.77 1.005
r(C<->T){all} 0.129631 0.007542 0.000049 0.296889 0.115126 358.52 365.00 1.004
r(G<->T){all} 0.142311 0.007460 0.002392 0.309241 0.129255 343.12 381.81 1.000
pi(A){all} 0.160717 0.000364 0.123610 0.197835 0.159655 1108.72 1205.55 1.000
pi(C){all} 0.271864 0.000504 0.231233 0.317202 0.271774 1219.00 1261.51 1.000
pi(G){all} 0.313788 0.000555 0.268238 0.361514 0.313226 1272.53 1302.47 1.000
pi(T){all} 0.253631 0.000484 0.211894 0.297924 0.253538 1335.13 1418.07 1.001
alpha{1,2} 0.325615 0.126679 0.000114 1.073284 0.208654 1011.22 1074.80 1.000
alpha{3} 0.568945 0.246111 0.000269 1.525811 0.438244 1158.85 1269.80 1.000
pinvar{all} 0.454302 0.042575 0.067151 0.809308 0.468668 681.66 734.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -520.039316
Model 2: PositiveSelection -483.824138
Model 0: one-ratio -530.350256
Model 7: beta -523.292832
Model 8: beta&w>1 -483.824132
Model 0 vs 1 20.62187999999992
Model 2 vs 1 72.43035599999996
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 1.000** 999.000
89 K 1.000** 999.000
90 D 1.000** 999.000
91 L 1.000** 999.000
92 E 1.000** 999.000
93 L 1.000** 999.000
94 R 1.000** 999.000
95 Y 1.000** 998.999
96 A 1.000** 999.000
97 C 1.000** 999.000
98 L 1.000** 999.000
99 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 0.998** 10.262 +- 0.668
89 K 0.995** 10.236 +- 0.829
90 D 0.983* 10.122 +- 1.316
91 L 0.957* 9.872 +- 1.997
92 E 0.996** 10.248 +- 0.758
93 L 0.998** 10.268 +- 0.624
94 R 0.988* 10.168 +- 1.148
95 Y 0.901 9.343 +- 2.878
96 A 0.829 8.658 +- 3.612
97 C 0.997** 10.253 +- 0.731
98 L 0.993** 10.215 +- 0.942
99 A 0.991** 10.201 +- 1.006
Model 8 vs 7 78.93739999999991
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 1.000** 999.000
89 K 1.000** 999.000
90 D 1.000** 999.000
91 L 1.000** 999.000
92 E 1.000** 999.000
93 L 1.000** 999.000
94 R 1.000** 999.000
95 Y 1.000** 999.000
96 A 1.000** 999.000
97 C 1.000** 999.000
98 L 1.000** 999.000
99 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 0.999** 10.274 +- 0.575
89 K 0.998** 10.260 +- 0.682
90 D 0.991** 10.200 +- 1.016
91 L 0.972* 10.013 +- 1.671
92 E 0.998** 10.267 +- 0.635
93 L 0.999** 10.274 +- 0.578
94 R 0.993** 10.220 +- 0.919
95 Y 0.934 9.648 +- 2.446
96 A 0.881 9.126 +- 3.178
97 C 0.998** 10.268 +- 0.626
98 L 0.996** 10.243 +- 0.798
99 A 0.996** 10.242 +- 0.802
>C1
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C2
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C3
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C4
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C5
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRRPQSPQQCPVRCo
ooooooooooooo
>C6
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
C1 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C2 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C3 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C4 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C5 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C6 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
**************************************************
C1 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C2 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C3 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C4 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C5 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRRPQSPQQCPVRCo
C6 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
************************************* : : . .
C1 VVALEGARAPEPF
C2 VVALEGARAPEPF
C3 VVALEGARAPEPF
C4 VVALEGARAPEPF
C5 ooooooooooooo
C6 VVALEGARAPEPF
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 113 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 113 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3990]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3990]--->[3700]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.457 Mb, Max= 30.651 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C2 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C3 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C4 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C5 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
C6 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
**************************************************
C1 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C2 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C3 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C4 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
C5 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRRPQSPQQCPVRCo
C6 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
************************************* : : . .
C1 VVALEGARAPEPF
C2 VVALEGARAPEPF
C3 VVALEGARAPEPF
C4 VVALEGARAPEPF
C5 ooooooooooooo
C6 VVALEGARAPEPF
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:99 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 76.99 C1 C5 76.99
TOP 4 0 76.99 C5 C1 76.99
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 76.99 C2 C5 76.99
TOP 4 1 76.99 C5 C2 76.99
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 76.99 C3 C5 76.99
TOP 4 2 76.99 C5 C3 76.99
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 76.99 C4 C5 76.99
TOP 4 3 76.99 C5 C4 76.99
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 76.99 C5 C6 76.99
TOP 5 4 76.99 C6 C5 76.99
AVG 0 C1 * 95.40
AVG 1 C2 * 95.40
AVG 2 C3 * 95.40
AVG 3 C4 * 95.40
AVG 4 C5 * 76.99
AVG 5 C6 * 95.40
TOT TOT * 92.33
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
C2 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
C3 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
C4 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
C5 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
C6 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
**************************************************
C1 TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
C2 TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
C3 TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
C4 TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
C5 TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
C6 TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
**************************************************
C1 TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
C2 TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
C3 TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
C4 TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
C5 TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
C6 TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
**************************************************
C1 AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
C2 AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
C3 AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
C4 AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
C5 AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
C6 AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
**************************************************
C1 TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
C2 TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
C3 TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
C4 TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
C5 TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
C6 TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
**************************************************
C1 TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
C2 TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
C3 TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
C4 TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
C5 TCTACATACGTAGGCCTCAATCACCCCAACAATGCCCCGTCCGATGC---
C6 TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
********** : .. *.* . . :.*..*.* * .
C1 GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
C2 GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
C3 GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
C4 GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
C5 ---------------------------------------
C6 GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>C1
ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>C2
ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>C3
ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>C4
ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>C5
ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
TCTACATACGTAGGCCTCAATCACCCCAACAATGCCCCGTCCGATGC---
---------------------------------------
>C6
ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT
TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG
TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT
AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA
TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA
TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC
GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>C1
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C2
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C3
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C4
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
>C5
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRRPQSPQQCPVRCo
ooooooooooooo
>C6
MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
VVALEGARAPEPF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 339 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579796163
Setting output file names to "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 614574003
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0975441945
Seed = 1354416224
Swapseed = 1579796163
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 13 unique site patterns
Division 2 has 16 unique site patterns
Division 3 has 14 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -860.190250 -- -24.965149
Chain 2 -- -860.136347 -- -24.965149
Chain 3 -- -860.190298 -- -24.965149
Chain 4 -- -860.187895 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -860.190290 -- -24.965149
Chain 2 -- -860.190290 -- -24.965149
Chain 3 -- -860.190290 -- -24.965149
Chain 4 -- -860.190290 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-860.190] (-860.136) (-860.190) (-860.188) * [-860.190] (-860.190) (-860.190) (-860.190)
500 -- (-610.392) (-614.033) [-608.652] (-608.412) * (-612.135) [-607.208] (-603.756) (-608.384) -- 0:00:00
1000 -- (-614.842) [-608.533] (-605.414) (-605.702) * (-604.389) [-600.217] (-602.587) (-607.713) -- 0:00:00
1500 -- [-608.234] (-600.986) (-614.416) (-601.531) * (-605.226) (-606.229) (-606.265) [-602.293] -- 0:11:05
2000 -- (-605.643) [-604.252] (-613.216) (-604.466) * [-604.216] (-603.277) (-601.411) (-599.776) -- 0:08:19
2500 -- (-601.923) [-602.686] (-612.679) (-601.293) * [-605.894] (-601.088) (-605.644) (-605.718) -- 0:06:39
3000 -- (-605.485) (-611.175) (-605.486) [-605.918] * (-604.956) [-603.317] (-600.977) (-603.413) -- 0:05:32
3500 -- (-608.730) [-608.069] (-609.515) (-603.646) * [-608.788] (-601.866) (-603.068) (-602.658) -- 0:04:44
4000 -- (-604.582) (-607.141) [-605.269] (-602.400) * (-611.148) (-608.503) [-606.985] (-601.327) -- 0:04:09
4500 -- (-607.453) (-610.473) (-608.394) [-604.360] * (-610.921) (-606.008) (-602.190) [-603.652] -- 0:03:41
5000 -- [-601.648] (-616.987) (-607.079) (-606.746) * (-604.549) (-606.578) [-606.505] (-602.948) -- 0:03:19
Average standard deviation of split frequencies: 0.104757
5500 -- (-599.549) (-602.426) (-605.767) [-603.370] * (-607.589) (-610.765) (-616.225) [-602.835] -- 0:03:00
6000 -- (-600.661) (-607.064) [-598.921] (-605.413) * (-611.995) (-605.301) [-607.203] (-609.632) -- 0:02:45
6500 -- (-608.514) (-612.948) [-603.608] (-606.841) * (-610.736) [-606.236] (-609.797) (-600.695) -- 0:02:32
7000 -- (-601.898) (-608.644) [-604.825] (-606.997) * (-611.745) [-606.892] (-602.481) (-606.807) -- 0:02:21
7500 -- [-599.280] (-605.803) (-606.398) (-616.838) * (-605.706) [-606.402] (-602.873) (-605.310) -- 0:02:12
8000 -- (-602.067) [-604.996] (-606.428) (-606.621) * (-604.974) (-605.852) (-605.953) [-603.519] -- 0:02:04
8500 -- (-597.288) [-605.194] (-601.571) (-602.866) * (-610.373) (-602.029) [-600.436] (-605.314) -- 0:01:56
9000 -- [-597.000] (-603.852) (-604.300) (-601.172) * (-609.735) (-610.494) [-602.419] (-605.289) -- 0:01:50
9500 -- (-601.260) [-603.357] (-603.928) (-607.133) * (-603.618) (-610.234) [-602.463] (-608.535) -- 0:01:44
10000 -- [-603.706] (-602.307) (-607.745) (-603.717) * (-602.868) (-603.877) (-600.986) [-601.157] -- 0:01:39
Average standard deviation of split frequencies: 0.059662
10500 -- [-607.436] (-611.309) (-607.898) (-605.831) * (-602.434) [-599.135] (-603.098) (-605.712) -- 0:01:34
11000 -- (-613.495) (-607.974) [-603.777] (-610.386) * (-609.383) (-601.850) [-605.059] (-603.326) -- 0:02:59
11500 -- (-604.598) [-604.567] (-602.667) (-605.740) * (-611.372) [-601.700] (-604.429) (-605.322) -- 0:02:51
12000 -- (-603.185) (-602.592) (-611.928) [-603.087] * (-608.759) (-604.908) [-598.103] (-603.170) -- 0:02:44
12500 -- (-606.873) [-603.080] (-605.409) (-612.322) * (-606.109) (-607.673) [-603.599] (-607.973) -- 0:02:38
13000 -- [-603.056] (-608.059) (-609.173) (-612.153) * [-604.884] (-606.570) (-602.189) (-599.072) -- 0:02:31
13500 -- (-614.786) (-603.589) (-607.531) [-602.117] * (-605.149) (-604.790) (-613.788) [-601.387] -- 0:02:26
14000 -- (-611.399) (-604.577) [-602.349] (-605.687) * (-601.835) (-610.002) (-607.677) [-602.059] -- 0:02:20
14500 -- [-600.286] (-601.055) (-611.982) (-614.888) * [-607.744] (-603.831) (-605.966) (-604.864) -- 0:02:15
15000 -- (-610.801) (-604.225) (-600.163) [-611.455] * (-602.603) (-602.752) [-599.167] (-602.971) -- 0:02:11
Average standard deviation of split frequencies: 0.058926
15500 -- (-609.080) (-609.658) [-601.736] (-611.453) * (-607.041) (-604.164) (-607.691) [-601.445] -- 0:02:07
16000 -- (-605.219) [-606.824] (-606.259) (-602.912) * (-606.821) (-609.523) [-603.098] (-600.923) -- 0:02:03
16500 -- [-603.967] (-607.593) (-606.513) (-601.169) * [-602.120] (-608.817) (-604.665) (-604.050) -- 0:01:59
17000 -- [-607.180] (-602.948) (-605.755) (-613.875) * (-602.678) (-599.350) [-606.889] (-600.315) -- 0:01:55
17500 -- (-599.075) (-607.042) (-607.544) [-601.535] * (-606.403) (-609.074) [-601.400] (-606.907) -- 0:01:52
18000 -- [-602.886] (-602.581) (-608.642) (-606.622) * (-606.931) (-600.816) (-602.904) [-602.670] -- 0:01:49
18500 -- (-604.810) (-617.271) (-607.354) [-603.814] * [-603.489] (-604.074) (-604.269) (-603.624) -- 0:01:46
19000 -- (-611.550) (-606.034) [-600.605] (-605.513) * (-602.854) (-600.875) (-610.122) [-605.182] -- 0:01:43
19500 -- [-602.034] (-607.928) (-603.071) (-611.968) * (-604.175) [-601.755] (-607.027) (-602.304) -- 0:01:40
20000 -- (-604.719) (-603.297) (-611.680) [-599.154] * (-613.263) (-603.451) [-596.427] (-612.472) -- 0:01:38
Average standard deviation of split frequencies: 0.054744
20500 -- [-601.843] (-606.306) (-607.252) (-607.950) * [-603.109] (-605.494) (-609.753) (-607.767) -- 0:01:35
21000 -- [-605.384] (-602.584) (-610.532) (-606.458) * (-604.028) [-601.530] (-610.966) (-604.750) -- 0:01:33
21500 -- [-600.765] (-605.765) (-599.339) (-604.244) * [-599.914] (-603.355) (-610.273) (-601.249) -- 0:02:16
22000 -- (-605.595) (-600.289) (-605.288) [-600.483] * (-608.700) (-607.704) [-606.784] (-606.628) -- 0:02:13
22500 -- (-606.366) [-608.401] (-604.416) (-602.122) * [-601.387] (-601.784) (-603.617) (-600.229) -- 0:02:10
23000 -- [-606.241] (-607.034) (-619.193) (-608.542) * [-600.766] (-610.352) (-610.238) (-604.589) -- 0:02:07
23500 -- (-606.833) [-602.021] (-601.306) (-607.824) * [-606.584] (-611.592) (-601.685) (-608.375) -- 0:02:04
24000 -- (-603.882) (-604.944) [-603.971] (-604.030) * (-610.210) [-605.795] (-607.612) (-602.858) -- 0:02:02
24500 -- (-602.183) [-606.595] (-607.726) (-608.039) * (-612.016) (-608.144) (-605.036) [-602.575] -- 0:01:59
25000 -- (-607.868) [-601.010] (-608.804) (-604.632) * (-613.090) (-599.570) (-610.326) [-611.115] -- 0:01:57
Average standard deviation of split frequencies: 0.037989
25500 -- (-599.934) (-604.166) (-602.416) [-599.612] * (-606.868) (-598.981) [-613.347] (-604.564) -- 0:01:54
26000 -- (-613.787) (-606.309) [-600.289] (-610.906) * (-610.388) (-602.818) (-608.768) [-611.123] -- 0:01:52
26500 -- (-610.636) (-603.967) (-603.266) [-603.619] * [-607.367] (-600.268) (-606.295) (-603.951) -- 0:01:50
27000 -- (-597.923) [-608.452] (-608.180) (-605.248) * (-607.772) [-602.859] (-607.507) (-612.133) -- 0:01:48
27500 -- [-604.628] (-607.706) (-601.414) (-604.540) * [-602.269] (-608.040) (-611.549) (-603.453) -- 0:01:46
28000 -- (-601.925) (-620.387) (-602.121) [-603.434] * [-600.946] (-603.651) (-606.907) (-603.921) -- 0:01:44
28500 -- (-605.285) (-606.898) (-610.920) [-605.513] * (-604.287) [-607.305] (-604.173) (-606.945) -- 0:01:42
29000 -- (-608.852) (-603.280) (-601.504) [-600.552] * (-607.967) (-615.015) (-605.397) [-613.918] -- 0:01:40
29500 -- (-603.392) (-609.242) (-603.992) [-604.763] * (-603.550) (-601.734) [-605.554] (-607.569) -- 0:01:38
30000 -- (-606.327) [-598.778] (-601.056) (-599.137) * (-599.107) [-604.454] (-609.963) (-607.306) -- 0:01:37
Average standard deviation of split frequencies: 0.034789
30500 -- [-605.721] (-605.199) (-604.869) (-606.604) * (-602.894) [-597.017] (-605.773) (-606.577) -- 0:01:35
31000 -- (-608.757) (-614.143) (-604.923) [-602.121] * [-599.065] (-602.086) (-604.879) (-606.901) -- 0:01:33
31500 -- (-604.425) (-603.463) (-602.636) [-599.686] * (-605.193) (-608.112) (-604.928) [-607.204] -- 0:02:02
32000 -- (-609.139) [-601.983] (-606.008) (-607.973) * (-607.240) (-606.383) [-606.404] (-621.356) -- 0:02:01
32500 -- (-615.955) (-598.999) (-612.583) [-609.206] * [-607.878] (-615.945) (-607.745) (-606.880) -- 0:01:59
33000 -- (-603.683) [-607.840] (-600.400) (-609.636) * (-607.622) [-598.063] (-607.900) (-608.639) -- 0:01:57
33500 -- (-604.324) [-601.603] (-611.186) (-606.750) * (-608.646) [-600.976] (-606.920) (-617.987) -- 0:01:55
34000 -- (-612.882) (-603.718) [-607.713] (-605.743) * [-601.574] (-607.856) (-606.772) (-600.380) -- 0:01:53
34500 -- (-606.644) (-599.180) [-597.886] (-612.105) * (-602.767) (-608.079) [-602.001] (-606.356) -- 0:01:51
35000 -- (-613.167) (-599.664) (-606.439) [-603.214] * [-611.354] (-604.656) (-600.873) (-604.949) -- 0:01:50
Average standard deviation of split frequencies: 0.031918
35500 -- (-608.421) [-602.271] (-612.329) (-601.321) * [-599.502] (-604.487) (-611.253) (-605.023) -- 0:01:48
36000 -- (-608.342) [-604.022] (-612.136) (-601.585) * [-605.369] (-611.336) (-607.314) (-607.231) -- 0:01:47
36500 -- [-601.290] (-606.444) (-605.557) (-599.073) * [-607.452] (-606.260) (-613.821) (-600.400) -- 0:01:45
37000 -- [-602.613] (-604.412) (-608.796) (-602.873) * (-603.872) [-607.077] (-601.205) (-599.188) -- 0:01:44
37500 -- (-606.190) (-604.742) (-610.977) [-606.978] * [-603.539] (-607.706) (-602.986) (-605.441) -- 0:01:42
38000 -- (-604.568) [-610.731] (-611.385) (-603.442) * [-601.143] (-599.859) (-611.036) (-608.916) -- 0:01:41
38500 -- [-606.836] (-605.366) (-605.147) (-605.144) * [-601.676] (-601.395) (-606.978) (-612.171) -- 0:01:39
39000 -- (-598.369) (-606.034) (-606.789) [-605.399] * [-602.364] (-604.678) (-611.843) (-612.082) -- 0:01:38
39500 -- (-599.828) [-602.735] (-599.890) (-601.776) * (-602.853) [-606.161] (-606.337) (-601.215) -- 0:01:37
40000 -- (-598.820) [-606.798] (-602.455) (-609.376) * (-605.266) (-607.294) [-602.234] (-601.837) -- 0:01:36
Average standard deviation of split frequencies: 0.032200
40500 -- (-603.154) [-601.578] (-597.877) (-604.731) * (-605.902) (-610.940) (-604.280) [-601.778] -- 0:01:34
41000 -- [-602.335] (-611.887) (-601.792) (-604.332) * [-605.613] (-604.204) (-611.145) (-611.762) -- 0:01:33
41500 -- (-603.877) [-604.455] (-602.568) (-596.881) * (-612.154) (-601.055) [-607.340] (-611.103) -- 0:01:55
42000 -- (-607.250) [-606.570] (-601.780) (-606.297) * [-601.711] (-604.953) (-609.235) (-610.449) -- 0:01:54
42500 -- [-604.625] (-605.218) (-602.096) (-606.963) * (-605.765) [-602.067] (-606.224) (-608.954) -- 0:01:52
43000 -- (-602.384) [-601.718] (-600.624) (-602.763) * (-604.252) (-604.592) (-611.328) [-600.839] -- 0:01:51
43500 -- (-604.522) [-607.197] (-609.578) (-610.808) * (-602.868) (-601.738) [-608.889] (-607.411) -- 0:01:49
44000 -- (-605.901) (-602.613) [-605.414] (-609.205) * (-605.546) (-598.513) (-622.135) [-609.647] -- 0:01:48
44500 -- [-607.433] (-606.495) (-598.601) (-601.703) * (-616.865) (-600.319) (-613.908) [-602.670] -- 0:01:47
45000 -- (-606.673) (-608.356) [-607.255] (-604.008) * (-604.343) (-603.674) (-606.194) [-602.154] -- 0:01:46
Average standard deviation of split frequencies: 0.028304
45500 -- [-603.810] (-606.347) (-608.073) (-601.897) * (-603.722) [-604.841] (-607.345) (-612.585) -- 0:01:44
46000 -- (-606.471) (-603.831) (-604.925) [-608.537] * (-611.824) (-604.851) [-606.318] (-602.935) -- 0:01:43
46500 -- (-606.098) [-609.161] (-602.085) (-605.020) * (-600.646) (-610.609) (-604.336) [-602.244] -- 0:01:42
47000 -- (-604.269) [-610.631] (-606.291) (-607.019) * (-605.579) (-614.000) (-612.702) [-602.689] -- 0:01:41
47500 -- [-608.362] (-606.084) (-598.717) (-615.485) * (-604.042) (-604.818) (-600.463) [-606.042] -- 0:01:40
48000 -- [-604.692] (-613.320) (-601.767) (-611.011) * (-604.515) (-601.092) [-600.447] (-606.846) -- 0:01:39
48500 -- (-607.746) [-610.777] (-602.175) (-608.211) * (-602.000) [-599.964] (-602.815) (-613.444) -- 0:01:38
49000 -- (-601.813) (-614.679) (-601.837) [-603.084] * (-611.707) (-609.770) [-607.601] (-603.135) -- 0:01:37
49500 -- (-605.480) [-615.849] (-604.205) (-612.043) * (-611.843) (-602.719) [-600.880] (-604.947) -- 0:01:36
50000 -- [-604.242] (-613.219) (-601.868) (-606.290) * (-614.673) (-609.292) (-601.963) [-606.098] -- 0:01:35
Average standard deviation of split frequencies: 0.028758
50500 -- (-604.367) (-602.798) [-603.760] (-606.213) * (-600.060) (-607.503) [-603.499] (-601.741) -- 0:01:34
51000 -- (-602.093) [-601.204] (-628.255) (-612.874) * (-604.080) (-614.076) [-603.313] (-606.017) -- 0:01:33
51500 -- [-602.971] (-607.885) (-619.798) (-602.983) * (-607.740) (-611.742) [-602.925] (-604.393) -- 0:01:50
52000 -- (-604.016) (-611.226) (-609.151) [-601.611] * (-609.966) (-609.437) (-604.716) [-600.417] -- 0:01:49
52500 -- [-600.351] (-601.906) (-606.586) (-607.586) * [-602.296] (-607.371) (-603.028) (-605.055) -- 0:01:48
53000 -- (-609.669) (-605.735) [-600.041] (-605.180) * (-606.515) (-602.040) (-602.529) [-601.652] -- 0:01:47
53500 -- [-603.586] (-610.146) (-605.938) (-608.002) * (-607.502) (-602.695) [-606.278] (-603.236) -- 0:01:46
54000 -- (-601.836) (-603.379) (-608.919) [-598.817] * (-613.246) (-601.164) (-604.338) [-601.344] -- 0:01:45
54500 -- (-604.680) (-604.935) (-603.468) [-611.876] * (-603.939) (-603.396) (-606.019) [-605.304] -- 0:01:44
55000 -- (-606.930) [-604.969] (-598.582) (-604.188) * (-600.895) [-602.152] (-605.074) (-603.258) -- 0:01:43
Average standard deviation of split frequencies: 0.025655
55500 -- (-607.455) [-599.542] (-605.270) (-605.810) * (-603.844) [-606.610] (-604.437) (-604.913) -- 0:01:42
56000 -- (-608.994) (-601.508) [-609.280] (-607.350) * (-609.002) (-603.281) (-599.916) [-606.138] -- 0:01:41
56500 -- [-601.920] (-605.985) (-603.151) (-603.005) * (-609.138) [-605.618] (-600.021) (-600.934) -- 0:01:40
57000 -- [-600.751] (-603.759) (-603.665) (-610.184) * (-604.533) [-603.982] (-607.031) (-609.172) -- 0:01:39
57500 -- [-600.687] (-605.446) (-614.136) (-600.183) * [-604.052] (-604.645) (-606.518) (-607.786) -- 0:01:38
58000 -- [-602.382] (-606.810) (-605.723) (-605.259) * (-609.351) [-600.348] (-614.695) (-601.070) -- 0:01:37
58500 -- (-610.584) [-600.161] (-604.700) (-611.513) * (-607.975) [-604.871] (-605.854) (-607.115) -- 0:01:36
59000 -- (-605.483) (-601.503) [-604.525] (-601.941) * (-606.846) [-602.071] (-604.896) (-606.219) -- 0:01:35
59500 -- (-608.264) (-605.279) [-608.668] (-602.948) * (-601.470) [-604.958] (-603.666) (-611.990) -- 0:01:34
60000 -- (-604.490) (-617.311) (-604.052) [-596.390] * [-600.968] (-603.067) (-605.872) (-610.129) -- 0:01:34
Average standard deviation of split frequencies: 0.026583
60500 -- [-611.843] (-602.083) (-618.380) (-600.948) * (-608.356) [-601.830] (-612.267) (-607.311) -- 0:01:33
61000 -- (-602.437) (-599.970) [-603.965] (-612.162) * (-608.745) (-612.765) [-610.294] (-610.615) -- 0:01:32
61500 -- (-599.426) [-606.289] (-608.512) (-608.055) * (-606.310) [-603.235] (-607.074) (-603.209) -- 0:01:46
62000 -- [-605.242] (-604.514) (-618.766) (-602.732) * (-603.147) (-608.391) (-606.570) [-604.528] -- 0:01:45
62500 -- (-607.522) [-608.278] (-608.181) (-609.066) * (-605.228) [-605.049] (-602.043) (-607.826) -- 0:01:45
63000 -- (-616.788) [-602.731] (-610.281) (-605.485) * [-602.077] (-602.110) (-602.668) (-606.879) -- 0:01:44
63500 -- (-608.550) [-601.294] (-610.558) (-608.126) * (-607.071) (-607.696) [-607.795] (-605.107) -- 0:01:43
64000 -- (-606.586) [-615.126] (-607.140) (-603.446) * (-610.738) [-605.828] (-609.248) (-599.562) -- 0:01:42
64500 -- (-603.625) (-608.987) (-603.164) [-600.645] * (-609.235) [-604.941] (-609.009) (-601.074) -- 0:01:41
65000 -- (-614.658) (-602.068) (-607.428) [-603.389] * (-606.239) (-605.931) (-616.162) [-602.479] -- 0:01:40
Average standard deviation of split frequencies: 0.023700
65500 -- (-609.234) (-607.483) (-600.427) [-602.556] * (-617.118) (-602.834) [-605.494] (-611.438) -- 0:01:39
66000 -- (-606.849) (-603.502) (-607.625) [-601.268] * (-603.957) (-606.245) (-602.554) [-599.113] -- 0:01:39
66500 -- (-611.136) [-610.586] (-599.560) (-603.864) * (-603.313) (-607.512) [-604.991] (-605.450) -- 0:01:38
67000 -- (-606.149) (-603.385) (-606.385) [-598.973] * (-601.750) (-603.517) [-603.483] (-605.543) -- 0:01:37
67500 -- (-604.475) (-599.279) [-609.188] (-605.307) * (-608.800) (-600.671) (-602.612) [-599.787] -- 0:01:36
68000 -- (-606.835) (-611.109) (-608.570) [-609.889] * (-613.886) [-602.128] (-604.362) (-600.839) -- 0:01:35
68500 -- (-612.512) [-601.646] (-602.330) (-608.135) * (-603.746) (-605.591) [-603.949] (-601.937) -- 0:01:35
69000 -- (-612.446) [-601.396] (-608.680) (-605.027) * (-606.357) (-611.948) [-604.255] (-603.717) -- 0:01:34
69500 -- (-605.886) (-608.900) [-601.814] (-608.757) * (-610.928) (-615.369) (-608.021) [-600.944] -- 0:01:33
70000 -- [-602.060] (-602.840) (-604.957) (-603.867) * (-606.405) [-603.948] (-610.076) (-605.453) -- 0:01:33
Average standard deviation of split frequencies: 0.020922
70500 -- (-605.875) (-604.213) (-601.055) [-604.277] * (-609.915) (-605.796) (-604.774) [-607.185] -- 0:01:32
71000 -- (-605.161) [-607.843] (-599.236) (-617.424) * (-604.365) (-605.835) (-608.037) [-613.123] -- 0:01:31
71500 -- (-603.909) (-611.335) (-607.745) [-602.721] * [-604.048] (-608.437) (-603.508) (-598.981) -- 0:01:43
72000 -- (-607.216) (-603.837) (-603.486) [-606.212] * (-602.885) (-611.758) [-602.451] (-605.709) -- 0:01:43
72500 -- [-602.309] (-608.865) (-605.261) (-607.049) * [-607.273] (-607.964) (-605.862) (-599.641) -- 0:01:42
73000 -- (-612.154) (-605.845) (-599.281) [-601.227] * (-603.606) (-606.408) (-599.782) [-605.282] -- 0:01:41
73500 -- (-609.232) (-603.304) [-601.068] (-605.235) * (-617.877) (-602.245) (-605.535) [-612.516] -- 0:01:40
74000 -- [-608.504] (-607.295) (-612.849) (-602.008) * [-605.580] (-611.616) (-605.620) (-605.587) -- 0:01:40
74500 -- (-604.356) (-612.416) (-601.722) [-607.896] * (-612.271) [-601.996] (-603.800) (-607.895) -- 0:01:39
75000 -- (-602.379) (-612.196) [-608.691] (-601.903) * (-615.538) [-601.128] (-603.893) (-609.774) -- 0:01:38
Average standard deviation of split frequencies: 0.023831
75500 -- (-607.813) [-602.310] (-616.028) (-603.540) * (-602.987) (-616.053) (-611.165) [-599.956] -- 0:01:37
76000 -- [-610.642] (-603.586) (-613.837) (-601.218) * (-604.613) (-606.962) (-603.092) [-607.226] -- 0:01:37
76500 -- [-605.445] (-604.684) (-602.968) (-603.660) * (-602.067) [-606.928] (-609.297) (-604.432) -- 0:01:36
77000 -- (-604.672) (-601.859) (-603.790) [-602.209] * (-611.280) (-616.338) (-607.112) [-601.100] -- 0:01:35
77500 -- [-601.406] (-603.662) (-617.516) (-609.208) * [-604.256] (-604.905) (-607.759) (-601.391) -- 0:01:35
78000 -- [-609.487] (-607.926) (-606.441) (-604.425) * (-603.201) [-603.606] (-610.709) (-602.998) -- 0:01:34
78500 -- (-604.199) (-600.330) (-601.982) [-601.197] * [-603.762] (-603.883) (-620.803) (-606.449) -- 0:01:33
79000 -- (-606.131) (-602.391) (-607.571) [-602.381] * [-604.972] (-614.084) (-603.590) (-610.347) -- 0:01:33
79500 -- (-607.870) (-611.611) [-612.649] (-605.186) * [-602.921] (-608.971) (-608.002) (-609.340) -- 0:01:32
80000 -- (-608.977) (-601.679) (-615.152) [-606.673] * [-600.818] (-604.009) (-604.550) (-602.228) -- 0:01:32
Average standard deviation of split frequencies: 0.020871
80500 -- (-604.461) [-603.212] (-608.773) (-603.237) * (-605.126) [-603.500] (-602.131) (-611.860) -- 0:01:31
81000 -- [-604.925] (-602.222) (-612.895) (-616.878) * (-600.050) (-606.709) (-603.462) [-601.756] -- 0:01:30
81500 -- (-604.619) (-609.727) [-600.978] (-607.385) * (-601.294) [-608.703] (-606.199) (-601.062) -- 0:01:30
82000 -- (-601.792) (-601.443) [-601.878] (-602.443) * (-598.177) (-606.875) (-601.641) [-609.518] -- 0:01:40
82500 -- (-612.867) [-607.834] (-607.134) (-603.475) * (-601.411) (-608.213) [-604.098] (-606.414) -- 0:01:40
83000 -- (-604.291) (-607.401) (-611.055) [-602.585] * [-607.118] (-603.788) (-608.951) (-606.708) -- 0:01:39
83500 -- (-605.429) (-602.889) [-607.581] (-602.842) * (-602.339) (-604.518) [-601.231] (-600.505) -- 0:01:38
84000 -- [-600.196] (-604.991) (-607.774) (-604.497) * (-611.813) (-607.171) (-605.531) [-602.292] -- 0:01:38
84500 -- [-606.173] (-609.518) (-602.640) (-600.679) * (-605.739) (-608.160) (-609.617) [-602.671] -- 0:01:37
85000 -- (-604.990) (-607.118) (-611.535) [-602.226] * (-607.335) [-604.990] (-605.154) (-599.876) -- 0:01:36
Average standard deviation of split frequencies: 0.023172
85500 -- (-608.281) (-620.289) (-611.942) [-601.386] * [-606.242] (-604.182) (-604.369) (-601.146) -- 0:01:36
86000 -- (-608.313) (-602.536) [-603.910] (-600.907) * (-599.625) (-607.088) (-606.729) [-602.714] -- 0:01:35
86500 -- (-608.694) (-608.115) [-601.374] (-606.585) * (-603.892) (-606.375) [-608.699] (-608.397) -- 0:01:35
87000 -- (-602.853) (-604.383) (-604.379) [-605.018] * [-604.287] (-606.198) (-608.720) (-604.061) -- 0:01:34
87500 -- (-602.104) (-608.901) (-611.861) [-604.452] * [-607.335] (-608.388) (-610.495) (-607.333) -- 0:01:33
88000 -- (-604.574) [-604.904] (-613.027) (-606.474) * (-606.384) (-599.524) [-605.462] (-601.466) -- 0:01:33
88500 -- (-602.643) (-601.106) (-609.394) [-601.880] * [-606.461] (-607.581) (-607.937) (-623.309) -- 0:01:32
89000 -- [-604.540] (-615.806) (-605.091) (-605.436) * [-605.065] (-609.462) (-605.705) (-605.809) -- 0:01:32
89500 -- (-601.798) (-609.624) (-606.770) [-604.883] * (-610.702) (-608.342) [-602.419] (-604.115) -- 0:01:31
90000 -- (-604.852) (-603.954) (-610.235) [-608.421] * (-609.369) (-612.524) (-607.902) [-609.710] -- 0:01:31
Average standard deviation of split frequencies: 0.020797
90500 -- (-606.318) (-618.926) [-609.197] (-611.676) * (-604.792) [-606.073] (-608.644) (-602.802) -- 0:01:30
91000 -- [-602.910] (-619.128) (-609.108) (-610.752) * [-600.860] (-605.878) (-610.645) (-608.580) -- 0:01:29
91500 -- [-600.734] (-603.912) (-609.871) (-610.793) * [-598.682] (-608.059) (-611.012) (-602.559) -- 0:01:29
92000 -- (-607.788) (-610.417) [-605.500] (-601.869) * (-605.312) (-612.362) (-605.557) [-600.673] -- 0:01:38
92500 -- (-605.748) (-601.959) (-605.286) [-602.993] * (-600.786) (-608.647) (-604.375) [-598.027] -- 0:01:38
93000 -- (-604.155) (-607.335) (-602.279) [-599.958] * [-607.098] (-609.074) (-608.071) (-606.521) -- 0:01:37
93500 -- (-603.709) (-607.096) (-601.338) [-604.342] * (-608.565) [-604.627] (-601.054) (-603.256) -- 0:01:36
94000 -- [-604.556] (-607.539) (-604.634) (-601.738) * [-600.247] (-607.220) (-610.290) (-599.512) -- 0:01:36
94500 -- (-607.297) (-608.885) (-609.913) [-604.418] * (-598.476) [-600.068] (-603.563) (-609.585) -- 0:01:35
95000 -- (-599.595) [-605.820] (-609.393) (-603.741) * [-604.109] (-611.078) (-608.314) (-607.008) -- 0:01:35
Average standard deviation of split frequencies: 0.021279
95500 -- (-612.489) (-604.123) [-601.563] (-607.428) * (-605.663) (-611.153) [-599.998] (-602.465) -- 0:01:34
96000 -- [-601.067] (-600.640) (-603.468) (-608.773) * (-610.073) (-605.417) (-599.554) [-600.727] -- 0:01:34
96500 -- (-607.757) (-604.509) [-603.454] (-601.316) * (-609.232) (-605.951) (-601.677) [-609.804] -- 0:01:33
97000 -- [-605.514] (-608.432) (-613.986) (-610.766) * (-608.330) (-603.984) (-604.676) [-604.436] -- 0:01:33
97500 -- (-607.467) [-604.677] (-606.755) (-603.400) * (-610.077) (-608.072) [-603.592] (-603.313) -- 0:01:32
98000 -- (-611.834) [-603.522] (-603.930) (-610.507) * (-597.988) (-603.136) (-612.540) [-601.519] -- 0:01:32
98500 -- [-603.970] (-597.764) (-606.908) (-605.575) * (-609.247) (-619.881) (-601.765) [-605.696] -- 0:01:31
99000 -- (-603.534) (-600.183) [-604.068] (-606.972) * (-605.814) (-611.835) [-605.744] (-614.098) -- 0:01:31
99500 -- (-610.886) [-602.678] (-603.114) (-605.603) * (-605.201) [-606.153] (-601.442) (-612.109) -- 0:01:30
100000 -- [-609.610] (-606.950) (-607.900) (-609.399) * (-604.132) (-606.026) [-600.680] (-618.696) -- 0:01:30
Average standard deviation of split frequencies: 0.020839
100500 -- (-615.801) (-605.731) [-605.271] (-604.838) * (-606.117) (-610.805) (-608.570) [-602.323] -- 0:01:29
101000 -- (-608.919) (-605.506) (-603.258) [-598.871] * (-610.324) (-610.583) (-600.268) [-604.953] -- 0:01:29
101500 -- (-610.057) [-601.384] (-604.089) (-611.643) * (-610.570) (-611.792) (-604.655) [-598.879] -- 0:01:28
102000 -- [-603.878] (-601.701) (-603.634) (-603.978) * (-602.622) (-609.156) [-606.009] (-603.820) -- 0:01:36
102500 -- (-602.068) (-614.532) [-603.052] (-604.703) * (-603.551) (-602.271) [-603.335] (-606.773) -- 0:01:36
103000 -- [-599.844] (-608.959) (-608.823) (-609.549) * (-604.482) (-605.305) (-601.243) [-608.582] -- 0:01:35
103500 -- (-604.966) (-607.498) [-605.073] (-607.036) * (-597.179) (-605.611) [-607.305] (-606.422) -- 0:01:35
104000 -- (-605.985) (-621.480) [-600.630] (-614.189) * (-607.740) (-601.683) (-604.940) [-602.399] -- 0:01:34
104500 -- (-603.372) (-607.705) (-598.817) [-605.997] * (-611.338) [-607.236] (-602.115) (-612.846) -- 0:01:34
105000 -- (-601.164) [-609.943] (-603.917) (-607.017) * (-600.053) (-604.611) [-603.758] (-601.552) -- 0:01:33
Average standard deviation of split frequencies: 0.019810
105500 -- (-602.517) (-608.153) [-603.965] (-604.426) * (-610.873) (-606.511) (-608.705) [-599.957] -- 0:01:33
106000 -- [-600.725] (-614.333) (-600.085) (-608.077) * (-604.457) (-610.775) [-601.483] (-602.844) -- 0:01:32
106500 -- (-609.915) [-599.860] (-603.226) (-606.451) * (-599.534) (-611.235) [-598.981] (-601.475) -- 0:01:32
107000 -- [-604.154] (-605.588) (-602.580) (-602.426) * (-602.426) (-607.131) (-607.516) [-602.232] -- 0:01:31
107500 -- (-612.898) (-602.427) (-606.163) [-606.235] * (-603.642) [-603.290] (-609.078) (-602.736) -- 0:01:31
108000 -- (-608.710) [-603.808] (-605.040) (-605.515) * [-601.356] (-610.337) (-611.024) (-615.959) -- 0:01:30
108500 -- (-608.091) (-598.160) (-604.411) [-606.961] * [-600.914] (-609.026) (-606.599) (-607.080) -- 0:01:30
109000 -- (-605.443) [-600.218] (-603.068) (-599.877) * (-614.031) [-601.027] (-607.386) (-605.057) -- 0:01:29
109500 -- (-609.513) (-607.284) [-603.326] (-609.664) * (-603.086) (-606.393) [-601.885] (-606.405) -- 0:01:29
110000 -- [-598.786] (-600.810) (-605.007) (-604.346) * [-606.746] (-604.399) (-604.623) (-602.805) -- 0:01:29
Average standard deviation of split frequencies: 0.020893
110500 -- [-600.870] (-601.049) (-617.657) (-607.375) * (-615.675) (-609.534) (-604.368) [-601.058] -- 0:01:28
111000 -- (-608.304) (-601.364) [-600.925] (-615.645) * (-608.108) (-616.545) [-612.459] (-607.000) -- 0:01:28
111500 -- (-607.299) [-600.173] (-606.303) (-602.474) * [-609.016] (-611.733) (-607.867) (-607.881) -- 0:01:27
112000 -- (-603.171) [-600.012] (-609.190) (-598.698) * [-602.777] (-602.720) (-601.955) (-605.630) -- 0:01:27
112500 -- (-609.686) [-602.549] (-602.259) (-607.293) * (-603.434) (-604.075) [-603.739] (-609.970) -- 0:01:34
113000 -- [-605.608] (-608.238) (-600.472) (-609.898) * (-606.171) (-609.589) [-600.937] (-611.089) -- 0:01:34
113500 -- (-602.967) [-602.613] (-601.804) (-602.332) * (-600.980) (-607.290) (-602.303) [-603.457] -- 0:01:33
114000 -- (-607.464) [-603.960] (-604.508) (-608.823) * [-607.032] (-606.082) (-611.518) (-610.658) -- 0:01:33
114500 -- (-607.784) [-601.095] (-607.137) (-606.512) * (-603.914) (-615.660) (-605.795) [-603.656] -- 0:01:32
115000 -- (-609.082) [-602.460] (-607.351) (-605.261) * (-603.389) [-610.209] (-608.289) (-603.048) -- 0:01:32
Average standard deviation of split frequencies: 0.021742
115500 -- (-605.771) [-603.129] (-615.085) (-609.759) * [-602.556] (-606.354) (-600.184) (-604.781) -- 0:01:31
116000 -- (-607.718) [-606.716] (-614.673) (-603.275) * (-607.104) (-603.271) (-611.293) [-602.159] -- 0:01:31
116500 -- (-604.129) (-611.413) (-608.684) [-602.430] * (-615.166) (-608.299) (-601.380) [-601.393] -- 0:01:31
117000 -- (-602.026) (-610.079) [-614.002] (-610.463) * (-602.224) (-615.321) [-600.659] (-611.160) -- 0:01:30
117500 -- (-604.516) (-605.040) [-607.637] (-603.648) * (-606.229) (-604.954) (-605.582) [-602.587] -- 0:01:30
118000 -- (-609.831) [-605.821] (-606.145) (-604.797) * (-602.520) (-606.879) (-607.585) [-601.402] -- 0:01:29
118500 -- [-609.503] (-613.269) (-604.173) (-608.450) * (-606.077) [-600.413] (-606.910) (-603.729) -- 0:01:29
119000 -- (-602.817) [-602.580] (-600.556) (-604.415) * (-603.847) (-606.284) [-606.025] (-602.953) -- 0:01:28
119500 -- (-604.651) [-603.729] (-604.364) (-605.197) * (-607.026) (-614.399) (-612.436) [-602.211] -- 0:01:28
120000 -- (-604.549) (-599.131) [-612.399] (-605.949) * (-603.727) (-603.780) (-600.309) [-602.933] -- 0:01:28
Average standard deviation of split frequencies: 0.023440
120500 -- [-598.185] (-604.725) (-609.274) (-608.478) * (-601.106) (-600.096) (-605.019) [-604.435] -- 0:01:27
121000 -- (-607.328) [-606.880] (-604.509) (-606.522) * (-613.795) (-607.449) (-610.393) [-607.714] -- 0:01:27
121500 -- (-603.795) (-611.166) (-603.039) [-606.893] * (-609.938) (-601.931) (-605.654) [-600.742] -- 0:01:26
122000 -- (-603.958) (-605.901) (-607.368) [-605.340] * [-601.982] (-602.561) (-604.531) (-606.327) -- 0:01:26
122500 -- (-609.678) (-604.870) (-607.021) [-603.746] * [-601.875] (-609.478) (-608.847) (-608.352) -- 0:01:33
123000 -- (-604.193) (-602.278) (-606.713) [-602.718] * (-603.406) (-608.478) (-609.451) [-606.782] -- 0:01:32
123500 -- (-608.398) [-601.190] (-613.087) (-599.643) * (-601.336) [-603.329] (-603.616) (-605.623) -- 0:01:32
124000 -- (-605.051) (-611.831) (-609.164) [-600.811] * [-605.920] (-605.099) (-602.550) (-607.560) -- 0:01:31
124500 -- [-602.173] (-613.867) (-614.324) (-616.832) * (-603.990) (-607.582) [-604.732] (-607.726) -- 0:01:31
125000 -- (-608.790) (-604.546) (-603.882) [-603.503] * (-606.972) (-610.972) [-604.107] (-615.746) -- 0:01:31
Average standard deviation of split frequencies: 0.023128
125500 -- (-605.650) (-607.619) (-602.626) [-610.938] * [-606.453] (-603.494) (-602.406) (-607.679) -- 0:01:30
126000 -- [-607.296] (-602.738) (-609.311) (-611.332) * (-608.013) [-606.688] (-607.618) (-613.825) -- 0:01:30
126500 -- (-613.002) [-607.562] (-606.475) (-606.915) * (-608.776) (-606.435) [-607.299] (-612.192) -- 0:01:29
127000 -- (-603.420) (-607.777) (-607.513) [-605.955] * (-605.759) (-613.290) [-601.243] (-607.627) -- 0:01:29
127500 -- (-608.019) [-602.176] (-609.678) (-606.649) * [-607.235] (-611.176) (-610.461) (-626.008) -- 0:01:28
128000 -- (-602.149) (-603.285) [-609.264] (-604.395) * [-611.391] (-603.752) (-601.943) (-603.987) -- 0:01:28
128500 -- (-613.321) (-615.114) (-603.778) [-608.504] * (-602.020) (-605.444) (-603.483) [-605.968] -- 0:01:28
129000 -- (-608.826) (-604.703) (-607.879) [-609.589] * [-607.577] (-605.509) (-603.522) (-609.325) -- 0:01:27
129500 -- (-613.889) (-607.500) (-609.775) [-607.803] * (-616.742) (-603.773) (-602.937) [-599.597] -- 0:01:27
130000 -- [-607.209] (-602.630) (-600.399) (-601.761) * (-601.476) (-603.646) [-601.688] (-605.852) -- 0:01:27
Average standard deviation of split frequencies: 0.022333
130500 -- [-610.208] (-602.417) (-609.631) (-600.038) * (-610.009) (-602.634) [-602.289] (-605.320) -- 0:01:26
131000 -- [-607.086] (-602.010) (-610.588) (-603.227) * [-607.026] (-604.881) (-610.212) (-606.241) -- 0:01:26
131500 -- (-604.389) (-604.253) (-598.798) [-605.030] * (-602.205) [-601.113] (-607.888) (-605.499) -- 0:01:25
132000 -- (-608.352) [-607.487] (-615.732) (-600.492) * (-606.101) (-615.238) (-602.680) [-601.132] -- 0:01:25
132500 -- (-599.907) [-603.503] (-605.550) (-599.257) * (-602.753) (-614.495) [-605.415] (-602.045) -- 0:01:31
133000 -- (-599.538) (-601.571) [-601.926] (-595.302) * [-605.986] (-607.626) (-609.274) (-600.039) -- 0:01:31
133500 -- (-613.351) (-606.239) (-610.263) [-603.930] * (-602.972) (-606.333) (-600.899) [-608.023] -- 0:01:30
134000 -- (-601.744) [-609.824] (-608.614) (-601.040) * (-610.625) (-611.744) (-608.516) [-603.569] -- 0:01:30
134500 -- (-603.536) (-605.448) (-605.570) [-599.625] * [-601.665] (-605.850) (-607.729) (-604.358) -- 0:01:30
135000 -- [-604.003] (-607.891) (-606.158) (-612.598) * [-610.026] (-602.734) (-609.460) (-601.082) -- 0:01:29
Average standard deviation of split frequencies: 0.021709
135500 -- (-605.028) (-603.378) [-608.643] (-603.259) * (-602.314) (-610.000) [-606.600] (-601.612) -- 0:01:29
136000 -- (-614.746) (-607.395) [-607.533] (-605.009) * (-608.799) [-599.284] (-605.342) (-610.729) -- 0:01:28
136500 -- [-612.232] (-602.460) (-603.423) (-609.408) * [-604.404] (-602.607) (-611.227) (-608.750) -- 0:01:28
137000 -- (-607.564) (-604.153) (-601.858) [-603.914] * (-605.728) (-603.997) (-612.910) [-607.114] -- 0:01:28
137500 -- (-609.226) (-603.147) (-602.361) [-605.901] * (-612.279) (-608.084) (-607.565) [-602.377] -- 0:01:27
138000 -- [-600.788] (-605.384) (-611.875) (-605.714) * (-602.557) [-600.064] (-606.732) (-604.588) -- 0:01:27
138500 -- (-608.514) (-600.465) (-604.999) [-598.599] * (-613.492) [-604.921] (-599.487) (-602.964) -- 0:01:27
139000 -- [-608.936] (-603.711) (-600.703) (-607.288) * (-605.626) (-601.564) [-603.874] (-609.413) -- 0:01:26
139500 -- [-605.908] (-605.761) (-610.907) (-604.099) * (-603.720) [-604.014] (-611.405) (-609.294) -- 0:01:26
140000 -- [-603.717] (-603.678) (-607.145) (-604.645) * (-606.642) [-605.288] (-608.621) (-600.965) -- 0:01:26
Average standard deviation of split frequencies: 0.021038
140500 -- (-609.068) [-609.849] (-606.663) (-606.555) * (-606.699) (-605.290) (-612.560) [-610.685] -- 0:01:25
141000 -- (-602.042) [-602.325] (-619.686) (-599.719) * (-603.014) (-620.768) (-606.258) [-606.270] -- 0:01:25
141500 -- (-609.792) (-601.380) [-605.334] (-608.374) * (-609.628) [-606.490] (-605.915) (-609.594) -- 0:01:24
142000 -- (-605.105) [-596.699] (-613.005) (-605.001) * [-603.496] (-599.520) (-599.150) (-611.475) -- 0:01:24
142500 -- (-601.528) [-607.811] (-612.410) (-599.669) * (-601.015) (-602.434) (-603.533) [-607.573] -- 0:01:24
143000 -- (-607.483) (-603.209) [-606.360] (-603.204) * [-601.647] (-606.866) (-608.819) (-604.121) -- 0:01:29
143500 -- (-605.654) (-604.512) [-599.694] (-602.418) * (-598.559) [-603.593] (-610.163) (-608.914) -- 0:01:29
144000 -- (-615.204) (-600.576) (-604.208) [-604.847] * (-608.106) [-601.944] (-610.740) (-601.434) -- 0:01:29
144500 -- (-602.141) (-606.788) [-604.073] (-614.389) * (-623.964) [-607.587] (-614.277) (-602.836) -- 0:01:28
145000 -- [-605.418] (-603.655) (-611.283) (-612.557) * (-603.620) [-599.814] (-615.250) (-606.659) -- 0:01:28
Average standard deviation of split frequencies: 0.020019
145500 -- [-605.026] (-600.511) (-607.231) (-608.294) * (-615.444) [-606.762] (-608.294) (-606.384) -- 0:01:28
146000 -- (-606.151) [-609.046] (-603.540) (-605.939) * (-605.046) (-606.518) [-605.172] (-614.454) -- 0:01:27
146500 -- (-603.797) [-600.818] (-601.216) (-605.397) * (-604.887) (-609.752) [-601.210] (-609.119) -- 0:01:27
147000 -- (-608.058) [-605.341] (-608.458) (-609.069) * (-606.212) (-603.142) [-602.778] (-606.842) -- 0:01:27
147500 -- (-610.007) [-605.747] (-609.353) (-608.632) * (-612.703) (-600.629) (-604.259) [-602.905] -- 0:01:26
148000 -- (-604.293) (-606.862) (-608.637) [-603.070] * (-603.340) (-606.193) [-602.476] (-609.174) -- 0:01:26
148500 -- (-603.402) [-605.559] (-604.649) (-610.129) * (-615.914) (-602.320) (-606.498) [-601.391] -- 0:01:26
149000 -- (-604.070) (-600.745) [-599.054] (-605.247) * (-613.609) [-608.782] (-604.314) (-603.627) -- 0:01:25
149500 -- (-609.319) [-612.211] (-604.565) (-609.083) * [-597.467] (-606.974) (-607.549) (-608.890) -- 0:01:25
150000 -- (-609.333) [-603.915] (-599.482) (-607.213) * (-601.335) [-600.212] (-605.946) (-605.358) -- 0:01:25
Average standard deviation of split frequencies: 0.019711
150500 -- (-609.201) [-599.926] (-605.179) (-605.782) * (-601.566) (-602.514) (-602.307) [-605.534] -- 0:01:24
151000 -- [-602.410] (-601.829) (-600.474) (-610.011) * (-606.122) (-603.954) [-604.681] (-607.758) -- 0:01:24
151500 -- (-601.607) (-603.073) [-601.851] (-602.172) * (-602.081) [-600.408] (-618.421) (-605.496) -- 0:01:24
152000 -- (-605.421) (-603.707) [-603.677] (-608.232) * [-598.682] (-601.109) (-615.260) (-610.784) -- 0:01:23
152500 -- (-610.008) (-602.311) (-600.415) [-601.933] * [-608.443] (-612.152) (-603.252) (-606.284) -- 0:01:28
153000 -- (-606.264) (-608.140) (-607.456) [-607.896] * [-603.555] (-599.556) (-603.414) (-608.822) -- 0:01:28
153500 -- (-601.508) (-606.169) (-602.239) [-610.036] * (-597.095) (-603.054) [-605.909] (-616.956) -- 0:01:28
154000 -- (-611.682) (-604.698) (-608.345) [-606.983] * (-604.573) [-599.346] (-606.468) (-607.613) -- 0:01:27
154500 -- (-602.088) (-607.491) (-610.934) [-607.466] * [-598.763] (-605.480) (-613.579) (-604.756) -- 0:01:27
155000 -- [-608.317] (-611.912) (-603.694) (-604.882) * (-603.131) (-605.237) [-611.315] (-605.346) -- 0:01:27
Average standard deviation of split frequencies: 0.019244
155500 -- (-605.560) (-604.687) [-603.537] (-600.370) * (-602.594) (-598.646) (-606.277) [-604.756] -- 0:01:26
156000 -- (-606.039) (-605.449) (-604.082) [-604.936] * (-603.155) [-601.475] (-607.372) (-602.380) -- 0:01:26
156500 -- (-608.851) [-600.133] (-599.858) (-601.583) * [-604.134] (-603.703) (-615.139) (-603.417) -- 0:01:26
157000 -- (-609.743) (-604.235) [-601.627] (-614.140) * [-604.141] (-604.768) (-603.568) (-614.212) -- 0:01:25
157500 -- (-603.961) (-606.974) [-602.468] (-608.105) * (-606.813) (-603.979) [-602.859] (-610.139) -- 0:01:25
158000 -- (-599.607) (-602.726) [-601.849] (-602.211) * (-605.675) [-604.085] (-604.265) (-613.936) -- 0:01:25
158500 -- [-603.189] (-605.232) (-598.080) (-602.497) * (-611.229) (-604.770) [-605.451] (-602.850) -- 0:01:24
159000 -- [-603.954] (-605.949) (-601.119) (-613.726) * [-604.108] (-604.775) (-602.912) (-605.139) -- 0:01:24
159500 -- (-604.526) (-609.811) [-598.188] (-606.949) * (-605.647) (-601.143) [-607.161] (-611.279) -- 0:01:24
160000 -- (-605.249) [-601.571] (-605.590) (-605.234) * (-601.247) (-604.106) [-606.783] (-606.207) -- 0:01:24
Average standard deviation of split frequencies: 0.019397
160500 -- (-602.671) [-599.759] (-607.523) (-606.346) * (-612.562) [-599.129] (-610.650) (-606.116) -- 0:01:23
161000 -- (-600.751) (-603.317) (-612.958) [-600.078] * (-610.812) (-610.582) [-598.735] (-604.505) -- 0:01:23
161500 -- (-602.305) [-603.417] (-605.525) (-609.980) * (-602.487) (-604.620) (-609.561) [-605.205] -- 0:01:23
162000 -- (-602.575) (-607.733) (-606.423) [-600.529] * (-611.249) (-607.556) [-604.749] (-606.297) -- 0:01:27
162500 -- (-613.578) (-605.927) (-613.948) [-604.219] * (-612.390) [-604.607] (-613.609) (-605.767) -- 0:01:27
163000 -- [-613.816] (-605.424) (-604.339) (-604.474) * (-604.327) [-606.259] (-608.722) (-603.816) -- 0:01:27
163500 -- (-604.111) (-604.664) [-609.691] (-615.822) * (-607.078) (-602.877) [-606.344] (-601.520) -- 0:01:26
164000 -- (-604.796) (-603.509) (-603.899) [-603.727] * (-602.128) (-604.866) (-607.733) [-598.563] -- 0:01:26
164500 -- (-600.850) (-607.775) [-600.557] (-603.073) * (-603.388) (-607.963) (-606.566) [-602.849] -- 0:01:26
165000 -- [-603.531] (-608.935) (-608.087) (-608.093) * (-605.465) (-603.588) (-611.735) [-606.506] -- 0:01:26
Average standard deviation of split frequencies: 0.017637
165500 -- (-603.377) [-603.227] (-602.880) (-609.872) * (-613.602) (-608.428) (-603.249) [-600.243] -- 0:01:25
166000 -- (-608.240) [-601.421] (-602.343) (-607.269) * (-614.619) [-608.900] (-612.109) (-603.910) -- 0:01:25
166500 -- [-604.470] (-597.640) (-609.423) (-606.005) * (-611.789) (-600.358) [-606.673] (-603.244) -- 0:01:25
167000 -- (-608.462) (-603.868) [-608.284] (-605.732) * (-603.867) [-607.050] (-605.574) (-604.150) -- 0:01:24
167500 -- [-603.020] (-604.929) (-603.257) (-606.509) * (-603.887) (-609.645) (-605.963) [-602.896] -- 0:01:24
168000 -- (-610.220) [-599.074] (-600.596) (-602.493) * (-603.383) [-606.252] (-600.823) (-600.008) -- 0:01:24
168500 -- (-606.533) (-600.426) [-600.284] (-600.355) * (-606.302) [-611.934] (-610.973) (-608.049) -- 0:01:23
169000 -- (-607.719) [-598.548] (-609.348) (-603.433) * [-601.374] (-603.479) (-607.685) (-604.338) -- 0:01:23
169500 -- (-601.408) (-609.514) [-605.448] (-607.971) * (-602.424) [-609.662] (-607.926) (-599.587) -- 0:01:23
170000 -- (-604.461) [-601.746] (-602.539) (-601.463) * (-601.392) (-609.932) [-606.969] (-605.171) -- 0:01:23
Average standard deviation of split frequencies: 0.017154
170500 -- (-615.204) (-602.872) [-598.958] (-603.602) * [-604.924] (-607.590) (-602.568) (-609.749) -- 0:01:22
171000 -- (-606.487) [-602.583] (-607.421) (-603.509) * [-605.906] (-609.127) (-601.924) (-605.765) -- 0:01:22
171500 -- (-604.422) [-598.383] (-605.525) (-609.782) * [-601.261] (-607.109) (-613.069) (-615.491) -- 0:01:22
172000 -- (-603.954) (-605.344) [-600.614] (-607.201) * (-600.649) (-607.092) [-603.576] (-601.656) -- 0:01:21
172500 -- [-595.876] (-605.047) (-607.646) (-598.937) * (-605.775) (-608.157) (-603.010) [-607.528] -- 0:01:26
173000 -- (-599.914) (-600.707) (-611.441) [-608.291] * (-608.692) (-604.181) [-604.844] (-605.450) -- 0:01:26
173500 -- (-602.975) (-607.201) [-603.338] (-606.769) * (-604.539) (-605.174) [-611.932] (-604.047) -- 0:01:25
174000 -- (-605.719) (-603.514) [-606.421] (-605.667) * (-608.596) (-606.735) (-618.935) [-603.306] -- 0:01:25
174500 -- [-605.121] (-598.483) (-609.266) (-602.522) * (-608.138) [-604.143] (-612.221) (-607.701) -- 0:01:25
175000 -- (-612.422) (-598.909) [-602.831] (-617.009) * [-607.312] (-613.057) (-611.657) (-607.364) -- 0:01:24
Average standard deviation of split frequencies: 0.015930
175500 -- (-623.533) [-604.253] (-612.563) (-605.848) * (-607.523) (-606.395) [-603.427] (-610.309) -- 0:01:24
176000 -- (-612.372) [-601.441] (-613.228) (-602.151) * [-602.659] (-611.058) (-616.744) (-615.061) -- 0:01:24
176500 -- [-608.136] (-601.084) (-607.432) (-600.882) * [-606.414] (-603.714) (-614.568) (-608.921) -- 0:01:23
177000 -- [-612.402] (-614.424) (-615.743) (-601.806) * (-607.798) [-602.993] (-607.076) (-603.306) -- 0:01:23
177500 -- (-608.551) [-609.992] (-611.016) (-602.859) * [-600.828] (-605.048) (-607.892) (-600.182) -- 0:01:23
178000 -- (-604.681) [-603.239] (-610.242) (-606.119) * [-603.172] (-599.876) (-604.749) (-600.422) -- 0:01:23
178500 -- (-606.071) (-608.428) (-614.291) [-604.375] * (-603.288) (-604.924) (-602.557) [-599.368] -- 0:01:22
179000 -- (-606.132) (-604.228) (-609.650) [-604.351] * (-609.987) (-607.785) (-607.622) [-603.136] -- 0:01:22
179500 -- (-603.998) [-601.221] (-611.923) (-607.775) * (-604.657) (-613.131) (-608.707) [-600.538] -- 0:01:22
180000 -- (-605.623) (-609.344) (-608.931) [-604.885] * (-605.226) (-606.889) (-606.705) [-609.033] -- 0:01:22
Average standard deviation of split frequencies: 0.015793
180500 -- (-599.710) [-606.434] (-609.116) (-604.522) * (-606.391) (-603.124) [-606.303] (-610.113) -- 0:01:21
181000 -- (-613.288) [-605.134] (-607.714) (-614.867) * [-600.731] (-609.074) (-605.868) (-604.782) -- 0:01:21
181500 -- (-602.790) [-602.979] (-603.924) (-612.192) * [-604.892] (-606.667) (-603.947) (-606.061) -- 0:01:21
182000 -- (-605.326) (-606.457) [-610.896] (-600.074) * [-608.470] (-603.673) (-615.730) (-598.877) -- 0:01:20
182500 -- (-602.025) [-596.604] (-604.790) (-610.124) * (-607.894) (-610.696) [-605.067] (-606.272) -- 0:01:25
183000 -- [-604.024] (-609.834) (-601.851) (-606.000) * (-600.969) (-598.898) (-612.840) [-601.770] -- 0:01:24
183500 -- (-608.628) (-604.491) (-602.573) [-613.075] * (-610.400) [-599.211] (-601.925) (-604.476) -- 0:01:24
184000 -- (-608.913) [-604.690] (-611.345) (-607.808) * (-606.921) (-607.497) [-601.694] (-604.874) -- 0:01:24
184500 -- (-605.868) (-607.876) (-610.535) [-604.398] * (-610.565) [-606.370] (-600.485) (-610.127) -- 0:01:23
185000 -- (-602.934) [-612.576] (-606.893) (-610.212) * [-603.973] (-603.194) (-606.751) (-621.223) -- 0:01:23
Average standard deviation of split frequencies: 0.016727
185500 -- (-606.868) (-611.990) (-604.021) [-609.676] * (-608.919) (-600.256) [-599.488] (-605.744) -- 0:01:23
186000 -- (-604.988) (-611.566) (-604.513) [-603.137] * [-601.940] (-602.639) (-610.312) (-607.871) -- 0:01:23
186500 -- (-604.470) (-603.357) (-605.317) [-608.740] * (-603.033) [-598.211] (-601.162) (-601.764) -- 0:01:22
187000 -- (-611.394) [-603.803] (-614.402) (-611.817) * (-601.514) (-603.323) (-602.393) [-606.344] -- 0:01:22
187500 -- (-599.426) [-604.113] (-613.417) (-610.127) * (-608.993) (-600.752) [-604.435] (-609.945) -- 0:01:22
188000 -- (-607.976) (-610.760) (-603.011) [-597.841] * (-604.094) [-608.535] (-607.766) (-606.723) -- 0:01:22
188500 -- [-602.108] (-602.360) (-601.854) (-616.111) * (-604.032) (-604.853) [-611.824] (-607.869) -- 0:01:21
189000 -- (-600.284) (-608.813) (-602.153) [-604.095] * [-600.537] (-606.225) (-603.676) (-613.160) -- 0:01:21
189500 -- (-606.113) (-606.696) (-609.299) [-601.439] * [-606.604] (-604.988) (-602.193) (-605.679) -- 0:01:21
190000 -- (-599.586) (-618.997) (-603.541) [-603.065] * (-603.368) [-603.131] (-606.046) (-603.252) -- 0:01:21
Average standard deviation of split frequencies: 0.017060
190500 -- (-604.443) [-600.035] (-607.109) (-608.692) * (-606.177) [-603.606] (-607.145) (-610.078) -- 0:01:20
191000 -- (-610.370) (-605.558) [-605.607] (-608.836) * [-603.243] (-603.390) (-605.120) (-614.870) -- 0:01:20
191500 -- (-608.057) (-607.989) (-605.920) [-606.311] * (-609.916) [-605.365] (-609.308) (-617.568) -- 0:01:20
192000 -- (-609.683) (-618.598) [-606.485] (-603.334) * (-611.645) (-608.107) (-606.470) [-603.406] -- 0:01:19
192500 -- [-606.893] (-612.980) (-610.199) (-614.264) * (-605.177) (-612.445) (-608.382) [-598.858] -- 0:01:19
193000 -- [-602.797] (-608.995) (-609.504) (-607.889) * (-607.922) (-608.738) [-599.144] (-599.558) -- 0:01:23
193500 -- (-602.249) (-600.426) [-604.228] (-605.212) * [-603.269] (-612.743) (-603.595) (-603.034) -- 0:01:23
194000 -- [-605.282] (-606.175) (-608.403) (-600.834) * (-607.382) [-602.992] (-604.099) (-599.492) -- 0:01:23
194500 -- (-607.164) (-608.619) [-605.954] (-606.515) * [-608.746] (-602.118) (-604.983) (-605.658) -- 0:01:22
195000 -- (-608.806) (-611.516) (-604.191) [-603.758] * (-610.287) [-599.082] (-608.851) (-601.849) -- 0:01:22
Average standard deviation of split frequencies: 0.020711
195500 -- (-607.943) [-605.003] (-602.795) (-612.465) * (-606.061) (-605.770) (-611.142) [-606.050] -- 0:01:22
196000 -- (-609.117) [-608.040] (-607.693) (-609.787) * (-610.942) (-602.086) (-604.253) [-598.437] -- 0:01:22
196500 -- (-608.178) (-603.309) (-601.457) [-606.560] * (-609.379) (-607.829) (-604.499) [-607.685] -- 0:01:21
197000 -- (-606.692) (-604.355) (-608.053) [-606.629] * (-614.504) (-602.832) (-599.871) [-604.432] -- 0:01:21
197500 -- (-599.949) (-601.923) (-607.315) [-605.613] * (-603.583) (-605.903) [-608.480] (-611.524) -- 0:01:21
198000 -- (-609.611) [-607.132] (-606.032) (-605.276) * (-605.343) [-601.304] (-603.079) (-607.855) -- 0:01:21
198500 -- [-611.336] (-607.127) (-601.733) (-603.950) * (-603.035) (-602.868) [-607.886] (-608.085) -- 0:01:20
199000 -- [-608.155] (-604.398) (-603.045) (-607.812) * [-603.105] (-603.125) (-603.372) (-609.704) -- 0:01:20
199500 -- (-599.974) (-600.695) (-608.027) [-599.864] * (-602.462) (-610.627) (-613.507) [-603.915] -- 0:01:20
200000 -- (-604.448) [-603.093] (-607.476) (-604.509) * (-598.373) (-602.736) [-606.838] (-605.799) -- 0:01:20
Average standard deviation of split frequencies: 0.021143
200500 -- (-604.300) (-597.882) (-605.868) [-602.769] * (-600.732) (-608.330) [-602.909] (-599.019) -- 0:01:19
201000 -- [-597.912] (-606.893) (-603.336) (-606.733) * (-604.600) (-608.303) (-607.194) [-602.527] -- 0:01:19
201500 -- (-604.108) (-604.937) [-604.087] (-604.495) * (-607.188) (-607.136) (-609.931) [-607.333] -- 0:01:19
202000 -- (-602.508) [-598.956] (-610.968) (-603.617) * (-604.706) (-598.357) (-604.453) [-601.293] -- 0:01:19
202500 -- (-614.445) (-604.254) (-597.272) [-601.037] * (-606.947) [-603.044] (-605.006) (-607.943) -- 0:01:18
203000 -- [-602.254] (-605.872) (-609.444) (-602.538) * (-609.442) [-600.887] (-605.847) (-609.487) -- 0:01:22
203500 -- [-609.342] (-606.923) (-605.617) (-601.612) * (-600.588) (-601.303) (-613.342) [-606.615] -- 0:01:22
204000 -- (-601.044) [-605.332] (-604.346) (-605.399) * (-610.975) [-596.459] (-608.274) (-602.612) -- 0:01:21
204500 -- [-607.342] (-610.025) (-601.374) (-607.928) * (-603.560) (-599.709) [-606.162] (-605.751) -- 0:01:21
205000 -- (-605.196) (-603.591) [-604.123] (-602.157) * (-604.264) [-597.416] (-607.113) (-604.346) -- 0:01:21
Average standard deviation of split frequencies: 0.021358
205500 -- (-606.444) [-602.956] (-609.559) (-614.657) * (-605.587) [-606.379] (-601.488) (-605.152) -- 0:01:21
206000 -- [-602.704] (-606.351) (-604.716) (-602.835) * (-607.767) (-605.855) [-608.991] (-601.779) -- 0:01:20
206500 -- (-605.399) (-608.105) [-599.569] (-604.380) * (-611.677) (-609.375) [-608.259] (-601.059) -- 0:01:20
207000 -- (-609.451) (-604.399) (-604.472) [-607.807] * (-607.836) (-605.775) [-602.874] (-603.347) -- 0:01:20
207500 -- [-601.939] (-612.093) (-609.412) (-607.055) * (-606.688) (-601.038) [-602.131] (-598.967) -- 0:01:20
208000 -- (-605.599) [-604.111] (-605.300) (-602.462) * (-601.138) [-600.110] (-612.692) (-608.454) -- 0:01:19
208500 -- (-615.903) [-605.336] (-606.541) (-600.718) * [-601.303] (-602.620) (-605.312) (-609.628) -- 0:01:19
209000 -- [-605.308] (-610.500) (-600.410) (-599.280) * (-613.930) [-607.109] (-605.845) (-610.890) -- 0:01:19
209500 -- (-607.603) [-602.830] (-600.780) (-605.874) * (-605.240) (-601.250) [-598.469] (-607.205) -- 0:01:19
210000 -- (-600.657) [-597.252] (-602.734) (-602.772) * (-600.372) [-602.786] (-611.206) (-607.579) -- 0:01:19
Average standard deviation of split frequencies: 0.021755
210500 -- (-602.142) [-603.376] (-603.570) (-603.921) * (-607.710) (-608.240) [-603.203] (-604.285) -- 0:01:18
211000 -- (-605.236) [-602.731] (-614.912) (-600.968) * (-610.446) [-602.105] (-609.895) (-603.168) -- 0:01:18
211500 -- (-611.493) [-606.091] (-601.706) (-607.629) * (-602.692) (-604.272) (-608.184) [-601.472] -- 0:01:18
212000 -- [-600.773] (-603.910) (-612.230) (-603.885) * (-612.040) [-608.094] (-612.846) (-603.228) -- 0:01:18
212500 -- (-605.367) (-605.961) (-609.991) [-606.167] * (-605.018) (-603.753) (-606.925) [-600.993] -- 0:01:17
213000 -- [-606.657] (-606.048) (-604.149) (-601.885) * (-604.463) [-603.326] (-607.525) (-607.317) -- 0:01:21
213500 -- (-614.346) (-607.084) (-601.966) [-606.076] * (-609.319) [-606.423] (-601.532) (-602.384) -- 0:01:21
214000 -- (-603.481) (-605.860) [-601.226] (-601.425) * (-610.285) (-608.989) (-607.982) [-599.600] -- 0:01:20
214500 -- (-609.836) [-597.961] (-612.599) (-603.430) * (-606.704) (-604.231) [-604.264] (-607.957) -- 0:01:20
215000 -- (-607.681) (-610.422) (-607.747) [-598.945] * (-609.336) (-602.762) (-601.721) [-601.746] -- 0:01:20
Average standard deviation of split frequencies: 0.020676
215500 -- (-617.928) (-607.573) (-602.888) [-603.378] * (-604.053) (-605.002) [-602.576] (-605.528) -- 0:01:20
216000 -- [-604.140] (-598.116) (-606.071) (-604.924) * [-602.932] (-611.163) (-607.568) (-607.787) -- 0:01:19
216500 -- (-599.417) (-598.789) (-602.606) [-605.328] * (-611.682) (-608.987) [-606.713] (-609.393) -- 0:01:19
217000 -- (-604.803) (-603.171) [-604.246] (-610.509) * (-607.820) (-613.619) [-601.835] (-604.256) -- 0:01:19
217500 -- (-607.342) [-606.371] (-602.952) (-600.328) * (-601.932) (-600.719) [-603.182] (-604.762) -- 0:01:19
218000 -- (-605.118) (-606.539) [-603.461] (-601.419) * (-601.616) (-608.572) [-604.072] (-609.145) -- 0:01:18
218500 -- [-605.482] (-603.772) (-607.187) (-608.608) * (-610.418) (-603.808) (-609.211) [-600.748] -- 0:01:18
219000 -- (-598.986) (-601.088) [-602.808] (-608.227) * [-609.638] (-604.693) (-606.253) (-608.505) -- 0:01:18
219500 -- (-600.816) (-606.924) (-602.529) [-608.781] * (-606.461) (-604.321) [-601.000] (-606.156) -- 0:01:18
220000 -- (-604.251) [-603.513] (-603.655) (-611.836) * (-601.032) [-605.915] (-603.379) (-612.952) -- 0:01:18
Average standard deviation of split frequencies: 0.020888
220500 -- [-601.404] (-607.535) (-609.127) (-604.921) * (-600.607) [-601.051] (-609.653) (-603.277) -- 0:01:17
221000 -- (-605.532) (-602.225) (-604.670) [-607.633] * (-601.338) [-602.077] (-606.324) (-606.702) -- 0:01:17
221500 -- (-621.037) [-608.416] (-602.552) (-607.544) * (-606.855) (-602.590) (-618.428) [-604.966] -- 0:01:17
222000 -- [-604.041] (-606.426) (-607.408) (-603.125) * (-611.766) [-603.058] (-610.696) (-607.177) -- 0:01:17
222500 -- (-602.305) (-599.793) (-604.221) [-601.412] * (-599.345) [-606.548] (-606.170) (-606.061) -- 0:01:16
223000 -- (-600.967) (-603.587) [-606.073] (-610.975) * (-606.343) (-604.380) [-602.282] (-603.316) -- 0:01:20
223500 -- (-604.857) (-598.141) [-603.028] (-614.533) * [-607.233] (-606.196) (-604.217) (-603.794) -- 0:01:19
224000 -- [-598.724] (-599.245) (-612.259) (-598.872) * (-602.216) (-610.085) (-604.014) [-597.331] -- 0:01:19
224500 -- (-603.848) [-597.870] (-602.531) (-603.250) * (-607.485) (-605.975) (-605.419) [-606.707] -- 0:01:19
225000 -- (-599.989) [-601.938] (-605.696) (-605.929) * (-605.046) (-602.955) [-601.307] (-605.256) -- 0:01:19
Average standard deviation of split frequencies: 0.020859
225500 -- (-609.933) [-604.336] (-618.277) (-604.428) * [-598.553] (-607.260) (-600.169) (-600.480) -- 0:01:18
226000 -- (-605.754) [-605.196] (-605.271) (-608.102) * [-601.209] (-602.075) (-604.329) (-612.389) -- 0:01:18
226500 -- [-607.451] (-601.088) (-606.861) (-609.880) * (-606.702) (-601.854) (-603.912) [-608.903] -- 0:01:18
227000 -- [-606.217] (-609.323) (-607.726) (-603.945) * (-599.784) [-607.374] (-604.827) (-613.946) -- 0:01:18
227500 -- (-613.600) [-600.083] (-614.492) (-604.623) * (-600.736) (-610.615) (-620.506) [-602.603] -- 0:01:18
228000 -- (-607.029) (-603.410) [-596.865] (-605.216) * (-605.207) [-607.284] (-608.859) (-609.044) -- 0:01:17
228500 -- (-600.280) (-600.852) [-602.119] (-609.465) * [-607.902] (-604.790) (-606.302) (-603.649) -- 0:01:17
229000 -- (-604.062) (-612.411) (-605.659) [-606.459] * [-602.654] (-607.205) (-604.296) (-609.518) -- 0:01:17
229500 -- [-601.583] (-606.943) (-600.118) (-607.680) * (-604.532) [-605.021] (-614.906) (-610.630) -- 0:01:17
230000 -- (-599.981) (-608.979) [-598.407] (-616.597) * (-606.088) (-605.780) (-604.919) [-608.661] -- 0:01:17
Average standard deviation of split frequencies: 0.018501
230500 -- (-605.522) (-611.810) (-607.836) [-604.396] * (-613.380) [-613.292] (-614.261) (-607.875) -- 0:01:16
231000 -- (-615.896) (-609.655) [-599.730] (-607.145) * [-601.926] (-604.714) (-605.719) (-608.925) -- 0:01:16
231500 -- [-608.730] (-603.097) (-608.846) (-606.310) * (-608.379) [-605.157] (-604.823) (-611.791) -- 0:01:16
232000 -- (-610.033) [-600.100] (-608.423) (-607.870) * (-608.343) (-604.400) (-607.230) [-605.861] -- 0:01:16
232500 -- [-601.102] (-605.415) (-600.726) (-600.708) * (-606.333) (-602.384) [-605.647] (-605.602) -- 0:01:15
233000 -- (-607.238) (-604.552) (-604.456) [-602.678] * (-606.996) (-607.960) (-614.108) [-602.408] -- 0:01:15
233500 -- [-604.816] (-601.470) (-604.316) (-606.778) * (-605.643) [-603.821] (-603.921) (-609.852) -- 0:01:18
234000 -- (-613.337) (-612.016) (-610.805) [-605.500] * (-613.133) (-612.916) [-604.057] (-604.851) -- 0:01:18
234500 -- [-602.692] (-612.626) (-612.441) (-611.722) * (-611.393) (-613.022) (-609.385) [-606.793] -- 0:01:18
235000 -- (-607.957) (-603.747) [-606.447] (-605.402) * (-603.511) (-604.446) [-605.507] (-600.053) -- 0:01:18
Average standard deviation of split frequencies: 0.019239
235500 -- (-614.765) (-605.630) [-602.951] (-609.193) * (-607.124) (-609.019) (-607.271) [-605.013] -- 0:01:17
236000 -- [-604.039] (-611.034) (-604.627) (-603.027) * [-604.829] (-608.226) (-608.174) (-601.036) -- 0:01:17
236500 -- (-605.369) (-604.486) (-605.487) [-606.449] * (-606.759) (-603.424) (-600.851) [-599.714] -- 0:01:17
237000 -- [-598.306] (-604.620) (-607.971) (-601.514) * [-604.115] (-603.669) (-606.876) (-611.805) -- 0:01:17
237500 -- [-606.470] (-604.631) (-611.262) (-604.918) * (-609.621) (-605.602) (-612.917) [-600.059] -- 0:01:17
238000 -- (-606.660) (-604.151) (-610.082) [-599.743] * (-611.742) (-602.654) (-611.884) [-601.934] -- 0:01:16
238500 -- [-599.613] (-602.887) (-601.683) (-603.636) * (-605.253) (-609.740) (-605.180) [-604.877] -- 0:01:16
239000 -- (-603.594) [-605.330] (-606.434) (-602.342) * [-604.085] (-603.963) (-610.682) (-601.981) -- 0:01:16
239500 -- (-609.594) [-607.606] (-609.048) (-604.130) * [-609.930] (-605.362) (-608.612) (-611.011) -- 0:01:16
240000 -- [-601.656] (-604.765) (-610.332) (-606.380) * (-600.311) [-607.989] (-604.418) (-600.529) -- 0:01:16
Average standard deviation of split frequencies: 0.018866
240500 -- (-603.190) [-606.055] (-605.465) (-603.382) * (-611.467) (-603.270) [-605.266] (-600.524) -- 0:01:15
241000 -- (-603.910) [-608.335] (-605.643) (-612.226) * (-602.627) (-610.538) (-609.398) [-604.319] -- 0:01:15
241500 -- (-604.345) (-606.927) (-602.344) [-604.746] * (-619.695) (-606.820) (-605.599) [-606.420] -- 0:01:15
242000 -- (-603.843) [-606.841] (-601.459) (-605.384) * (-605.115) (-615.748) [-609.726] (-603.638) -- 0:01:15
242500 -- (-603.061) [-602.768] (-611.461) (-610.638) * [-598.521] (-603.943) (-608.484) (-607.528) -- 0:01:14
243000 -- [-604.388] (-603.748) (-606.397) (-600.378) * (-611.170) [-602.126] (-608.439) (-607.115) -- 0:01:14
243500 -- (-603.695) [-604.814] (-599.831) (-606.080) * [-602.610] (-614.456) (-604.614) (-610.471) -- 0:01:14
244000 -- (-609.359) [-612.866] (-607.054) (-605.118) * (-605.618) (-619.419) (-605.349) [-609.367] -- 0:01:17
244500 -- (-603.425) (-607.736) (-605.929) [-603.765] * (-614.498) (-601.391) (-609.678) [-600.887] -- 0:01:17
245000 -- [-603.683] (-614.120) (-601.253) (-610.143) * (-609.395) (-609.954) [-600.562] (-611.354) -- 0:01:17
Average standard deviation of split frequencies: 0.018154
245500 -- (-603.190) (-605.645) [-600.098] (-612.088) * (-614.499) [-608.183] (-605.028) (-606.913) -- 0:01:16
246000 -- [-600.278] (-610.976) (-603.719) (-603.965) * (-605.627) (-605.650) [-607.579] (-605.887) -- 0:01:16
246500 -- [-612.028] (-607.463) (-605.009) (-607.664) * (-606.461) (-610.375) (-617.023) [-606.858] -- 0:01:16
247000 -- [-601.890] (-605.830) (-611.581) (-603.025) * (-602.785) (-608.716) [-604.596] (-604.349) -- 0:01:16
247500 -- [-601.486] (-607.952) (-611.743) (-603.078) * [-607.909] (-607.868) (-610.081) (-602.084) -- 0:01:16
248000 -- (-602.927) [-602.247] (-600.493) (-602.395) * [-602.070] (-605.690) (-605.343) (-610.201) -- 0:01:15
248500 -- [-604.931] (-604.199) (-609.645) (-597.812) * (-614.352) [-603.604] (-612.161) (-603.412) -- 0:01:15
249000 -- (-604.700) (-606.031) (-604.257) [-602.512] * (-602.593) (-616.751) (-603.004) [-604.398] -- 0:01:15
249500 -- (-606.485) (-603.116) (-603.884) [-605.989] * (-609.273) (-608.038) [-604.607] (-604.337) -- 0:01:15
250000 -- [-606.756] (-605.369) (-617.539) (-606.753) * (-613.266) (-604.209) (-613.221) [-601.144] -- 0:01:15
Average standard deviation of split frequencies: 0.018212
250500 -- (-603.317) [-603.427] (-606.950) (-600.315) * (-611.858) (-607.375) [-605.217] (-614.370) -- 0:01:14
251000 -- [-601.072] (-608.651) (-612.608) (-604.800) * (-606.381) (-607.985) [-600.369] (-615.019) -- 0:01:14
251500 -- (-604.057) [-604.576] (-620.650) (-609.182) * (-606.416) (-610.356) [-600.079] (-611.377) -- 0:01:14
252000 -- [-604.867] (-600.858) (-621.072) (-605.146) * [-602.436] (-604.921) (-607.212) (-606.457) -- 0:01:14
252500 -- [-607.412] (-602.736) (-606.611) (-602.771) * (-605.167) [-608.837] (-608.358) (-604.283) -- 0:01:14
253000 -- [-601.277] (-607.293) (-612.618) (-603.856) * [-608.766] (-608.090) (-606.005) (-617.101) -- 0:01:13
253500 -- [-606.698] (-604.947) (-607.697) (-608.530) * [-602.926] (-611.093) (-611.023) (-615.403) -- 0:01:13
254000 -- (-597.583) (-606.559) (-606.912) [-610.104] * (-610.716) [-605.027] (-603.301) (-600.879) -- 0:01:16
254500 -- (-603.948) [-604.232] (-604.261) (-605.123) * [-609.514] (-605.289) (-607.279) (-605.458) -- 0:01:16
255000 -- [-597.951] (-611.877) (-605.997) (-604.209) * (-614.607) (-611.627) [-601.170] (-604.111) -- 0:01:15
Average standard deviation of split frequencies: 0.018414
255500 -- [-604.878] (-603.076) (-615.513) (-604.375) * (-600.626) [-599.153] (-606.258) (-608.941) -- 0:01:15
256000 -- [-600.633] (-614.884) (-609.665) (-619.260) * [-610.030] (-607.805) (-604.580) (-609.667) -- 0:01:15
256500 -- (-601.001) (-610.531) (-605.180) [-604.609] * [-606.976] (-604.160) (-611.457) (-600.751) -- 0:01:15
257000 -- [-611.686] (-602.361) (-610.466) (-603.126) * (-605.475) [-598.726] (-603.112) (-602.771) -- 0:01:15
257500 -- (-605.156) [-601.089] (-617.667) (-616.011) * (-607.122) (-606.587) [-607.813] (-603.567) -- 0:01:14
258000 -- (-607.016) [-614.268] (-612.612) (-609.082) * [-609.153] (-603.115) (-607.893) (-607.567) -- 0:01:14
258500 -- (-605.522) [-604.258] (-605.979) (-611.272) * (-604.497) (-611.380) (-608.342) [-601.274] -- 0:01:14
259000 -- (-606.519) (-605.310) (-610.600) [-601.683] * (-602.874) [-603.554] (-604.360) (-603.369) -- 0:01:14
259500 -- [-605.200] (-606.169) (-615.804) (-602.290) * (-611.453) [-599.802] (-606.047) (-603.564) -- 0:01:14
260000 -- [-605.214] (-602.488) (-606.926) (-612.021) * (-610.814) [-597.365] (-617.775) (-606.493) -- 0:01:14
Average standard deviation of split frequencies: 0.018404
260500 -- (-610.294) [-600.841] (-611.824) (-612.329) * (-605.137) (-605.394) (-610.870) [-598.966] -- 0:01:13
261000 -- (-606.383) [-602.543] (-606.149) (-605.857) * (-602.936) (-601.337) [-605.394] (-605.874) -- 0:01:13
261500 -- (-610.180) [-601.786] (-606.932) (-602.840) * (-610.221) (-601.811) [-605.472] (-611.451) -- 0:01:13
262000 -- (-607.885) [-606.038] (-617.603) (-604.084) * (-602.809) (-599.512) (-610.104) [-611.123] -- 0:01:13
262500 -- (-599.474) (-605.719) (-612.806) [-610.604] * (-605.109) [-603.568] (-605.845) (-602.064) -- 0:01:13
263000 -- [-603.763] (-607.601) (-607.836) (-601.592) * (-608.166) [-601.267] (-610.011) (-606.496) -- 0:01:12
263500 -- (-612.803) (-603.811) (-612.027) [-603.138] * (-602.593) [-601.645] (-610.794) (-612.353) -- 0:01:12
264000 -- (-603.923) [-604.242] (-608.677) (-606.582) * (-616.783) [-602.492] (-612.158) (-609.771) -- 0:01:15
264500 -- (-606.910) (-619.613) [-601.625] (-611.200) * (-600.714) [-602.835] (-601.138) (-603.700) -- 0:01:15
265000 -- [-603.941] (-606.148) (-614.159) (-608.026) * (-606.168) (-607.024) (-605.836) [-604.697] -- 0:01:14
Average standard deviation of split frequencies: 0.016043
265500 -- (-602.869) (-606.978) (-601.145) [-599.935] * (-609.747) [-606.578] (-604.508) (-606.063) -- 0:01:14
266000 -- (-607.469) (-604.842) (-611.496) [-606.146] * (-605.053) (-603.798) [-600.874] (-603.412) -- 0:01:14
266500 -- (-608.898) [-605.897] (-615.359) (-603.868) * (-612.018) (-606.594) [-600.749] (-607.166) -- 0:01:14
267000 -- (-605.501) (-607.634) (-601.114) [-603.971] * (-608.993) [-599.909] (-602.482) (-601.422) -- 0:01:14
267500 -- [-602.774] (-605.448) (-612.866) (-607.556) * (-601.882) [-603.742] (-603.479) (-606.122) -- 0:01:13
268000 -- (-608.143) (-604.215) [-604.063] (-602.104) * (-610.087) (-611.276) [-611.092] (-608.765) -- 0:01:13
268500 -- [-603.441] (-604.726) (-605.978) (-604.110) * (-613.158) (-605.545) (-603.266) [-603.446] -- 0:01:13
269000 -- (-605.261) (-610.865) (-601.734) [-599.636] * (-604.565) (-603.105) (-604.788) [-603.595] -- 0:01:13
269500 -- (-603.742) (-599.547) (-606.790) [-601.701] * (-604.498) (-599.827) (-610.376) [-604.173] -- 0:01:13
270000 -- (-607.218) (-608.125) (-601.904) [-600.877] * [-607.673] (-606.666) (-606.295) (-603.014) -- 0:01:13
Average standard deviation of split frequencies: 0.015858
270500 -- (-599.202) [-598.908] (-604.801) (-604.010) * (-609.823) [-603.693] (-606.059) (-606.133) -- 0:01:12
271000 -- (-609.050) (-612.894) (-607.199) [-609.990] * (-615.451) (-606.288) (-600.943) [-604.506] -- 0:01:12
271500 -- (-604.833) (-606.291) (-611.136) [-600.004] * (-611.064) (-603.125) [-603.241] (-602.662) -- 0:01:12
272000 -- [-604.421] (-607.786) (-607.339) (-606.136) * (-605.780) (-600.645) [-601.968] (-609.520) -- 0:01:12
272500 -- (-605.847) (-603.149) [-607.450] (-614.953) * (-605.950) (-607.976) [-606.448] (-610.022) -- 0:01:12
273000 -- [-599.866] (-603.313) (-606.903) (-607.045) * (-601.743) [-606.015] (-610.055) (-601.171) -- 0:01:11
273500 -- (-606.322) (-611.403) (-607.024) [-606.857] * [-598.107] (-602.795) (-603.305) (-605.969) -- 0:01:11
274000 -- (-603.343) (-613.597) [-603.144] (-610.100) * [-601.750] (-614.697) (-605.465) (-606.916) -- 0:01:14
274500 -- [-602.622] (-604.969) (-611.948) (-604.341) * (-603.296) (-609.405) (-611.023) [-601.987] -- 0:01:14
275000 -- (-610.780) (-605.729) [-605.340] (-604.650) * (-611.269) (-605.618) (-612.293) [-606.910] -- 0:01:13
Average standard deviation of split frequencies: 0.016321
275500 -- [-610.717] (-605.407) (-604.319) (-611.384) * (-601.894) (-605.193) [-603.509] (-608.871) -- 0:01:13
276000 -- (-603.819) [-606.206] (-604.221) (-602.946) * [-604.603] (-602.410) (-610.453) (-606.030) -- 0:01:13
276500 -- [-605.090] (-608.995) (-600.786) (-607.165) * (-606.089) (-608.368) (-610.759) [-605.638] -- 0:01:13
277000 -- (-600.242) (-609.548) [-605.865] (-609.598) * (-607.713) (-609.514) (-602.219) [-604.948] -- 0:01:13
277500 -- (-602.776) (-606.628) [-607.233] (-612.707) * (-605.509) (-601.477) (-604.646) [-601.329] -- 0:01:12
278000 -- (-601.986) (-610.268) [-607.589] (-606.554) * (-609.564) (-603.140) (-603.927) [-603.226] -- 0:01:12
278500 -- (-605.144) (-605.153) [-608.680] (-606.753) * (-606.889) (-606.142) (-601.189) [-600.171] -- 0:01:12
279000 -- (-601.525) [-601.289] (-603.977) (-604.384) * (-603.252) (-611.001) [-602.174] (-611.285) -- 0:01:12
279500 -- (-607.049) (-599.309) (-606.109) [-603.597] * (-599.660) (-601.580) [-613.059] (-613.468) -- 0:01:12
280000 -- [-609.318] (-605.525) (-610.376) (-604.783) * [-604.425] (-604.628) (-605.685) (-606.254) -- 0:01:12
Average standard deviation of split frequencies: 0.015610
280500 -- (-600.293) (-609.152) [-603.766] (-608.763) * (-601.491) (-605.118) [-599.884] (-605.559) -- 0:01:11
281000 -- (-601.622) [-606.950] (-611.315) (-603.818) * [-603.983] (-604.307) (-604.963) (-609.559) -- 0:01:11
281500 -- (-602.626) [-606.569] (-619.910) (-606.963) * [-600.250] (-608.883) (-605.338) (-604.210) -- 0:01:11
282000 -- (-604.889) [-602.309] (-621.831) (-610.137) * (-598.946) (-617.950) [-601.877] (-610.266) -- 0:01:11
282500 -- (-602.071) [-606.688] (-614.077) (-606.284) * (-599.887) (-604.433) (-615.354) [-599.783] -- 0:01:11
283000 -- [-602.230] (-597.113) (-610.406) (-604.632) * [-598.327] (-618.796) (-612.858) (-607.823) -- 0:01:10
283500 -- [-599.542] (-605.561) (-602.978) (-605.745) * (-603.021) [-611.180] (-613.196) (-597.615) -- 0:01:10
284000 -- (-606.393) (-600.149) [-610.780] (-609.673) * (-605.502) (-609.540) (-603.702) [-604.047] -- 0:01:10
284500 -- [-604.990] (-606.222) (-604.846) (-608.631) * (-607.011) (-606.742) [-603.144] (-605.723) -- 0:01:12
285000 -- (-615.717) (-605.846) (-604.883) [-599.411] * [-603.970] (-604.866) (-604.267) (-601.905) -- 0:01:12
Average standard deviation of split frequencies: 0.015875
285500 -- (-605.646) [-601.219] (-600.037) (-604.748) * (-607.300) (-604.667) (-602.949) [-602.187] -- 0:01:12
286000 -- (-606.671) (-605.146) (-607.937) [-606.600] * (-608.362) [-607.992] (-612.623) (-610.149) -- 0:01:12
286500 -- [-611.127] (-605.948) (-606.344) (-599.947) * (-607.618) (-600.415) [-605.206] (-601.185) -- 0:01:12
287000 -- [-605.232] (-602.208) (-608.946) (-601.586) * [-601.729] (-613.587) (-612.313) (-603.210) -- 0:01:12
287500 -- (-614.623) (-601.536) (-610.419) [-607.550] * (-601.915) (-608.008) [-607.990] (-607.132) -- 0:01:11
288000 -- (-607.391) (-605.116) [-603.582] (-602.267) * [-603.298] (-606.168) (-603.809) (-605.737) -- 0:01:11
288500 -- [-602.142] (-606.682) (-601.883) (-605.183) * (-606.678) (-602.044) [-604.847] (-611.304) -- 0:01:11
289000 -- (-601.992) (-604.851) [-606.224] (-611.180) * (-602.128) (-606.811) (-610.073) [-603.730] -- 0:01:11
289500 -- [-604.726] (-603.164) (-610.689) (-607.283) * (-605.495) (-606.489) (-605.070) [-606.665] -- 0:01:11
290000 -- [-604.936] (-603.791) (-611.121) (-608.385) * [-604.787] (-611.066) (-610.346) (-601.013) -- 0:01:11
Average standard deviation of split frequencies: 0.015587
290500 -- (-602.516) (-601.526) (-603.634) [-601.479] * (-605.547) (-605.931) [-608.535] (-606.938) -- 0:01:10
291000 -- (-610.539) [-601.496] (-607.073) (-615.058) * (-602.741) (-608.044) [-601.849] (-607.689) -- 0:01:10
291500 -- (-601.958) [-607.214] (-605.713) (-608.078) * (-607.837) (-612.216) [-601.757] (-612.074) -- 0:01:10
292000 -- (-604.182) (-613.565) (-603.438) [-604.293] * (-609.049) [-603.535] (-599.994) (-603.436) -- 0:01:10
292500 -- (-600.533) (-611.442) [-606.351] (-600.728) * [-600.018] (-608.219) (-602.020) (-603.190) -- 0:01:10
293000 -- (-608.035) [-602.158] (-612.373) (-602.776) * [-602.967] (-612.863) (-603.771) (-601.522) -- 0:01:09
293500 -- (-602.865) [-600.049] (-606.084) (-603.265) * [-606.475] (-602.587) (-611.772) (-604.040) -- 0:01:09
294000 -- (-601.619) (-602.038) (-604.452) [-600.704] * (-603.277) (-603.320) [-605.427] (-599.918) -- 0:01:09
294500 -- (-603.451) [-607.238] (-603.739) (-614.125) * (-603.726) [-603.272] (-606.241) (-603.216) -- 0:01:11
295000 -- [-600.025] (-607.749) (-607.045) (-603.371) * (-608.515) [-603.934] (-608.011) (-603.093) -- 0:01:11
Average standard deviation of split frequencies: 0.015660
295500 -- (-603.707) (-600.073) (-607.571) [-603.844] * (-606.799) (-604.201) [-601.725] (-610.663) -- 0:01:11
296000 -- (-599.753) (-604.254) (-614.223) [-608.313] * (-603.389) [-601.626] (-599.235) (-600.017) -- 0:01:11
296500 -- (-603.373) (-613.527) [-612.162] (-608.509) * (-609.593) (-607.673) (-606.817) [-602.433] -- 0:01:11
297000 -- (-599.008) (-605.832) [-602.569] (-607.810) * (-603.503) [-598.990] (-601.133) (-610.385) -- 0:01:11
297500 -- (-603.954) (-599.711) (-607.641) [-601.857] * (-601.341) (-603.043) (-606.890) [-601.373] -- 0:01:10
298000 -- (-606.628) (-599.803) (-603.016) [-608.506] * [-602.425] (-606.676) (-609.446) (-601.562) -- 0:01:10
298500 -- (-607.513) [-600.518] (-606.816) (-599.038) * [-601.162] (-598.785) (-599.311) (-602.111) -- 0:01:10
299000 -- (-606.099) (-603.477) (-603.893) [-602.029] * (-604.914) (-604.853) [-598.842] (-608.342) -- 0:01:10
299500 -- (-601.054) [-600.772] (-617.406) (-607.604) * (-598.677) (-607.683) [-602.329] (-611.514) -- 0:01:10
300000 -- (-608.012) (-604.270) [-611.394] (-604.208) * (-609.964) (-606.350) (-606.082) [-605.611] -- 0:01:10
Average standard deviation of split frequencies: 0.015266
300500 -- (-607.290) (-605.719) (-613.369) [-598.333] * (-610.425) (-610.754) [-602.257] (-608.149) -- 0:01:09
301000 -- (-605.348) (-607.544) (-623.154) [-603.837] * (-609.947) [-600.766] (-598.205) (-612.167) -- 0:01:09
301500 -- [-604.430] (-606.967) (-622.273) (-604.764) * [-604.434] (-607.130) (-604.921) (-607.287) -- 0:01:09
302000 -- [-605.842] (-610.433) (-607.723) (-599.604) * (-601.692) [-599.253] (-602.065) (-611.309) -- 0:01:09
302500 -- (-609.502) (-604.439) [-602.028] (-601.678) * (-603.085) (-609.804) (-607.196) [-602.225] -- 0:01:09
303000 -- [-604.884] (-603.259) (-603.748) (-608.224) * (-612.978) [-605.069] (-606.865) (-603.302) -- 0:01:09
303500 -- (-608.157) [-603.894] (-611.549) (-609.758) * [-605.437] (-598.844) (-609.846) (-604.543) -- 0:01:08
304000 -- (-604.454) (-606.624) (-613.985) [-606.919] * (-602.304) [-602.217] (-601.178) (-604.159) -- 0:01:10
304500 -- (-605.371) [-606.152] (-612.841) (-601.939) * (-603.039) (-605.627) [-601.862] (-606.186) -- 0:01:10
305000 -- (-608.189) [-604.991] (-608.283) (-611.688) * [-599.499] (-604.421) (-604.972) (-603.838) -- 0:01:10
Average standard deviation of split frequencies: 0.014676
305500 -- (-601.577) [-602.654] (-610.858) (-609.268) * [-601.635] (-606.605) (-612.130) (-602.204) -- 0:01:10
306000 -- [-605.235] (-605.427) (-613.306) (-607.467) * [-606.649] (-598.413) (-609.146) (-602.052) -- 0:01:10
306500 -- (-614.442) (-606.124) (-608.931) [-603.557] * (-610.758) [-601.422] (-602.593) (-603.819) -- 0:01:10
307000 -- [-605.855] (-604.989) (-604.948) (-605.271) * (-604.753) (-606.528) [-611.544] (-616.831) -- 0:01:09
307500 -- (-608.852) [-606.685] (-605.968) (-607.091) * (-608.519) (-612.364) [-606.084] (-601.764) -- 0:01:09
308000 -- (-605.226) (-609.037) (-603.860) [-601.252] * [-600.715] (-611.500) (-603.571) (-606.217) -- 0:01:09
308500 -- (-612.422) (-606.392) [-604.428] (-602.533) * (-613.601) (-603.836) [-611.512] (-608.139) -- 0:01:09
309000 -- (-604.720) (-605.123) (-601.948) [-605.555] * (-612.513) (-607.630) [-606.893] (-605.477) -- 0:01:09
309500 -- (-613.845) (-600.804) [-603.777] (-607.738) * [-603.669] (-609.966) (-606.275) (-607.509) -- 0:01:09
310000 -- (-605.763) (-602.757) [-605.674] (-604.189) * (-612.173) [-600.495] (-610.089) (-605.350) -- 0:01:09
Average standard deviation of split frequencies: 0.014216
310500 -- (-612.721) [-604.219] (-607.653) (-603.851) * (-605.984) [-603.175] (-604.531) (-608.732) -- 0:01:08
311000 -- (-605.455) (-611.173) (-601.614) [-604.974] * [-604.996] (-608.140) (-604.734) (-605.000) -- 0:01:08
311500 -- (-607.650) [-606.197] (-609.131) (-607.670) * (-611.555) (-607.753) [-603.674] (-604.738) -- 0:01:08
312000 -- (-604.065) [-601.764] (-602.238) (-607.039) * (-610.053) (-602.031) [-602.288] (-604.383) -- 0:01:08
312500 -- (-607.995) (-599.817) [-603.754] (-610.111) * (-609.568) [-602.975] (-602.925) (-617.494) -- 0:01:08
313000 -- (-607.527) (-606.309) (-603.418) [-604.835] * (-610.721) (-606.558) (-602.516) [-609.660] -- 0:01:08
313500 -- [-609.379] (-604.971) (-605.368) (-607.233) * [-604.489] (-602.973) (-616.080) (-604.583) -- 0:01:07
314000 -- [-613.954] (-603.865) (-599.079) (-604.624) * (-607.543) (-612.752) (-607.817) [-601.570] -- 0:01:09
314500 -- [-603.992] (-609.992) (-602.277) (-605.656) * (-601.115) (-605.318) (-614.287) [-603.665] -- 0:01:09
315000 -- (-610.820) [-606.004] (-602.453) (-607.932) * (-601.435) (-616.596) [-603.640] (-612.523) -- 0:01:09
Average standard deviation of split frequencies: 0.013177
315500 -- (-604.939) (-608.342) (-608.904) [-610.955] * (-608.098) [-601.402] (-607.684) (-600.257) -- 0:01:09
316000 -- [-603.244] (-606.566) (-603.735) (-603.133) * (-612.966) [-606.105] (-610.972) (-599.951) -- 0:01:09
316500 -- (-620.903) (-602.573) (-615.228) [-601.880] * (-604.845) (-609.016) [-604.487] (-604.797) -- 0:01:09
317000 -- (-610.302) [-605.883] (-610.577) (-604.235) * (-603.055) [-605.496] (-605.622) (-608.407) -- 0:01:08
317500 -- (-606.097) (-613.697) (-608.642) [-603.261] * (-610.020) (-611.763) [-605.528] (-609.477) -- 0:01:08
318000 -- (-606.674) [-603.003] (-610.461) (-606.994) * (-605.445) (-613.500) [-601.141] (-603.258) -- 0:01:08
318500 -- (-608.619) (-599.054) (-604.889) [-607.615] * [-603.537] (-611.758) (-601.672) (-607.470) -- 0:01:08
319000 -- (-603.648) (-607.087) (-609.908) [-605.411] * (-605.768) [-604.383] (-602.493) (-608.133) -- 0:01:08
319500 -- (-605.363) (-613.477) (-604.868) [-606.496] * (-607.675) (-601.225) [-608.447] (-607.981) -- 0:01:08
320000 -- (-607.197) (-605.115) [-602.986] (-604.097) * (-613.204) [-599.661] (-608.010) (-604.150) -- 0:01:08
Average standard deviation of split frequencies: 0.013922
320500 -- [-606.656] (-604.658) (-616.544) (-603.473) * [-609.123] (-600.525) (-608.674) (-604.026) -- 0:01:07
321000 -- (-605.280) [-605.699] (-610.282) (-605.093) * (-607.633) [-608.640] (-604.404) (-609.934) -- 0:01:07
321500 -- [-609.967] (-605.964) (-608.659) (-604.405) * (-601.858) [-599.629] (-600.851) (-605.572) -- 0:01:07
322000 -- [-609.616] (-601.683) (-607.064) (-606.960) * (-602.206) (-604.039) [-614.185] (-602.922) -- 0:01:07
322500 -- (-605.483) (-603.660) [-597.952] (-598.473) * (-605.074) (-612.670) [-609.005] (-608.931) -- 0:01:07
323000 -- (-614.984) (-604.007) [-606.239] (-604.033) * [-601.755] (-609.783) (-609.247) (-613.763) -- 0:01:07
323500 -- (-612.269) (-605.704) (-610.567) [-603.693] * [-602.435] (-602.735) (-604.754) (-607.394) -- 0:01:06
324000 -- (-602.585) [-608.062] (-603.108) (-601.631) * [-607.278] (-612.214) (-606.369) (-602.101) -- 0:01:06
324500 -- (-603.270) [-610.580] (-607.561) (-606.716) * [-600.854] (-603.574) (-608.403) (-611.779) -- 0:01:08
325000 -- (-601.873) (-604.256) [-605.022] (-602.529) * (-607.583) [-609.221] (-613.868) (-600.040) -- 0:01:08
Average standard deviation of split frequencies: 0.013471
325500 -- [-605.420] (-600.036) (-604.809) (-615.800) * (-602.210) (-600.554) (-615.508) [-601.165] -- 0:01:08
326000 -- (-607.906) [-599.836] (-605.542) (-609.577) * (-606.033) [-601.346] (-610.685) (-612.190) -- 0:01:08
326500 -- (-601.297) (-606.310) (-606.578) [-601.795] * (-607.309) (-612.688) (-609.154) [-603.038] -- 0:01:08
327000 -- [-607.419] (-603.048) (-615.923) (-605.698) * [-605.861] (-604.416) (-614.464) (-606.841) -- 0:01:07
327500 -- (-612.157) [-599.932] (-612.327) (-605.262) * [-607.327] (-610.066) (-610.362) (-607.754) -- 0:01:07
328000 -- (-604.161) [-613.289] (-609.384) (-611.201) * [-602.441] (-604.934) (-610.707) (-601.817) -- 0:01:07
328500 -- (-601.502) (-605.839) (-613.506) [-603.361] * (-611.475) (-611.074) [-606.850] (-605.420) -- 0:01:07
329000 -- (-604.618) [-603.835] (-612.085) (-603.499) * (-609.731) (-605.184) (-611.102) [-608.811] -- 0:01:07
329500 -- (-601.771) (-603.232) (-612.349) [-602.911] * (-599.927) (-609.230) (-613.439) [-601.815] -- 0:01:07
330000 -- (-611.446) (-602.006) [-607.193] (-603.772) * (-602.393) [-599.303] (-608.807) (-616.703) -- 0:01:07
Average standard deviation of split frequencies: 0.014177
330500 -- (-612.423) [-605.102] (-604.084) (-601.663) * [-604.157] (-613.766) (-608.580) (-607.001) -- 0:01:06
331000 -- (-619.752) (-614.100) [-606.410] (-608.855) * [-610.926] (-611.915) (-605.012) (-605.298) -- 0:01:06
331500 -- (-608.796) [-606.046] (-610.916) (-605.300) * (-605.878) (-608.112) [-609.056] (-607.611) -- 0:01:06
332000 -- (-601.656) (-607.764) (-603.084) [-600.471] * (-603.203) [-600.374] (-604.792) (-610.790) -- 0:01:06
332500 -- [-603.319] (-606.153) (-601.643) (-605.269) * (-611.021) (-606.418) (-608.562) [-599.942] -- 0:01:06
333000 -- (-612.818) [-607.106] (-600.689) (-600.002) * (-607.427) [-606.703] (-601.264) (-602.091) -- 0:01:06
333500 -- (-602.702) [-605.086] (-602.962) (-601.419) * (-599.540) [-601.517] (-602.097) (-597.402) -- 0:01:05
334000 -- (-608.877) (-600.452) [-600.437] (-608.465) * [-601.804] (-609.580) (-606.659) (-608.682) -- 0:01:05
334500 -- (-602.934) (-610.830) (-602.963) [-603.447] * (-604.445) [-602.264] (-613.882) (-614.396) -- 0:01:05
335000 -- (-608.993) (-606.370) (-607.239) [-604.104] * (-609.292) (-605.177) (-604.148) [-607.325] -- 0:01:07
Average standard deviation of split frequencies: 0.014277
335500 -- (-603.539) (-610.466) (-601.190) [-601.705] * (-617.582) (-613.384) (-612.004) [-604.965] -- 0:01:07
336000 -- (-602.505) (-608.060) (-607.730) [-604.675] * [-602.428] (-602.000) (-603.150) (-610.321) -- 0:01:07
336500 -- (-609.655) (-602.739) (-608.707) [-604.702] * (-608.423) (-604.413) [-609.781] (-605.681) -- 0:01:07
337000 -- (-612.208) (-606.749) (-608.122) [-600.834] * (-610.199) [-609.443] (-602.124) (-608.698) -- 0:01:06
337500 -- [-604.262] (-610.542) (-605.205) (-607.704) * (-605.924) (-601.492) [-605.382] (-601.695) -- 0:01:06
338000 -- (-609.386) (-610.643) (-610.933) [-604.762] * (-607.891) (-614.438) (-605.424) [-603.740] -- 0:01:06
338500 -- (-618.099) (-602.760) [-608.608] (-603.076) * (-604.374) (-612.870) (-611.949) [-603.317] -- 0:01:06
339000 -- (-616.992) [-607.980] (-609.166) (-608.486) * [-602.800] (-613.741) (-606.275) (-603.971) -- 0:01:06
339500 -- (-614.683) (-607.124) (-611.371) [-600.966] * (-604.704) [-608.184] (-609.687) (-606.489) -- 0:01:06
340000 -- (-612.228) (-606.356) (-609.334) [-604.931] * (-605.604) [-602.968] (-603.915) (-603.752) -- 0:01:06
Average standard deviation of split frequencies: 0.014652
340500 -- [-612.630] (-606.541) (-606.506) (-604.926) * (-606.548) (-611.224) [-603.905] (-606.760) -- 0:01:05
341000 -- (-600.141) [-606.841] (-611.993) (-610.595) * (-600.932) (-601.387) [-605.481] (-603.386) -- 0:01:05
341500 -- [-602.736] (-602.418) (-610.582) (-611.387) * (-605.816) [-604.087] (-603.900) (-601.804) -- 0:01:05
342000 -- (-610.850) (-610.047) (-609.434) [-602.724] * [-605.758] (-604.427) (-606.329) (-610.082) -- 0:01:05
342500 -- [-601.307] (-607.089) (-600.509) (-606.411) * (-603.919) (-604.135) [-605.863] (-605.737) -- 0:01:05
343000 -- (-612.616) (-609.988) (-606.631) [-602.791] * (-607.611) (-609.283) (-611.241) [-608.979] -- 0:01:05
343500 -- (-612.308) [-601.802] (-608.776) (-607.832) * [-602.208] (-604.971) (-609.830) (-607.526) -- 0:01:04
344000 -- (-611.889) (-607.713) [-606.801] (-597.040) * (-604.621) (-603.742) [-603.332] (-611.391) -- 0:01:04
344500 -- (-600.894) (-603.086) [-601.834] (-602.181) * (-606.887) (-600.373) [-600.774] (-602.420) -- 0:01:04
345000 -- (-607.080) (-607.125) [-599.710] (-603.768) * [-612.868] (-601.989) (-601.665) (-600.957) -- 0:01:06
Average standard deviation of split frequencies: 0.014684
345500 -- (-602.688) (-600.869) (-609.334) [-607.708] * (-604.705) (-610.983) [-600.158] (-611.425) -- 0:01:06
346000 -- [-601.893] (-597.944) (-602.885) (-606.906) * (-610.163) [-605.169] (-608.441) (-600.550) -- 0:01:06
346500 -- [-605.658] (-606.538) (-619.225) (-603.687) * (-606.018) [-605.089] (-598.962) (-602.266) -- 0:01:06
347000 -- (-606.013) (-605.501) (-607.038) [-600.256] * (-603.311) [-601.641] (-613.554) (-615.765) -- 0:01:05
347500 -- [-599.726] (-608.534) (-609.717) (-604.221) * [-603.089] (-603.542) (-608.102) (-609.868) -- 0:01:05
348000 -- (-605.984) (-615.251) [-605.527] (-613.359) * (-602.233) (-610.070) (-599.331) [-606.839] -- 0:01:05
348500 -- [-603.700] (-606.467) (-602.281) (-606.246) * [-604.990] (-610.005) (-603.448) (-612.367) -- 0:01:05
349000 -- (-601.377) (-611.551) (-607.352) [-609.371] * (-605.742) [-610.063] (-597.886) (-613.259) -- 0:01:05
349500 -- (-608.902) (-604.562) (-605.879) [-603.058] * [-601.524] (-616.513) (-608.380) (-600.497) -- 0:01:05
350000 -- (-609.951) [-600.751] (-606.032) (-608.380) * (-607.946) (-603.501) [-603.173] (-601.662) -- 0:01:05
Average standard deviation of split frequencies: 0.014937
350500 -- (-608.836) (-600.247) [-601.988] (-610.921) * (-608.409) (-599.022) [-604.717] (-604.503) -- 0:01:04
351000 -- (-599.730) (-606.614) (-601.145) [-610.245] * (-605.103) (-608.194) (-608.364) [-600.157] -- 0:01:04
351500 -- (-604.801) [-604.950] (-603.063) (-602.510) * (-603.210) (-603.679) [-603.050] (-605.686) -- 0:01:04
352000 -- (-602.959) (-603.538) [-606.288] (-606.317) * [-612.377] (-604.629) (-607.961) (-602.342) -- 0:01:04
352500 -- (-611.589) [-599.239] (-603.509) (-604.485) * (-610.797) [-597.654] (-607.948) (-612.898) -- 0:01:04
353000 -- (-605.627) [-599.982] (-598.621) (-608.721) * (-606.446) (-609.559) (-607.515) [-604.425] -- 0:01:04
353500 -- (-609.404) (-603.699) (-599.291) [-601.960] * [-601.996] (-606.090) (-604.090) (-610.960) -- 0:01:04
354000 -- (-605.108) [-618.346] (-605.632) (-603.787) * (-606.874) (-608.526) (-607.886) [-606.793] -- 0:01:03
354500 -- [-607.229] (-610.529) (-599.575) (-616.541) * (-616.153) (-604.803) [-600.236] (-608.254) -- 0:01:03
355000 -- (-597.511) (-604.703) (-602.203) [-608.149] * (-601.209) (-604.380) (-605.527) [-601.544] -- 0:01:05
Average standard deviation of split frequencies: 0.014800
355500 -- (-599.943) (-602.749) [-602.271] (-621.272) * (-607.662) (-603.199) [-605.784] (-605.623) -- 0:01:05
356000 -- (-615.261) (-607.525) (-609.300) [-607.239] * (-603.742) [-600.317] (-610.423) (-604.157) -- 0:01:05
356500 -- (-606.935) (-606.346) (-609.953) [-602.702] * (-605.803) (-606.389) [-607.495] (-614.704) -- 0:01:04
357000 -- (-617.115) [-605.586] (-608.838) (-605.197) * (-602.570) (-602.972) [-600.484] (-603.028) -- 0:01:04
357500 -- [-607.309] (-601.236) (-607.455) (-611.070) * [-603.639] (-603.182) (-604.299) (-610.005) -- 0:01:04
358000 -- (-605.215) (-608.381) (-604.183) [-600.703] * (-603.226) (-601.726) [-596.537] (-609.760) -- 0:01:04
358500 -- (-608.009) (-605.551) (-609.681) [-599.111] * (-609.519) (-603.942) (-607.341) [-606.552] -- 0:01:04
359000 -- [-603.451] (-608.724) (-609.529) (-604.156) * [-608.642] (-602.993) (-602.952) (-607.903) -- 0:01:04
359500 -- (-605.649) (-611.920) (-605.924) [-599.756] * (-606.320) (-601.381) (-605.167) [-601.143] -- 0:01:04
360000 -- (-608.675) (-605.609) (-613.413) [-605.558] * (-608.054) (-611.059) (-600.310) [-601.568] -- 0:01:04
Average standard deviation of split frequencies: 0.015146
360500 -- (-602.521) [-599.686] (-608.076) (-601.634) * (-604.710) (-620.784) [-600.553] (-607.931) -- 0:01:03
361000 -- (-603.258) (-604.278) (-609.435) [-602.716] * [-602.244] (-614.597) (-603.995) (-605.261) -- 0:01:03
361500 -- [-608.155] (-602.496) (-615.295) (-606.044) * (-603.307) (-606.690) [-600.440] (-607.690) -- 0:01:03
362000 -- (-604.284) [-602.621] (-608.866) (-610.197) * (-599.124) [-607.930] (-600.699) (-605.828) -- 0:01:03
362500 -- (-607.047) (-601.914) [-602.683] (-605.988) * (-601.876) (-606.821) [-604.418] (-613.121) -- 0:01:03
363000 -- (-604.566) (-606.377) (-610.904) [-602.928] * [-604.428] (-611.071) (-607.108) (-609.607) -- 0:01:03
363500 -- [-601.416] (-614.779) (-607.783) (-604.550) * [-603.089] (-601.251) (-608.825) (-606.041) -- 0:01:03
364000 -- (-606.966) (-600.861) (-604.293) [-606.094] * (-606.544) (-600.741) [-604.870] (-605.157) -- 0:01:02
364500 -- [-605.313] (-600.689) (-603.053) (-604.220) * (-605.257) (-608.892) (-604.237) [-601.891] -- 0:01:02
365000 -- [-611.045] (-600.912) (-604.492) (-611.169) * (-604.012) (-605.471) (-618.611) [-607.910] -- 0:01:02
Average standard deviation of split frequencies: 0.014311
365500 -- [-605.010] (-603.293) (-613.105) (-612.063) * (-606.931) (-609.960) [-599.947] (-609.365) -- 0:01:04
366000 -- (-605.518) (-602.718) [-605.936] (-609.507) * [-604.380] (-613.192) (-599.476) (-606.801) -- 0:01:04
366500 -- (-599.484) (-608.688) [-603.234] (-605.762) * (-601.982) (-606.400) [-598.839] (-602.806) -- 0:01:03
367000 -- (-604.395) (-607.782) [-607.997] (-610.052) * [-600.022] (-613.019) (-610.419) (-608.830) -- 0:01:03
367500 -- (-608.904) [-602.835] (-608.719) (-603.387) * (-607.951) (-614.821) (-601.959) [-604.130] -- 0:01:03
368000 -- (-608.405) (-605.340) [-607.271] (-611.537) * (-604.345) (-603.490) [-600.575] (-602.559) -- 0:01:03
368500 -- [-606.010] (-605.732) (-608.296) (-607.016) * (-604.705) (-609.054) [-602.178] (-602.161) -- 0:01:03
369000 -- (-605.975) (-609.489) (-608.430) [-604.282] * (-604.917) (-602.121) [-600.574] (-607.657) -- 0:01:03
369500 -- [-604.142] (-606.847) (-616.419) (-603.635) * [-601.369] (-602.431) (-602.410) (-607.247) -- 0:01:03
370000 -- [-605.043] (-604.783) (-611.781) (-606.191) * [-603.481] (-603.849) (-599.848) (-605.024) -- 0:01:03
Average standard deviation of split frequencies: 0.013990
370500 -- (-612.547) (-606.311) [-602.654] (-602.759) * [-600.970] (-603.099) (-604.218) (-609.196) -- 0:01:02
371000 -- (-606.061) (-602.871) (-615.426) [-602.575] * (-599.430) [-606.194] (-604.494) (-599.559) -- 0:01:02
371500 -- [-599.124] (-610.210) (-610.049) (-620.377) * (-603.932) (-604.949) [-601.442] (-614.585) -- 0:01:02
372000 -- (-605.035) [-605.478] (-610.796) (-615.838) * (-608.454) [-604.932] (-605.632) (-612.733) -- 0:01:02
372500 -- (-609.774) (-607.754) (-607.531) [-608.064] * (-601.780) (-605.550) (-607.106) [-601.710] -- 0:01:02
373000 -- (-607.218) [-602.841] (-608.393) (-601.574) * (-610.713) [-607.073] (-614.664) (-602.815) -- 0:01:02
373500 -- [-602.071] (-600.930) (-608.032) (-604.816) * [-601.953] (-606.994) (-604.002) (-609.232) -- 0:01:02
374000 -- [-604.037] (-611.253) (-604.561) (-602.647) * [-610.320] (-614.109) (-601.883) (-609.831) -- 0:01:01
374500 -- (-599.880) [-603.985] (-601.682) (-609.038) * (-604.194) (-602.165) [-604.348] (-603.319) -- 0:01:01
375000 -- [-603.948] (-610.636) (-609.086) (-603.118) * (-603.091) [-604.515] (-602.148) (-599.608) -- 0:01:01
Average standard deviation of split frequencies: 0.014070
375500 -- (-603.857) [-608.773] (-606.880) (-606.557) * (-615.233) [-604.098] (-600.830) (-601.645) -- 0:01:03
376000 -- [-602.575] (-600.717) (-605.811) (-602.639) * (-608.485) (-608.627) (-606.364) [-602.253] -- 0:01:03
376500 -- [-603.607] (-613.389) (-610.732) (-609.800) * (-614.072) (-600.513) [-601.509] (-603.480) -- 0:01:02
377000 -- [-599.634] (-599.612) (-606.208) (-607.351) * (-605.083) (-603.479) [-604.414] (-607.402) -- 0:01:02
377500 -- [-598.279] (-606.723) (-607.374) (-611.030) * (-613.345) (-608.048) (-603.603) [-606.920] -- 0:01:02
378000 -- (-600.816) (-600.348) (-608.222) [-604.069] * (-612.368) (-612.450) (-607.522) [-612.139] -- 0:01:02
378500 -- (-603.445) (-604.007) (-603.804) [-602.423] * [-605.403] (-608.749) (-605.924) (-608.301) -- 0:01:02
379000 -- (-613.688) (-608.871) [-611.681] (-602.491) * (-605.134) (-600.971) [-609.545] (-601.500) -- 0:01:02
379500 -- (-610.195) [-620.990] (-606.673) (-604.969) * [-603.704] (-604.013) (-601.171) (-600.439) -- 0:01:02
380000 -- (-603.183) (-609.705) [-604.491] (-609.311) * (-605.195) [-602.980] (-601.598) (-601.638) -- 0:01:02
Average standard deviation of split frequencies: 0.014516
380500 -- (-608.909) (-606.131) (-617.171) [-605.554] * (-599.762) (-604.358) [-606.697] (-613.548) -- 0:01:01
381000 -- (-610.520) [-598.959] (-609.056) (-603.377) * (-599.740) (-600.585) [-606.658] (-607.350) -- 0:01:01
381500 -- [-601.756] (-609.064) (-607.609) (-611.897) * (-607.213) (-601.642) (-603.402) [-607.416] -- 0:01:01
382000 -- (-602.619) (-602.923) [-599.432] (-609.525) * (-599.057) [-602.333] (-609.993) (-608.519) -- 0:01:01
382500 -- [-606.885] (-612.328) (-608.904) (-606.008) * (-600.179) (-607.580) [-610.219] (-609.283) -- 0:01:01
383000 -- (-607.186) (-612.684) [-599.977] (-600.636) * (-603.719) (-609.434) [-603.274] (-606.270) -- 0:01:01
383500 -- (-608.121) (-614.549) [-601.749] (-612.972) * [-597.823] (-605.641) (-600.374) (-603.868) -- 0:01:01
384000 -- (-610.516) (-601.661) (-602.934) [-604.578] * (-603.485) (-608.364) [-605.655] (-606.625) -- 0:01:00
384500 -- (-605.996) (-603.813) [-602.559] (-605.574) * (-608.684) (-609.580) (-608.087) [-609.214] -- 0:01:00
385000 -- (-611.043) [-605.791] (-602.664) (-612.756) * (-609.284) (-606.930) [-611.369] (-603.946) -- 0:01:00
Average standard deviation of split frequencies: 0.014655
385500 -- (-605.320) (-600.831) (-607.833) [-611.153] * (-607.714) (-599.853) [-609.230] (-605.784) -- 0:01:00
386000 -- (-606.261) (-608.709) [-597.807] (-608.015) * (-604.011) (-610.555) (-618.934) [-604.973] -- 0:01:02
386500 -- [-605.593] (-605.505) (-601.306) (-616.322) * (-607.026) [-609.024] (-606.394) (-611.174) -- 0:01:01
387000 -- [-603.253] (-603.577) (-600.885) (-603.571) * (-601.200) (-615.904) [-601.190] (-605.033) -- 0:01:01
387500 -- (-599.836) (-607.358) [-609.443] (-603.892) * (-610.728) (-613.064) (-607.175) [-604.943] -- 0:01:01
388000 -- (-602.039) (-607.851) [-604.103] (-611.312) * (-610.589) (-611.755) (-604.479) [-606.988] -- 0:01:01
388500 -- [-602.587] (-602.833) (-601.459) (-606.043) * (-603.734) (-604.447) (-608.179) [-604.998] -- 0:01:01
389000 -- (-608.108) (-601.340) [-603.123] (-604.851) * (-599.930) (-607.441) [-603.719] (-610.459) -- 0:01:01
389500 -- (-609.119) (-606.265) (-614.857) [-611.368] * (-602.792) (-611.746) (-605.575) [-608.483] -- 0:01:01
390000 -- (-607.811) (-602.308) (-609.872) [-599.425] * [-607.360] (-602.189) (-603.929) (-604.456) -- 0:01:01
Average standard deviation of split frequencies: 0.015351
390500 -- (-607.281) (-605.180) (-607.313) [-603.800] * [-599.331] (-612.799) (-600.787) (-600.085) -- 0:01:00
391000 -- (-602.682) [-604.997] (-608.623) (-598.607) * (-607.963) (-603.158) (-604.056) [-606.482] -- 0:01:00
391500 -- [-602.589] (-601.611) (-598.845) (-610.271) * (-605.048) [-601.830] (-607.204) (-605.343) -- 0:01:00
392000 -- [-607.115] (-611.113) (-606.947) (-618.709) * [-601.163] (-609.359) (-597.235) (-608.532) -- 0:01:00
392500 -- (-603.027) [-600.574] (-612.496) (-606.751) * (-605.946) (-613.632) [-603.577] (-608.484) -- 0:01:00
393000 -- (-605.581) (-608.207) [-608.717] (-601.138) * (-600.832) (-605.172) (-605.231) [-602.043] -- 0:01:00
393500 -- (-602.296) (-602.715) [-610.057] (-607.101) * [-600.920] (-600.918) (-601.507) (-608.985) -- 0:01:00
394000 -- (-614.658) (-609.937) (-603.815) [-603.480] * (-606.916) [-604.803] (-606.635) (-600.410) -- 0:00:59
394500 -- [-601.291] (-602.276) (-607.157) (-601.579) * (-602.074) (-608.615) [-603.423] (-615.079) -- 0:00:59
395000 -- (-601.679) [-608.145] (-606.422) (-601.432) * [-604.035] (-608.117) (-606.821) (-608.624) -- 0:00:59
Average standard deviation of split frequencies: 0.015542
395500 -- [-600.887] (-607.123) (-603.707) (-600.485) * (-610.915) [-603.334] (-602.442) (-607.712) -- 0:00:59
396000 -- [-601.938] (-602.700) (-605.657) (-610.537) * [-599.318] (-599.492) (-601.595) (-603.991) -- 0:01:01
396500 -- [-608.102] (-600.212) (-607.350) (-606.509) * (-608.597) (-610.912) (-604.157) [-602.832] -- 0:01:00
397000 -- [-606.668] (-613.000) (-608.886) (-608.712) * (-607.573) (-607.696) (-608.530) [-604.889] -- 0:01:00
397500 -- [-608.255] (-603.797) (-602.226) (-604.359) * (-604.615) [-605.354] (-608.881) (-607.709) -- 0:01:00
398000 -- (-609.456) (-602.816) (-614.523) [-608.512] * (-605.784) (-598.379) [-603.449] (-607.634) -- 0:01:00
398500 -- [-604.192] (-608.917) (-607.104) (-604.671) * (-606.998) (-595.924) (-604.050) [-601.936] -- 0:01:00
399000 -- [-610.271] (-601.695) (-612.302) (-604.715) * (-608.617) [-603.324] (-609.240) (-601.818) -- 0:01:00
399500 -- (-605.922) [-602.550] (-615.619) (-616.265) * (-603.990) (-606.902) (-610.491) [-599.215] -- 0:01:00
400000 -- (-609.690) [-605.495] (-608.917) (-605.779) * [-604.961] (-607.485) (-603.747) (-606.238) -- 0:01:00
Average standard deviation of split frequencies: 0.014738
400500 -- (-603.050) (-605.579) [-612.063] (-610.662) * [-604.267] (-603.222) (-607.806) (-602.437) -- 0:00:59
401000 -- (-607.572) (-607.860) [-603.124] (-611.562) * (-608.992) (-599.992) (-604.418) [-604.506] -- 0:00:59
401500 -- (-611.384) (-601.062) (-611.265) [-606.715] * (-607.423) [-604.496] (-605.265) (-602.856) -- 0:00:59
402000 -- (-609.096) [-601.504] (-615.585) (-604.763) * [-602.994] (-602.805) (-609.665) (-608.452) -- 0:00:59
402500 -- (-604.078) (-601.694) (-609.141) [-607.800] * (-605.103) [-601.486] (-601.416) (-602.451) -- 0:00:59
403000 -- [-606.908] (-611.141) (-607.800) (-604.957) * (-607.756) (-605.788) [-606.514] (-611.928) -- 0:00:59
403500 -- [-607.873] (-603.944) (-602.733) (-602.913) * (-605.683) (-606.276) (-610.679) [-603.469] -- 0:00:59
404000 -- (-609.039) [-601.149] (-609.305) (-607.698) * (-610.669) (-605.414) [-603.151] (-606.555) -- 0:00:59
404500 -- (-612.449) (-606.415) (-606.755) [-605.084] * [-601.342] (-612.193) (-601.440) (-603.046) -- 0:00:58
405000 -- (-603.486) (-607.163) (-609.596) [-603.822] * [-602.722] (-602.396) (-604.940) (-602.897) -- 0:00:58
Average standard deviation of split frequencies: 0.014116
405500 -- [-605.066] (-609.328) (-603.304) (-600.105) * [-612.091] (-603.201) (-603.580) (-614.209) -- 0:00:58
406000 -- (-611.204) (-603.333) [-604.885] (-608.388) * (-601.934) [-604.741] (-603.867) (-609.958) -- 0:00:59
406500 -- (-606.109) [-605.480] (-608.408) (-603.846) * [-601.633] (-611.517) (-597.196) (-605.073) -- 0:00:59
407000 -- [-610.120] (-606.338) (-602.780) (-604.874) * [-606.418] (-605.263) (-601.858) (-602.458) -- 0:00:59
407500 -- (-617.094) [-608.902] (-605.085) (-610.840) * (-599.652) [-601.617] (-613.423) (-603.736) -- 0:00:59
408000 -- (-613.032) (-603.664) (-607.113) [-604.944] * (-608.711) (-607.370) [-613.914] (-602.797) -- 0:00:59
408500 -- [-607.548] (-609.197) (-600.751) (-611.787) * (-605.225) [-612.476] (-606.522) (-606.808) -- 0:00:59
409000 -- (-608.108) (-602.741) [-599.509] (-607.430) * [-607.452] (-607.542) (-609.833) (-608.323) -- 0:00:59
409500 -- (-603.136) (-617.721) (-605.779) [-603.652] * (-608.780) [-602.414] (-602.978) (-604.487) -- 0:00:59
410000 -- [-601.700] (-610.360) (-607.629) (-602.628) * (-606.554) (-605.373) [-600.863] (-609.127) -- 0:00:59
Average standard deviation of split frequencies: 0.013456
410500 -- (-610.012) (-608.229) [-603.894] (-601.588) * [-601.733] (-602.364) (-606.212) (-605.978) -- 0:00:58
411000 -- (-607.256) [-601.934] (-600.861) (-602.864) * (-602.963) [-603.678] (-610.072) (-605.395) -- 0:00:58
411500 -- (-610.405) (-605.281) [-603.198] (-602.595) * (-604.364) (-612.656) (-605.285) [-599.708] -- 0:00:58
412000 -- (-606.572) [-605.841] (-610.335) (-609.572) * (-609.235) (-604.531) (-605.753) [-605.586] -- 0:00:58
412500 -- (-604.955) [-604.530] (-598.968) (-608.889) * (-604.291) [-607.346] (-613.520) (-601.980) -- 0:00:58
413000 -- (-611.011) [-603.790] (-600.643) (-607.444) * (-608.459) (-602.445) (-611.358) [-614.420] -- 0:00:58
413500 -- (-613.850) [-603.299] (-603.865) (-604.154) * [-596.325] (-607.690) (-606.713) (-613.939) -- 0:00:58
414000 -- [-610.165] (-601.073) (-607.163) (-607.238) * (-607.917) [-604.627] (-609.101) (-606.988) -- 0:00:58
414500 -- (-605.272) (-607.341) (-603.215) [-600.854] * (-606.141) [-604.199] (-614.092) (-611.364) -- 0:00:57
415000 -- (-608.129) [-604.749] (-605.699) (-610.518) * (-601.764) (-606.390) [-601.866] (-602.917) -- 0:00:57
Average standard deviation of split frequencies: 0.014291
415500 -- (-612.797) (-610.000) (-602.998) [-603.861] * [-603.325] (-603.304) (-610.459) (-613.108) -- 0:00:57
416000 -- [-599.774] (-604.873) (-601.807) (-603.805) * (-600.900) (-604.015) (-602.368) [-604.068] -- 0:00:57
416500 -- (-603.587) (-605.738) [-602.007] (-609.714) * (-608.689) (-616.067) (-604.544) [-604.065] -- 0:00:58
417000 -- (-604.395) (-612.078) [-602.125] (-603.366) * (-607.683) (-609.069) (-603.787) [-603.506] -- 0:00:58
417500 -- (-611.430) (-598.506) [-602.635] (-606.645) * (-600.505) (-601.837) (-612.595) [-603.929] -- 0:00:58
418000 -- (-604.069) (-603.678) [-604.430] (-604.162) * (-606.476) [-603.819] (-606.420) (-603.358) -- 0:00:58
418500 -- [-606.720] (-610.894) (-604.329) (-610.685) * (-615.500) (-611.395) (-610.610) [-604.662] -- 0:00:58
419000 -- (-603.719) [-603.213] (-606.631) (-606.163) * [-603.021] (-601.051) (-606.404) (-604.302) -- 0:00:58
419500 -- (-605.289) (-605.497) (-609.063) [-605.634] * (-609.420) (-604.763) (-608.068) [-604.901] -- 0:00:58
420000 -- (-606.269) (-604.903) (-605.437) [-600.493] * [-606.281] (-607.847) (-609.735) (-608.874) -- 0:00:58
Average standard deviation of split frequencies: 0.014634
420500 -- (-601.470) (-599.350) (-605.483) [-611.613] * (-606.950) (-606.528) (-603.988) [-605.785] -- 0:00:57
421000 -- (-605.036) [-602.423] (-607.218) (-608.142) * (-600.647) [-603.150] (-607.823) (-611.439) -- 0:00:57
421500 -- (-603.968) (-615.264) [-612.569] (-609.085) * (-606.179) [-604.084] (-606.911) (-603.350) -- 0:00:57
422000 -- (-604.388) (-623.142) (-615.246) [-602.975] * (-603.122) [-606.669] (-609.079) (-603.586) -- 0:00:57
422500 -- (-613.439) (-606.617) (-606.350) [-601.623] * (-609.007) (-607.983) (-604.643) [-606.682] -- 0:00:57
423000 -- [-604.429] (-603.095) (-610.212) (-610.778) * [-608.561] (-606.940) (-613.015) (-606.811) -- 0:00:57
423500 -- (-605.638) (-609.442) (-622.418) [-611.052] * (-609.942) [-610.320] (-615.115) (-604.326) -- 0:00:57
424000 -- (-603.408) (-610.124) [-607.939] (-608.497) * [-598.879] (-603.610) (-609.416) (-602.316) -- 0:00:57
424500 -- (-602.693) (-602.615) (-599.843) [-603.693] * [-597.534] (-613.462) (-608.275) (-601.563) -- 0:00:56
425000 -- (-609.638) (-603.785) (-611.063) [-601.120] * (-604.106) (-606.261) (-605.830) [-599.288] -- 0:00:56
Average standard deviation of split frequencies: 0.014386
425500 -- (-619.175) [-606.672] (-603.884) (-604.001) * [-604.579] (-604.845) (-605.657) (-616.791) -- 0:00:56
426000 -- (-603.291) [-600.028] (-606.589) (-602.428) * [-604.313] (-601.804) (-604.122) (-604.761) -- 0:00:57
426500 -- (-615.635) [-603.478] (-616.587) (-606.562) * (-601.741) (-607.421) (-613.168) [-601.974] -- 0:00:57
427000 -- (-609.581) (-604.293) [-608.816] (-612.675) * (-605.522) (-606.887) (-608.765) [-609.889] -- 0:00:57
427500 -- [-607.578] (-601.316) (-604.968) (-604.819) * (-606.537) [-600.095] (-607.744) (-603.178) -- 0:00:57
428000 -- (-613.110) (-604.762) [-604.525] (-605.768) * (-603.458) (-610.344) (-602.692) [-599.180] -- 0:00:57
428500 -- (-604.608) (-606.706) [-600.135] (-614.307) * (-612.909) (-607.576) (-602.285) [-602.496] -- 0:00:57
429000 -- (-604.357) (-608.543) (-604.634) [-603.792] * (-603.698) [-605.459] (-606.638) (-611.221) -- 0:00:57
429500 -- [-602.150] (-603.498) (-607.059) (-622.132) * [-600.393] (-609.645) (-605.912) (-605.250) -- 0:00:57
430000 -- (-603.461) (-605.524) (-604.214) [-607.013] * (-607.476) (-605.157) (-600.971) [-601.597] -- 0:00:57
Average standard deviation of split frequencies: 0.014358
430500 -- (-605.573) [-607.267] (-607.994) (-609.765) * (-607.616) (-601.337) [-605.768] (-608.642) -- 0:00:56
431000 -- (-605.835) [-608.662] (-610.985) (-608.928) * (-603.725) (-603.615) (-603.665) [-603.409] -- 0:00:56
431500 -- (-612.730) [-607.215] (-609.958) (-611.706) * (-602.164) [-605.789] (-605.305) (-605.672) -- 0:00:56
432000 -- (-604.049) (-604.586) [-606.739] (-605.818) * (-613.478) (-606.983) [-601.915] (-607.638) -- 0:00:56
432500 -- [-606.093] (-606.075) (-604.499) (-605.261) * (-605.319) (-603.867) (-598.664) [-608.862] -- 0:00:56
433000 -- (-604.776) (-605.550) [-599.687] (-605.492) * [-609.003] (-609.503) (-606.112) (-605.968) -- 0:00:56
433500 -- (-617.832) (-607.329) [-610.816] (-607.572) * [-604.663] (-611.327) (-606.485) (-600.256) -- 0:00:56
434000 -- (-609.101) (-606.044) [-607.956] (-606.511) * [-602.751] (-601.620) (-604.395) (-608.006) -- 0:00:56
434500 -- (-603.607) (-611.300) (-607.278) [-603.411] * [-611.086] (-611.439) (-608.368) (-602.341) -- 0:00:55
435000 -- (-607.102) (-608.536) [-603.507] (-611.234) * (-602.365) (-616.675) (-602.477) [-600.113] -- 0:00:55
Average standard deviation of split frequencies: 0.013992
435500 -- (-616.888) [-606.019] (-602.429) (-609.718) * (-603.573) (-602.086) (-602.940) [-604.631] -- 0:00:57
436000 -- (-604.094) (-609.737) (-603.773) [-603.305] * [-605.968] (-606.258) (-614.362) (-601.654) -- 0:00:56
436500 -- (-609.465) (-601.967) (-612.325) [-601.080] * (-607.359) (-604.412) (-608.741) [-600.858] -- 0:00:56
437000 -- (-603.199) [-600.500] (-608.598) (-601.660) * (-605.219) (-607.681) (-614.217) [-601.036] -- 0:00:56
437500 -- (-601.979) [-604.203] (-599.345) (-603.010) * [-608.770] (-606.501) (-610.125) (-605.429) -- 0:00:56
438000 -- (-606.465) (-605.695) [-610.006] (-600.409) * [-611.143] (-606.291) (-605.138) (-603.293) -- 0:00:56
438500 -- (-608.634) (-611.166) (-611.729) [-602.860] * (-600.155) (-604.460) [-604.434] (-606.092) -- 0:00:56
439000 -- (-608.696) (-611.992) (-603.135) [-605.838] * (-613.389) (-612.561) (-604.939) [-604.084] -- 0:00:56
439500 -- (-610.194) (-602.863) [-603.636] (-598.905) * (-603.035) [-607.677] (-608.072) (-604.334) -- 0:00:56
440000 -- (-607.391) [-605.383] (-603.224) (-609.887) * (-606.776) (-621.042) (-608.151) [-600.952] -- 0:00:56
Average standard deviation of split frequencies: 0.013844
440500 -- [-599.895] (-604.532) (-605.139) (-603.315) * (-600.248) (-612.540) (-604.969) [-602.968] -- 0:00:55
441000 -- [-604.246] (-610.482) (-611.414) (-603.130) * [-603.894] (-611.008) (-608.270) (-604.698) -- 0:00:55
441500 -- (-599.465) (-610.102) (-604.008) [-603.670] * (-606.154) [-608.289] (-604.945) (-603.516) -- 0:00:55
442000 -- (-599.999) (-612.333) (-603.935) [-603.260] * [-603.501] (-617.599) (-604.413) (-606.054) -- 0:00:55
442500 -- [-608.316] (-606.042) (-604.343) (-605.948) * (-596.603) (-612.743) [-600.955] (-607.140) -- 0:00:55
443000 -- (-599.051) (-610.535) (-601.391) [-605.983] * (-605.725) (-612.123) [-600.248] (-602.504) -- 0:00:55
443500 -- (-603.623) (-607.706) [-599.958] (-602.428) * (-612.426) (-603.777) (-606.324) [-610.443] -- 0:00:55
444000 -- (-604.321) (-603.200) [-600.821] (-605.797) * (-605.252) (-601.352) [-599.966] (-600.947) -- 0:00:55
444500 -- (-608.319) (-613.334) (-607.519) [-605.530] * (-610.437) (-603.952) (-605.002) [-604.633] -- 0:00:56
445000 -- (-599.902) (-614.367) [-604.439] (-598.509) * (-612.053) [-600.607] (-612.748) (-607.623) -- 0:00:56
Average standard deviation of split frequencies: 0.014130
445500 -- (-601.007) (-611.657) [-601.185] (-602.161) * [-599.641] (-612.975) (-615.157) (-606.125) -- 0:00:56
446000 -- (-599.671) (-606.557) [-605.208] (-608.124) * (-602.408) [-606.566] (-604.112) (-608.803) -- 0:00:55
446500 -- (-606.462) (-603.272) (-604.039) [-602.311] * [-603.199] (-606.399) (-603.845) (-602.525) -- 0:00:55
447000 -- (-608.359) (-611.613) [-613.779] (-599.106) * [-605.381] (-613.024) (-607.662) (-604.740) -- 0:00:55
447500 -- [-603.341] (-604.674) (-604.099) (-600.996) * (-604.628) [-608.018] (-608.069) (-606.443) -- 0:00:55
448000 -- [-605.539] (-600.961) (-609.229) (-609.947) * (-603.330) (-603.008) [-599.972] (-609.635) -- 0:00:55
448500 -- (-601.755) [-607.466] (-605.111) (-616.027) * (-604.321) [-601.821] (-616.828) (-605.300) -- 0:00:55
449000 -- (-598.713) (-598.716) [-607.932] (-607.743) * (-601.725) [-600.889] (-613.631) (-609.770) -- 0:00:55
449500 -- (-605.276) (-610.319) (-611.034) [-606.886] * (-601.993) (-601.866) [-603.196] (-604.966) -- 0:00:55
450000 -- (-607.309) (-610.252) [-607.629] (-611.740) * (-597.374) [-602.967] (-610.908) (-609.205) -- 0:00:55
Average standard deviation of split frequencies: 0.013656
450500 -- (-599.747) (-602.318) [-601.857] (-603.479) * [-600.019] (-610.015) (-602.970) (-602.258) -- 0:00:54
451000 -- (-604.887) (-601.679) [-600.151] (-602.176) * (-605.611) (-608.509) (-610.956) [-600.691] -- 0:00:54
451500 -- [-611.670] (-598.934) (-605.347) (-604.185) * [-604.105] (-611.287) (-603.140) (-606.013) -- 0:00:54
452000 -- [-604.965] (-605.288) (-600.488) (-610.557) * (-607.774) [-603.468] (-605.029) (-600.974) -- 0:00:54
452500 -- (-607.338) (-611.326) (-601.082) [-609.997] * (-603.128) [-610.050] (-611.806) (-602.680) -- 0:00:54
453000 -- [-603.085] (-609.318) (-606.145) (-603.649) * (-608.560) (-606.171) [-612.701] (-604.392) -- 0:00:54
453500 -- [-602.112] (-610.253) (-601.756) (-608.672) * (-601.569) (-605.794) [-603.245] (-601.120) -- 0:00:54
454000 -- [-606.950] (-607.274) (-604.136) (-607.221) * (-605.846) (-611.499) [-603.169] (-603.758) -- 0:00:55
454500 -- (-608.403) [-610.010] (-605.908) (-607.209) * (-614.089) (-610.736) [-601.300] (-614.667) -- 0:00:55
455000 -- (-610.167) [-601.981] (-614.324) (-605.819) * (-599.973) [-608.498] (-609.860) (-610.085) -- 0:00:55
Average standard deviation of split frequencies: 0.013497
455500 -- (-610.844) (-603.715) [-607.377] (-609.520) * (-607.155) (-603.472) [-603.195] (-602.342) -- 0:00:54
456000 -- [-603.613] (-610.490) (-613.251) (-604.321) * (-605.150) [-607.630] (-610.023) (-600.454) -- 0:00:54
456500 -- [-601.471] (-606.543) (-608.842) (-605.681) * (-603.810) (-599.498) (-606.601) [-600.385] -- 0:00:54
457000 -- (-609.491) (-611.769) [-599.834] (-609.813) * (-603.718) (-606.853) (-602.959) [-601.694] -- 0:00:54
457500 -- (-605.639) [-601.696] (-604.411) (-606.613) * (-608.161) [-609.889] (-604.544) (-611.172) -- 0:00:54
458000 -- (-609.421) (-607.338) (-608.961) [-603.423] * (-607.481) [-597.908] (-605.800) (-598.152) -- 0:00:54
458500 -- (-609.912) [-601.238] (-607.430) (-606.562) * (-609.678) (-603.520) [-599.929] (-611.384) -- 0:00:54
459000 -- (-607.130) (-606.415) (-606.740) [-614.018] * (-609.071) (-613.307) [-605.639] (-606.124) -- 0:00:54
459500 -- (-608.123) (-601.421) [-603.097] (-614.026) * (-603.667) (-612.291) (-611.873) [-604.442] -- 0:00:54
460000 -- (-606.686) (-605.700) (-615.586) [-609.483] * (-605.064) (-606.679) [-612.422] (-611.646) -- 0:00:54
Average standard deviation of split frequencies: 0.013587
460500 -- (-615.657) (-605.905) [-603.148] (-607.326) * (-611.700) [-603.502] (-603.668) (-604.632) -- 0:00:53
461000 -- (-611.675) (-602.327) [-597.486] (-613.952) * (-605.415) (-605.968) (-601.662) [-608.405] -- 0:00:53
461500 -- (-610.652) (-606.369) [-599.437] (-607.373) * (-613.599) [-607.352] (-613.543) (-607.744) -- 0:00:53
462000 -- [-614.053] (-609.347) (-603.428) (-600.087) * (-603.442) (-617.262) (-610.583) [-600.172] -- 0:00:53
462500 -- (-605.251) [-600.490] (-602.316) (-609.095) * (-598.915) (-602.292) (-613.244) [-606.159] -- 0:00:53
463000 -- (-605.604) (-601.855) [-602.329] (-608.915) * (-602.174) (-605.383) (-607.662) [-603.168] -- 0:00:53
463500 -- (-601.000) (-599.125) (-608.954) [-601.632] * (-602.495) [-605.571] (-606.252) (-609.167) -- 0:00:53
464000 -- [-604.493] (-608.177) (-603.051) (-607.957) * (-606.109) (-606.295) (-608.853) [-607.419] -- 0:00:53
464500 -- (-603.535) [-602.648] (-604.925) (-607.591) * (-609.661) (-604.854) (-601.628) [-602.913] -- 0:00:54
465000 -- (-601.527) [-605.293] (-603.080) (-600.552) * (-606.221) (-607.209) [-607.983] (-605.979) -- 0:00:54
Average standard deviation of split frequencies: 0.013790
465500 -- [-604.891] (-606.240) (-602.599) (-607.093) * [-598.595] (-615.012) (-613.344) (-603.843) -- 0:00:53
466000 -- (-600.454) (-605.980) (-606.584) [-601.732] * (-610.129) (-601.947) [-605.006] (-606.171) -- 0:00:53
466500 -- [-603.839] (-603.261) (-604.083) (-612.438) * (-607.643) (-600.045) (-619.738) [-600.188] -- 0:00:53
467000 -- (-604.206) [-606.268] (-606.946) (-611.011) * (-606.525) [-604.080] (-609.075) (-605.104) -- 0:00:53
467500 -- (-605.315) (-608.358) [-601.442] (-606.204) * [-605.672] (-607.270) (-612.110) (-601.123) -- 0:00:53
468000 -- [-607.619] (-607.352) (-601.759) (-611.511) * (-608.891) (-608.613) (-610.529) [-599.355] -- 0:00:53
468500 -- (-607.995) (-609.691) (-602.028) [-603.618] * [-605.549] (-605.407) (-612.992) (-600.536) -- 0:00:53
469000 -- (-614.683) [-602.801] (-607.118) (-606.346) * [-602.566] (-602.964) (-603.565) (-600.089) -- 0:00:53
469500 -- (-607.879) (-609.012) (-605.019) [-606.283] * (-604.786) (-609.669) (-606.250) [-604.772] -- 0:00:53
470000 -- (-612.565) [-606.114] (-600.771) (-608.303) * (-605.758) [-601.366] (-617.853) (-604.270) -- 0:00:53
Average standard deviation of split frequencies: 0.013632
470500 -- (-603.367) (-607.703) (-609.041) [-610.090] * (-604.727) (-604.175) (-611.962) [-602.403] -- 0:00:52
471000 -- (-602.918) [-602.680] (-604.147) (-603.060) * [-600.081] (-605.489) (-603.490) (-608.628) -- 0:00:52
471500 -- [-603.434] (-598.548) (-612.873) (-609.570) * (-606.906) (-605.384) (-608.370) [-602.629] -- 0:00:52
472000 -- (-603.898) (-607.761) (-605.569) [-606.262] * (-602.880) (-600.138) [-607.821] (-612.860) -- 0:00:52
472500 -- [-601.229] (-610.672) (-601.547) (-609.630) * (-609.169) (-606.409) [-600.433] (-600.815) -- 0:00:52
473000 -- (-613.309) [-603.463] (-615.311) (-604.406) * [-606.160] (-604.159) (-608.927) (-610.161) -- 0:00:52
473500 -- (-605.943) (-609.475) [-613.266] (-606.990) * (-607.239) [-596.846] (-605.391) (-610.549) -- 0:00:52
474000 -- [-604.504] (-612.724) (-609.186) (-608.053) * (-605.380) (-609.036) [-602.573] (-606.407) -- 0:00:52
474500 -- (-611.378) [-600.173] (-608.540) (-606.910) * (-603.716) [-598.638] (-606.131) (-604.189) -- 0:00:53
475000 -- (-606.383) [-606.168] (-608.272) (-608.213) * (-606.294) (-599.184) [-600.921] (-603.858) -- 0:00:53
Average standard deviation of split frequencies: 0.013457
475500 -- [-597.030] (-612.098) (-614.566) (-603.747) * [-603.428] (-602.969) (-602.792) (-609.997) -- 0:00:52
476000 -- [-602.045] (-605.189) (-612.312) (-608.182) * (-605.743) [-603.640] (-607.547) (-610.250) -- 0:00:52
476500 -- (-608.206) (-615.430) (-608.560) [-600.949] * (-603.704) [-602.645] (-605.807) (-600.569) -- 0:00:52
477000 -- (-608.309) [-605.693] (-603.256) (-604.352) * (-610.741) (-603.278) (-615.498) [-600.861] -- 0:00:52
477500 -- (-617.522) (-602.263) [-599.494] (-603.161) * (-607.611) (-605.766) [-609.099] (-608.240) -- 0:00:52
478000 -- [-600.916] (-604.555) (-609.574) (-607.024) * [-608.063] (-605.845) (-605.919) (-605.997) -- 0:00:52
478500 -- (-603.489) (-604.009) [-601.682] (-609.931) * (-605.708) (-605.215) (-608.077) [-602.315] -- 0:00:52
479000 -- (-605.506) [-608.519] (-602.473) (-609.295) * (-607.525) (-602.467) [-600.245] (-604.795) -- 0:00:52
479500 -- (-606.114) (-603.780) [-600.990] (-599.172) * (-603.072) (-612.648) (-602.193) [-607.467] -- 0:00:52
480000 -- (-604.435) (-608.370) [-602.469] (-603.242) * (-604.662) [-603.280] (-601.678) (-613.067) -- 0:00:52
Average standard deviation of split frequencies: 0.013499
480500 -- (-606.577) (-605.134) [-603.381] (-601.539) * [-609.628] (-606.510) (-604.933) (-610.864) -- 0:00:51
481000 -- (-607.043) [-603.922] (-608.091) (-600.189) * (-606.606) (-611.197) (-606.949) [-607.503] -- 0:00:51
481500 -- (-613.035) (-600.407) (-599.323) [-599.908] * (-606.005) (-605.503) [-601.119] (-610.391) -- 0:00:51
482000 -- [-605.215] (-612.751) (-606.089) (-604.428) * (-603.352) (-611.194) (-599.408) [-606.502] -- 0:00:51
482500 -- (-605.583) (-607.628) (-606.596) [-601.424] * (-606.862) (-607.916) (-599.311) [-599.450] -- 0:00:51
483000 -- (-607.174) [-602.492] (-607.601) (-608.114) * [-600.192] (-606.867) (-611.165) (-602.505) -- 0:00:51
483500 -- (-614.381) (-603.926) [-602.361] (-610.899) * (-605.520) (-604.252) (-609.954) [-600.045] -- 0:00:51
484000 -- (-607.935) [-601.827] (-606.333) (-603.870) * (-609.257) (-607.997) (-615.302) [-598.884] -- 0:00:51
484500 -- [-603.586] (-602.067) (-611.011) (-602.053) * (-609.242) [-608.392] (-606.846) (-605.251) -- 0:00:52
485000 -- (-601.481) (-603.388) [-599.711] (-601.370) * [-607.362] (-611.377) (-601.236) (-600.873) -- 0:00:52
Average standard deviation of split frequencies: 0.013148
485500 -- (-614.638) [-602.105] (-610.678) (-605.256) * (-605.206) (-608.062) [-602.067] (-603.491) -- 0:00:51
486000 -- (-608.845) (-610.394) [-601.655] (-599.768) * (-598.752) (-611.103) [-605.099] (-603.549) -- 0:00:51
486500 -- [-609.833] (-600.127) (-606.150) (-609.715) * (-612.240) (-603.531) (-613.299) [-607.286] -- 0:00:51
487000 -- (-611.858) [-606.469] (-606.437) (-606.097) * [-604.941] (-606.736) (-607.581) (-607.722) -- 0:00:51
487500 -- (-601.329) (-609.782) [-602.769] (-605.850) * (-603.890) (-602.669) (-613.514) [-604.762] -- 0:00:51
488000 -- (-615.499) [-602.599] (-601.611) (-606.552) * (-601.617) [-599.941] (-603.615) (-605.639) -- 0:00:51
488500 -- [-606.781] (-607.537) (-604.013) (-604.866) * [-604.771] (-605.034) (-603.697) (-610.790) -- 0:00:51
489000 -- (-609.781) [-608.238] (-605.722) (-604.079) * (-601.614) (-612.873) (-611.648) [-604.793] -- 0:00:51
489500 -- [-601.263] (-599.262) (-607.046) (-620.982) * (-608.020) (-607.811) (-607.253) [-602.634] -- 0:00:51
490000 -- (-605.658) [-596.047] (-605.213) (-605.352) * (-604.269) [-606.056] (-609.428) (-602.347) -- 0:00:51
Average standard deviation of split frequencies: 0.012383
490500 -- (-606.253) (-605.914) [-599.021] (-601.740) * (-602.774) (-610.807) [-601.270] (-607.207) -- 0:00:50
491000 -- (-601.557) (-603.644) [-606.223] (-605.985) * (-600.701) [-598.456] (-605.350) (-602.553) -- 0:00:50
491500 -- (-600.724) (-605.006) (-606.405) [-603.522] * (-606.096) (-611.351) [-608.561] (-600.307) -- 0:00:50
492000 -- [-606.472] (-606.312) (-607.684) (-596.814) * [-602.066] (-606.732) (-611.416) (-610.884) -- 0:00:50
492500 -- [-601.550] (-605.914) (-609.814) (-602.523) * (-604.821) (-613.556) (-610.358) [-602.625] -- 0:00:50
493000 -- (-611.441) [-603.164] (-623.102) (-612.273) * (-599.246) (-607.918) (-604.014) [-604.231] -- 0:00:50
493500 -- (-602.832) [-601.574] (-613.941) (-608.212) * (-606.427) [-607.326] (-606.532) (-613.211) -- 0:00:50
494000 -- (-602.039) (-609.029) (-605.855) [-605.189] * (-607.301) [-603.312] (-609.756) (-612.180) -- 0:00:50
494500 -- [-604.766] (-604.453) (-603.140) (-602.971) * (-607.079) [-603.692] (-611.482) (-607.044) -- 0:00:51
495000 -- (-613.314) (-617.615) [-602.069] (-606.805) * (-610.437) (-606.878) [-606.068] (-604.186) -- 0:00:51
Average standard deviation of split frequencies: 0.012250
495500 -- [-601.999] (-607.812) (-601.510) (-605.014) * (-606.138) [-600.684] (-614.081) (-607.947) -- 0:00:50
496000 -- (-604.804) (-605.381) (-604.754) [-603.010] * (-605.530) (-600.877) [-604.742] (-607.443) -- 0:00:50
496500 -- (-606.313) [-604.873] (-615.487) (-603.012) * [-605.821] (-615.523) (-617.606) (-600.069) -- 0:00:50
497000 -- (-611.669) [-602.066] (-610.632) (-601.919) * (-610.334) [-604.580] (-611.413) (-602.595) -- 0:00:50
497500 -- (-603.903) (-602.324) (-601.417) [-603.631] * (-611.825) (-601.078) (-619.061) [-601.499] -- 0:00:50
498000 -- (-616.514) [-602.482] (-605.846) (-610.878) * (-607.311) (-605.954) [-606.318] (-611.001) -- 0:00:50
498500 -- [-602.027] (-606.770) (-605.389) (-605.291) * (-605.266) [-605.310] (-604.374) (-601.673) -- 0:00:50
499000 -- (-605.411) (-603.052) [-600.354] (-611.879) * (-604.297) (-604.605) [-608.011] (-608.198) -- 0:00:50
499500 -- (-606.757) (-604.859) [-601.933] (-603.639) * (-606.969) (-600.634) [-607.362] (-602.443) -- 0:00:50
500000 -- (-604.283) (-605.254) (-605.373) [-602.612] * (-608.717) (-608.285) [-608.248] (-606.046) -- 0:00:50
Average standard deviation of split frequencies: 0.012534
500500 -- [-604.534] (-600.721) (-606.040) (-603.521) * (-606.228) (-608.201) [-607.947] (-603.190) -- 0:00:49
501000 -- (-609.972) (-612.878) [-603.492] (-612.889) * (-600.641) [-602.777] (-603.661) (-600.609) -- 0:00:49
501500 -- (-607.771) (-605.064) (-608.652) [-604.746] * (-602.890) (-602.468) (-601.090) [-605.061] -- 0:00:49
502000 -- (-610.199) [-600.620] (-606.396) (-607.504) * (-610.310) (-607.362) [-599.321] (-607.939) -- 0:00:49
502500 -- (-605.738) [-606.619] (-607.617) (-601.770) * (-603.084) (-600.022) (-604.436) [-605.426] -- 0:00:49
503000 -- [-611.882] (-604.869) (-602.211) (-604.101) * (-614.983) (-604.535) (-607.479) [-605.537] -- 0:00:49
503500 -- (-606.049) (-606.064) (-606.056) [-602.182] * (-607.012) (-607.264) [-600.189] (-608.449) -- 0:00:49
504000 -- (-607.851) (-613.657) [-606.155] (-601.474) * (-607.135) (-606.473) [-610.246] (-606.302) -- 0:00:49
504500 -- (-610.703) (-604.997) (-600.005) [-604.520] * (-614.853) [-602.130] (-601.418) (-602.680) -- 0:00:50
505000 -- (-603.088) (-605.661) [-598.992] (-602.544) * (-606.982) (-613.453) [-598.282] (-604.026) -- 0:00:49
Average standard deviation of split frequencies: 0.012461
505500 -- (-607.468) (-604.371) [-602.808] (-606.380) * [-603.597] (-602.286) (-604.837) (-611.956) -- 0:00:49
506000 -- (-602.970) (-602.306) (-605.968) [-608.201] * (-602.499) (-609.524) [-604.360] (-609.549) -- 0:00:49
506500 -- (-605.900) (-604.982) [-601.970] (-610.038) * (-603.045) [-600.767] (-610.999) (-606.797) -- 0:00:49
507000 -- [-604.514] (-608.801) (-600.532) (-603.525) * [-607.449] (-598.824) (-607.981) (-607.078) -- 0:00:49
507500 -- [-605.875] (-602.676) (-609.731) (-608.451) * (-607.078) [-602.390] (-607.180) (-601.097) -- 0:00:49
508000 -- (-616.316) (-608.636) (-606.606) [-608.939] * (-608.108) [-600.519] (-607.012) (-606.436) -- 0:00:49
508500 -- (-601.034) (-602.763) [-601.134] (-609.523) * (-604.719) (-608.669) (-610.048) [-598.720] -- 0:00:49
509000 -- (-605.124) (-611.926) (-609.832) [-606.155] * (-606.169) (-609.009) [-600.746] (-602.232) -- 0:00:49
509500 -- (-600.952) (-600.860) (-612.085) [-605.516] * (-608.847) (-604.987) (-604.524) [-600.344] -- 0:00:49
510000 -- (-602.079) [-605.153] (-604.603) (-615.657) * (-603.761) (-606.048) (-608.411) [-604.789] -- 0:00:49
Average standard deviation of split frequencies: 0.011654
510500 -- (-600.946) (-605.185) [-606.408] (-607.382) * [-610.864] (-619.149) (-610.893) (-602.609) -- 0:00:48
511000 -- [-601.358] (-606.241) (-605.351) (-606.209) * (-607.916) (-603.375) [-606.786] (-612.640) -- 0:00:48
511500 -- (-603.112) (-603.560) [-602.436] (-606.536) * (-609.730) (-605.010) (-609.241) [-607.441] -- 0:00:48
512000 -- [-604.185] (-613.305) (-608.855) (-607.054) * (-607.298) (-609.229) (-603.687) [-599.606] -- 0:00:48
512500 -- (-616.697) (-603.881) (-605.976) [-600.850] * (-605.262) [-601.284] (-602.971) (-610.702) -- 0:00:48
513000 -- (-606.824) [-601.700] (-598.801) (-604.548) * [-601.302] (-605.708) (-606.061) (-601.346) -- 0:00:48
513500 -- (-609.019) [-605.371] (-600.166) (-607.887) * (-602.235) [-605.769] (-607.919) (-604.014) -- 0:00:48
514000 -- (-608.565) (-604.095) (-601.697) [-606.634] * (-607.308) (-607.252) [-602.171] (-604.580) -- 0:00:48
514500 -- (-609.489) (-603.330) (-603.780) [-606.052] * (-600.403) [-606.343] (-606.033) (-603.421) -- 0:00:49
515000 -- [-601.588] (-607.666) (-608.755) (-607.569) * (-608.552) [-603.269] (-604.284) (-603.597) -- 0:00:48
Average standard deviation of split frequencies: 0.011248
515500 -- [-604.632] (-612.123) (-603.825) (-607.957) * (-608.295) (-602.395) (-602.810) [-602.583] -- 0:00:48
516000 -- [-602.885] (-607.321) (-607.506) (-605.115) * (-606.765) [-603.128] (-603.481) (-604.603) -- 0:00:48
516500 -- (-605.657) (-602.872) [-604.540] (-609.206) * (-617.945) (-607.037) [-610.148] (-604.677) -- 0:00:48
517000 -- (-605.786) [-608.451] (-606.662) (-604.465) * (-613.349) (-613.402) [-600.171] (-606.476) -- 0:00:48
517500 -- (-595.921) (-602.420) (-609.182) [-603.899] * (-614.573) (-608.821) [-600.467] (-611.859) -- 0:00:48
518000 -- (-603.629) (-603.716) (-611.534) [-605.738] * (-601.016) (-609.202) (-614.389) [-601.341] -- 0:00:48
518500 -- [-601.350] (-610.516) (-605.064) (-615.398) * (-607.512) (-609.984) [-602.050] (-604.896) -- 0:00:48
519000 -- (-607.270) [-602.539] (-604.856) (-602.275) * (-611.446) (-606.607) [-605.452] (-611.691) -- 0:00:48
519500 -- (-608.520) (-603.264) [-602.784] (-608.479) * [-604.769] (-611.856) (-614.016) (-607.951) -- 0:00:48
520000 -- (-603.883) (-603.506) [-599.451] (-618.071) * (-607.999) (-606.055) (-604.178) [-598.044] -- 0:00:48
Average standard deviation of split frequencies: 0.010808
520500 -- (-604.527) (-599.355) [-603.872] (-603.337) * (-606.074) (-604.844) (-608.177) [-611.196] -- 0:00:47
521000 -- (-608.225) [-601.593] (-603.313) (-600.355) * [-607.514] (-610.033) (-608.280) (-605.544) -- 0:00:47
521500 -- (-604.170) (-602.348) [-607.903] (-601.385) * (-603.399) [-610.000] (-607.019) (-604.965) -- 0:00:47
522000 -- (-608.303) [-600.100] (-603.914) (-604.725) * (-602.430) [-603.548] (-607.185) (-605.640) -- 0:00:47
522500 -- (-606.693) (-605.486) (-612.585) [-604.153] * [-604.368] (-599.903) (-606.404) (-603.001) -- 0:00:47
523000 -- (-600.750) (-603.151) [-612.647] (-609.095) * [-608.448] (-604.053) (-607.264) (-611.724) -- 0:00:47
523500 -- (-605.719) [-600.859] (-607.610) (-600.162) * [-608.587] (-603.854) (-605.099) (-610.456) -- 0:00:47
524000 -- (-609.242) (-601.977) (-603.184) [-605.377] * (-610.937) [-604.409] (-604.770) (-604.078) -- 0:00:47
524500 -- [-601.736] (-609.174) (-604.061) (-604.495) * (-609.041) (-603.506) [-602.945] (-599.156) -- 0:00:47
525000 -- (-605.627) [-602.206] (-604.499) (-601.125) * (-602.643) (-602.320) [-605.038] (-600.300) -- 0:00:47
Average standard deviation of split frequencies: 0.010702
525500 -- (-605.658) [-612.981] (-601.022) (-609.874) * (-607.129) [-605.442] (-607.226) (-605.097) -- 0:00:47
526000 -- (-599.545) (-603.349) [-608.910] (-607.054) * (-609.995) (-604.414) [-599.470] (-612.038) -- 0:00:47
526500 -- (-605.668) (-601.273) (-609.260) [-602.370] * (-603.198) [-600.511] (-601.899) (-601.199) -- 0:00:47
527000 -- [-601.074] (-605.273) (-604.068) (-607.630) * [-601.783] (-604.457) (-607.389) (-607.866) -- 0:00:47
527500 -- [-601.545] (-608.401) (-604.845) (-617.249) * [-599.752] (-602.384) (-599.306) (-607.837) -- 0:00:47
528000 -- (-609.420) (-606.021) [-599.971] (-614.017) * (-605.220) (-608.304) (-606.278) [-599.405] -- 0:00:47
528500 -- [-607.887] (-604.937) (-599.920) (-607.334) * [-610.237] (-602.272) (-605.313) (-609.680) -- 0:00:47
529000 -- (-600.633) (-604.012) [-602.353] (-603.466) * (-607.934) [-609.956] (-603.501) (-608.977) -- 0:00:47
529500 -- (-605.743) (-608.705) (-605.576) [-604.563] * (-613.617) [-607.496] (-604.965) (-605.775) -- 0:00:47
530000 -- [-610.140] (-602.341) (-609.363) (-611.297) * (-608.099) (-605.686) (-604.069) [-603.774] -- 0:00:47
Average standard deviation of split frequencies: 0.010826
530500 -- (-605.673) (-608.291) [-611.981] (-603.740) * (-611.014) (-609.608) (-609.334) [-609.763] -- 0:00:46
531000 -- [-612.343] (-607.145) (-601.452) (-600.491) * (-611.323) [-597.359] (-608.685) (-601.360) -- 0:00:46
531500 -- (-615.007) (-602.396) [-600.699] (-607.541) * (-608.578) [-602.037] (-610.204) (-607.388) -- 0:00:46
532000 -- (-604.820) [-598.990] (-601.594) (-607.688) * (-616.617) [-601.859] (-601.988) (-601.755) -- 0:00:46
532500 -- (-598.531) (-605.288) [-601.065] (-604.940) * (-604.704) (-605.822) [-603.477] (-602.083) -- 0:00:46
533000 -- [-602.556] (-601.801) (-602.008) (-611.938) * [-605.255] (-607.738) (-601.775) (-607.094) -- 0:00:46
533500 -- [-613.620] (-608.266) (-610.970) (-603.351) * [-605.103] (-603.145) (-609.824) (-598.048) -- 0:00:46
534000 -- (-606.876) (-610.637) [-599.029] (-602.494) * (-602.174) [-606.602] (-610.057) (-605.819) -- 0:00:46
534500 -- [-605.228] (-607.492) (-608.655) (-604.563) * (-605.843) (-601.847) (-610.873) [-597.883] -- 0:00:46
535000 -- (-606.192) (-604.629) (-602.510) [-596.879] * [-600.027] (-611.793) (-603.383) (-608.546) -- 0:00:46
Average standard deviation of split frequencies: 0.010437
535500 -- (-599.716) (-598.798) (-609.680) [-602.415] * (-604.000) [-601.856] (-610.307) (-607.156) -- 0:00:46
536000 -- (-607.534) (-613.652) [-615.338] (-604.022) * (-607.190) (-603.599) [-598.889] (-604.058) -- 0:00:46
536500 -- [-598.585] (-599.742) (-605.907) (-607.316) * [-605.107] (-606.805) (-611.390) (-603.132) -- 0:00:46
537000 -- (-613.904) (-605.362) (-607.778) [-603.451] * (-604.155) [-600.508] (-603.817) (-608.866) -- 0:00:46
537500 -- (-601.876) (-604.335) [-601.032] (-608.296) * (-606.664) [-603.248] (-602.376) (-603.682) -- 0:00:46
538000 -- [-599.345] (-605.746) (-609.966) (-611.280) * (-608.124) (-605.641) [-599.977] (-597.632) -- 0:00:46
538500 -- (-602.174) (-601.897) (-601.041) [-603.057] * (-603.261) [-604.990] (-607.000) (-597.268) -- 0:00:46
539000 -- [-603.069] (-604.427) (-604.041) (-601.247) * (-609.201) (-608.210) [-602.844] (-600.563) -- 0:00:46
539500 -- (-614.942) (-599.969) (-607.831) [-605.600] * (-610.543) [-606.291] (-601.585) (-604.106) -- 0:00:46
540000 -- (-605.397) (-602.543) (-606.650) [-604.573] * [-606.280] (-600.881) (-605.000) (-600.291) -- 0:00:46
Average standard deviation of split frequencies: 0.010790
540500 -- [-603.322] (-605.138) (-603.144) (-608.543) * [-602.946] (-604.334) (-608.945) (-601.298) -- 0:00:45
541000 -- (-602.365) (-607.755) (-608.486) [-604.160] * (-605.862) [-600.160] (-605.545) (-604.775) -- 0:00:45
541500 -- [-601.629] (-611.917) (-607.974) (-602.623) * (-609.918) (-607.319) [-600.826] (-601.786) -- 0:00:45
542000 -- (-604.213) (-599.816) [-607.996] (-607.510) * (-599.791) [-602.044] (-597.861) (-603.937) -- 0:00:45
542500 -- (-605.964) (-606.757) [-605.820] (-606.904) * (-610.013) [-606.641] (-605.995) (-602.826) -- 0:00:45
543000 -- (-607.670) (-609.499) [-607.696] (-601.944) * [-602.716] (-606.155) (-605.759) (-610.889) -- 0:00:45
543500 -- [-601.790] (-608.458) (-603.186) (-606.879) * (-607.690) [-603.321] (-606.075) (-602.657) -- 0:00:45
544000 -- (-603.291) (-614.327) [-601.385] (-609.879) * [-605.278] (-610.461) (-608.669) (-604.997) -- 0:00:45
544500 -- (-605.887) (-603.658) [-603.398] (-600.257) * (-606.556) (-601.393) (-613.872) [-604.562] -- 0:00:45
545000 -- (-607.551) [-603.700] (-602.882) (-602.131) * (-604.213) [-606.748] (-605.821) (-607.483) -- 0:00:45
Average standard deviation of split frequencies: 0.011386
545500 -- (-604.244) (-604.680) (-598.899) [-608.709] * (-608.898) (-611.074) [-602.326] (-603.356) -- 0:00:45
546000 -- (-608.211) [-601.741] (-601.840) (-608.518) * (-605.539) (-613.739) [-605.069] (-612.352) -- 0:00:45
546500 -- (-603.382) (-604.419) (-603.013) [-606.951] * [-606.868] (-602.162) (-603.949) (-610.497) -- 0:00:45
547000 -- (-602.094) [-601.001] (-609.832) (-602.706) * (-605.141) [-603.391] (-606.958) (-612.100) -- 0:00:45
547500 -- (-603.604) (-608.727) (-605.441) [-597.951] * (-618.942) (-607.137) [-601.863] (-606.885) -- 0:00:45
548000 -- [-600.596] (-601.705) (-605.134) (-600.744) * [-602.051] (-608.226) (-601.880) (-604.791) -- 0:00:45
548500 -- (-602.730) (-615.760) (-609.191) [-603.326] * (-602.046) (-603.927) [-603.586] (-605.946) -- 0:00:45
549000 -- (-601.745) [-610.365] (-602.830) (-609.520) * (-605.787) (-610.276) [-604.353] (-606.863) -- 0:00:45
549500 -- [-600.706] (-607.604) (-604.696) (-612.233) * (-611.922) (-607.036) [-608.358] (-604.773) -- 0:00:45
550000 -- (-607.051) (-606.276) [-603.467] (-606.225) * [-604.685] (-606.335) (-610.955) (-598.618) -- 0:00:45
Average standard deviation of split frequencies: 0.011182
550500 -- (-611.103) [-605.352] (-600.802) (-615.789) * (-608.915) (-611.002) [-604.528] (-607.293) -- 0:00:44
551000 -- (-605.479) (-600.276) [-606.935] (-601.469) * [-607.799] (-607.552) (-607.765) (-607.902) -- 0:00:44
551500 -- (-608.302) [-602.007] (-619.625) (-601.529) * (-608.445) (-604.179) [-603.958] (-605.406) -- 0:00:44
552000 -- [-598.633] (-605.317) (-612.331) (-614.360) * (-605.076) (-610.719) [-599.357] (-601.948) -- 0:00:44
552500 -- (-604.604) [-602.479] (-608.110) (-606.714) * [-602.771] (-606.754) (-611.233) (-604.434) -- 0:00:44
553000 -- (-598.569) [-603.492] (-601.210) (-608.616) * (-602.872) (-602.779) [-599.748] (-606.451) -- 0:00:44
553500 -- (-610.590) (-605.701) (-609.786) [-605.271] * (-602.467) (-610.173) (-605.577) [-610.283] -- 0:00:44
554000 -- (-606.367) [-600.173] (-614.863) (-606.138) * (-605.916) (-605.596) [-601.534] (-607.827) -- 0:00:44
554500 -- (-604.009) (-602.819) [-600.603] (-603.087) * (-617.982) [-603.977] (-606.088) (-612.918) -- 0:00:44
555000 -- [-599.726] (-603.438) (-607.117) (-610.510) * [-600.120] (-604.568) (-607.646) (-604.654) -- 0:00:44
Average standard deviation of split frequencies: 0.011552
555500 -- (-600.144) (-613.251) [-607.045] (-608.988) * [-599.528] (-605.234) (-611.694) (-604.541) -- 0:00:44
556000 -- (-598.829) (-603.529) (-603.519) [-601.644] * (-603.559) (-613.746) [-604.559] (-607.577) -- 0:00:44
556500 -- (-600.939) (-601.422) [-600.357] (-602.840) * [-604.518] (-610.613) (-607.637) (-606.992) -- 0:00:44
557000 -- (-605.472) (-606.802) [-601.856] (-602.228) * (-602.638) (-606.183) [-603.599] (-609.787) -- 0:00:44
557500 -- (-602.939) [-604.443] (-598.206) (-616.324) * (-602.929) [-601.158] (-600.445) (-604.039) -- 0:00:44
558000 -- (-603.786) (-609.011) [-596.906] (-600.011) * (-604.367) (-604.417) [-601.783] (-606.203) -- 0:00:44
558500 -- (-606.562) (-610.615) [-605.676] (-613.376) * (-603.442) [-604.326] (-604.566) (-609.902) -- 0:00:44
559000 -- (-605.838) (-606.380) [-603.319] (-608.517) * (-602.673) [-607.456] (-608.918) (-599.142) -- 0:00:44
559500 -- (-601.904) (-603.707) (-614.575) [-601.320] * (-605.260) (-604.141) [-605.957] (-606.265) -- 0:00:44
560000 -- (-611.563) (-609.419) [-597.183] (-607.966) * [-607.196] (-598.763) (-598.931) (-608.053) -- 0:00:44
Average standard deviation of split frequencies: 0.010930
560500 -- (-609.450) [-608.125] (-604.031) (-606.615) * (-602.565) [-601.643] (-603.068) (-610.549) -- 0:00:43
561000 -- [-601.586] (-608.081) (-612.811) (-600.286) * [-606.578] (-606.506) (-607.090) (-600.764) -- 0:00:43
561500 -- [-597.868] (-599.929) (-607.798) (-604.921) * (-606.773) (-607.649) [-603.101] (-606.112) -- 0:00:43
562000 -- (-604.323) (-607.879) (-606.823) [-606.801] * (-605.631) (-602.127) (-604.432) [-601.309] -- 0:00:43
562500 -- (-602.051) [-604.093] (-615.401) (-602.656) * (-609.035) (-605.585) (-602.694) [-607.433] -- 0:00:43
563000 -- (-616.565) (-605.340) [-605.714] (-612.935) * (-607.754) (-612.656) [-601.980] (-610.067) -- 0:00:43
563500 -- [-602.976] (-610.702) (-608.243) (-605.870) * [-613.454] (-605.645) (-605.545) (-605.609) -- 0:00:43
564000 -- (-606.056) (-600.713) (-613.213) [-604.280] * [-606.603] (-605.395) (-606.432) (-606.170) -- 0:00:43
564500 -- (-604.694) (-608.908) (-614.417) [-601.627] * (-613.342) (-603.137) (-609.123) [-603.687] -- 0:00:43
565000 -- (-606.141) (-607.755) [-603.007] (-607.316) * (-602.315) (-603.240) (-609.528) [-602.719] -- 0:00:43
Average standard deviation of split frequencies: 0.011170
565500 -- (-614.703) [-602.981] (-605.510) (-601.591) * (-612.700) (-612.771) [-605.169] (-603.046) -- 0:00:43
566000 -- (-600.491) (-607.871) [-612.895] (-605.993) * (-606.994) (-602.358) (-603.802) [-604.191] -- 0:00:43
566500 -- (-612.396) (-601.874) (-605.225) [-598.224] * [-605.398] (-604.387) (-602.504) (-607.598) -- 0:00:43
567000 -- (-609.434) (-602.066) [-607.535] (-609.966) * (-607.825) (-611.426) [-599.792] (-619.297) -- 0:00:43
567500 -- [-603.935] (-609.428) (-602.748) (-607.819) * (-604.921) (-616.865) [-603.112] (-603.626) -- 0:00:43
568000 -- (-608.913) (-606.494) [-607.840] (-605.764) * [-602.297] (-600.312) (-610.775) (-613.193) -- 0:00:43
568500 -- [-608.888] (-599.017) (-606.828) (-601.923) * (-608.385) (-603.358) [-602.930] (-601.976) -- 0:00:43
569000 -- (-606.854) (-621.923) (-613.585) [-600.802] * (-605.370) (-619.660) (-606.677) [-602.817] -- 0:00:43
569500 -- (-611.258) (-605.350) (-603.746) [-598.557] * (-612.894) (-612.491) (-606.864) [-607.079] -- 0:00:43
570000 -- (-612.781) [-607.026] (-604.993) (-607.563) * (-611.670) (-605.100) (-603.898) [-604.459] -- 0:00:43
Average standard deviation of split frequencies: 0.011322
570500 -- (-605.520) [-604.253] (-608.805) (-604.196) * [-608.263] (-602.196) (-611.116) (-609.380) -- 0:00:42
571000 -- (-614.119) [-606.166] (-610.635) (-604.280) * (-608.519) (-608.832) (-605.692) [-603.875] -- 0:00:42
571500 -- (-602.952) [-608.332] (-608.896) (-603.326) * (-602.959) [-612.532] (-624.758) (-608.092) -- 0:00:42
572000 -- (-601.584) (-604.782) (-603.129) [-600.731] * [-603.519] (-610.624) (-613.282) (-601.182) -- 0:00:42
572500 -- (-608.629) [-606.629] (-606.966) (-602.444) * (-608.479) (-602.025) [-602.958] (-609.222) -- 0:00:42
573000 -- [-603.111] (-602.691) (-605.773) (-611.717) * (-612.958) (-609.298) (-607.200) [-605.625] -- 0:00:42
573500 -- (-608.452) [-603.337] (-614.316) (-602.906) * (-606.244) [-602.728] (-607.077) (-607.365) -- 0:00:42
574000 -- (-606.167) (-602.860) (-611.513) [-599.505] * (-600.809) [-602.884] (-606.117) (-619.177) -- 0:00:42
574500 -- (-607.525) (-608.316) (-602.027) [-605.038] * [-600.156] (-604.926) (-606.630) (-621.180) -- 0:00:42
575000 -- (-607.602) (-603.450) [-599.656] (-608.329) * [-603.733] (-605.790) (-610.553) (-617.718) -- 0:00:42
Average standard deviation of split frequencies: 0.011795
575500 -- (-604.922) (-607.777) [-599.985] (-612.303) * (-602.453) (-607.022) (-606.778) [-605.037] -- 0:00:42
576000 -- (-607.331) (-604.044) (-600.173) [-607.791] * (-605.628) (-606.383) (-603.108) [-610.851] -- 0:00:42
576500 -- (-606.490) (-606.018) (-606.436) [-605.716] * (-597.830) (-601.316) [-600.851] (-604.596) -- 0:00:42
577000 -- [-600.740] (-604.076) (-607.317) (-602.484) * [-602.685] (-603.699) (-607.903) (-605.929) -- 0:00:42
577500 -- (-606.568) (-606.550) [-605.871] (-605.814) * (-601.608) (-606.136) [-606.036] (-600.258) -- 0:00:42
578000 -- (-599.882) (-610.975) [-604.308] (-608.250) * (-601.146) (-603.540) (-606.406) [-609.098] -- 0:00:42
578500 -- (-602.743) (-611.988) (-607.117) [-603.896] * (-598.380) (-604.546) (-614.306) [-600.686] -- 0:00:42
579000 -- (-604.529) (-610.806) (-601.363) [-609.112] * [-598.102] (-615.107) (-610.258) (-602.041) -- 0:00:42
579500 -- (-606.174) (-600.062) [-601.230] (-610.832) * (-604.424) (-608.582) (-609.941) [-599.985] -- 0:00:42
580000 -- (-604.768) (-612.015) [-609.747] (-605.648) * (-621.343) [-611.142] (-608.658) (-614.510) -- 0:00:42
Average standard deviation of split frequencies: 0.011413
580500 -- (-604.646) (-608.866) (-600.990) [-606.555] * [-602.092] (-603.226) (-608.991) (-605.234) -- 0:00:41
581000 -- (-609.867) (-607.889) [-610.916] (-606.777) * (-600.838) (-602.633) (-600.041) [-604.365] -- 0:00:41
581500 -- [-601.670] (-608.058) (-604.096) (-604.018) * (-611.541) [-600.490] (-601.585) (-604.356) -- 0:00:41
582000 -- [-599.720] (-610.216) (-602.732) (-604.189) * (-614.913) [-605.325] (-603.135) (-598.510) -- 0:00:41
582500 -- (-605.880) [-602.450] (-598.273) (-613.445) * (-600.839) (-608.956) [-608.716] (-604.219) -- 0:00:41
583000 -- (-606.990) (-608.468) [-599.091] (-605.453) * (-606.054) (-609.866) (-613.602) [-607.270] -- 0:00:41
583500 -- (-602.767) (-608.119) (-599.622) [-610.172] * (-601.889) [-608.373] (-610.580) (-605.107) -- 0:00:41
584000 -- (-599.624) (-606.879) (-600.627) [-606.626] * [-599.172] (-604.255) (-605.807) (-604.938) -- 0:00:41
584500 -- (-606.365) (-608.354) (-610.196) [-605.373] * (-601.338) [-599.462] (-607.672) (-597.852) -- 0:00:41
585000 -- (-605.440) (-605.962) (-606.624) [-605.202] * (-607.596) (-607.145) (-613.607) [-609.135] -- 0:00:41
Average standard deviation of split frequencies: 0.010742
585500 -- [-598.988] (-606.780) (-607.226) (-604.362) * (-615.691) (-607.001) (-601.804) [-602.034] -- 0:00:41
586000 -- (-606.738) (-600.811) (-604.462) [-604.962] * (-603.253) (-607.949) (-609.667) [-600.735] -- 0:00:41
586500 -- (-603.668) [-602.527] (-619.646) (-614.599) * (-604.075) (-606.631) (-606.835) [-608.874] -- 0:00:41
587000 -- (-610.002) (-600.493) (-612.476) [-598.650] * [-604.165] (-606.591) (-603.362) (-601.173) -- 0:00:41
587500 -- (-603.313) (-600.493) (-600.303) [-607.638] * [-599.540] (-605.715) (-609.452) (-601.337) -- 0:00:41
588000 -- [-604.698] (-610.484) (-605.585) (-605.720) * (-604.792) (-605.874) [-600.727] (-601.335) -- 0:00:41
588500 -- (-608.111) [-598.881] (-609.815) (-613.244) * (-605.665) (-606.442) [-599.436] (-607.736) -- 0:00:41
589000 -- (-603.578) (-601.473) [-608.627] (-604.640) * (-601.070) [-598.815] (-605.594) (-600.862) -- 0:00:41
589500 -- (-609.792) (-602.126) [-606.757] (-608.505) * (-606.341) (-608.019) (-601.855) [-598.506] -- 0:00:41
590000 -- (-604.835) [-598.404] (-608.450) (-608.362) * (-606.174) (-610.466) (-603.154) [-602.476] -- 0:00:41
Average standard deviation of split frequencies: 0.010469
590500 -- (-606.852) [-599.443] (-603.927) (-610.237) * (-607.417) (-603.923) (-604.464) [-603.939] -- 0:00:40
591000 -- (-611.945) (-608.900) [-603.661] (-604.361) * (-612.564) (-607.056) [-601.500] (-605.065) -- 0:00:40
591500 -- (-602.757) (-609.814) (-607.032) [-598.939] * (-608.621) (-604.690) (-603.709) [-600.647] -- 0:00:40
592000 -- (-600.675) [-605.188] (-602.868) (-613.531) * (-610.441) (-603.503) (-606.089) [-599.151] -- 0:00:40
592500 -- (-603.004) (-604.457) (-601.850) [-600.488] * (-609.358) (-604.437) [-602.032] (-606.351) -- 0:00:40
593000 -- (-610.591) (-606.730) [-609.142] (-602.476) * (-605.957) [-601.192] (-611.225) (-614.420) -- 0:00:40
593500 -- (-614.930) [-603.722] (-608.497) (-609.583) * [-601.459] (-608.722) (-611.593) (-609.788) -- 0:00:40
594000 -- [-600.359] (-607.154) (-606.124) (-607.807) * (-608.302) (-603.938) [-608.870] (-611.828) -- 0:00:40
594500 -- [-603.384] (-608.463) (-601.447) (-606.928) * (-605.036) (-607.498) (-604.873) [-603.801] -- 0:00:40
595000 -- (-603.377) (-606.254) [-604.929] (-616.194) * [-604.333] (-602.041) (-604.215) (-603.579) -- 0:00:40
Average standard deviation of split frequencies: 0.010189
595500 -- (-605.440) [-602.650] (-605.982) (-606.984) * (-603.360) [-601.124] (-602.709) (-605.727) -- 0:00:40
596000 -- (-604.098) [-604.063] (-599.170) (-605.448) * (-599.559) (-613.968) (-607.221) [-607.825] -- 0:00:40
596500 -- [-601.003] (-605.427) (-607.182) (-605.980) * [-603.849] (-610.155) (-600.407) (-610.931) -- 0:00:40
597000 -- (-601.971) (-620.135) (-611.822) [-599.566] * (-602.545) [-610.803] (-604.794) (-610.712) -- 0:00:40
597500 -- [-606.264] (-604.131) (-605.625) (-610.090) * (-609.557) (-602.002) (-603.850) [-608.533] -- 0:00:40
598000 -- (-608.000) (-603.963) [-600.418] (-616.181) * [-601.738] (-605.717) (-606.320) (-600.795) -- 0:00:40
598500 -- (-607.198) [-610.431] (-604.387) (-605.364) * (-605.991) (-605.568) (-610.572) [-602.167] -- 0:00:40
599000 -- (-605.925) (-608.018) (-609.903) [-605.935] * [-601.585] (-609.840) (-608.355) (-602.547) -- 0:00:40
599500 -- (-615.446) (-601.702) [-604.198] (-603.302) * (-603.223) [-601.544] (-607.048) (-599.303) -- 0:00:40
600000 -- (-610.819) (-602.920) (-606.273) [-604.276] * (-609.910) (-610.743) [-607.413] (-605.868) -- 0:00:40
Average standard deviation of split frequencies: 0.009925
600500 -- [-604.196] (-611.102) (-610.590) (-608.265) * (-607.192) (-603.243) (-604.777) [-601.865] -- 0:00:39
601000 -- (-606.952) (-605.417) [-605.715] (-611.832) * (-599.184) (-603.458) (-607.145) [-600.275] -- 0:00:39
601500 -- (-611.253) (-601.239) (-604.056) [-604.093] * (-602.729) (-601.161) (-608.489) [-597.214] -- 0:00:39
602000 -- (-605.917) [-600.351] (-613.753) (-599.478) * (-606.029) (-603.042) (-602.177) [-599.453] -- 0:00:39
602500 -- [-602.766] (-601.355) (-609.819) (-606.464) * (-606.881) (-609.674) [-603.906] (-612.237) -- 0:00:39
603000 -- (-608.708) (-609.903) [-610.032] (-597.830) * [-602.257] (-604.148) (-612.026) (-615.272) -- 0:00:39
603500 -- [-604.629] (-609.873) (-607.423) (-605.907) * (-608.536) [-603.121] (-602.833) (-608.390) -- 0:00:39
604000 -- [-606.763] (-601.540) (-605.263) (-599.843) * [-606.096] (-610.392) (-603.006) (-609.346) -- 0:00:39
604500 -- (-606.195) (-599.420) (-605.024) [-604.067] * (-601.340) [-609.451] (-608.067) (-606.578) -- 0:00:39
605000 -- (-607.473) (-600.754) (-604.931) [-606.161] * (-606.328) (-606.757) (-601.023) [-606.276] -- 0:00:39
Average standard deviation of split frequencies: 0.010387
605500 -- (-609.419) (-601.751) [-606.823] (-608.025) * (-600.619) (-603.599) [-603.231] (-599.733) -- 0:00:39
606000 -- (-603.980) (-605.725) [-600.193] (-601.193) * (-606.294) [-611.434] (-604.907) (-601.761) -- 0:00:39
606500 -- (-607.957) (-605.844) (-604.078) [-604.922] * [-605.462] (-605.354) (-604.238) (-603.997) -- 0:00:39
607000 -- (-607.692) (-607.767) [-603.476] (-609.601) * [-606.435] (-612.562) (-604.054) (-607.889) -- 0:00:39
607500 -- (-607.302) [-608.822] (-602.383) (-613.356) * (-604.471) (-606.671) [-599.949] (-605.513) -- 0:00:39
608000 -- (-601.710) [-601.107] (-609.289) (-605.789) * [-608.884] (-604.354) (-603.951) (-604.953) -- 0:00:39
608500 -- (-606.170) [-605.878] (-610.223) (-605.942) * (-610.227) (-605.886) [-605.291] (-619.524) -- 0:00:39
609000 -- (-607.723) (-608.708) (-606.800) [-604.974] * [-602.635] (-607.141) (-613.655) (-608.143) -- 0:00:39
609500 -- [-607.753] (-607.382) (-608.539) (-604.388) * [-604.316] (-604.520) (-602.551) (-606.082) -- 0:00:39
610000 -- (-605.675) [-602.589] (-606.080) (-607.291) * (-608.635) (-605.412) [-603.695] (-607.594) -- 0:00:39
Average standard deviation of split frequencies: 0.010081
610500 -- (-611.806) (-600.683) [-602.515] (-610.471) * [-598.785] (-599.942) (-611.723) (-601.355) -- 0:00:38
611000 -- (-610.181) (-606.330) (-610.762) [-602.171] * (-600.249) (-603.361) [-599.319] (-611.021) -- 0:00:38
611500 -- (-601.973) [-599.079] (-605.366) (-604.823) * (-604.978) (-600.415) (-603.760) [-601.681] -- 0:00:38
612000 -- [-606.053] (-598.428) (-608.185) (-605.618) * (-611.466) (-603.937) [-602.632] (-606.803) -- 0:00:38
612500 -- (-608.318) [-601.555] (-609.936) (-609.828) * (-604.848) (-612.682) (-602.585) [-606.894] -- 0:00:38
613000 -- (-606.923) (-605.267) (-606.168) [-600.823] * (-610.396) [-605.133] (-603.670) (-605.222) -- 0:00:38
613500 -- (-602.162) (-605.032) [-603.824] (-606.351) * (-604.322) (-603.624) [-598.426] (-605.906) -- 0:00:38
614000 -- (-607.759) [-606.844] (-607.113) (-615.018) * (-601.947) (-601.698) [-601.641] (-604.020) -- 0:00:38
614500 -- (-605.393) (-603.440) (-604.001) [-600.565] * (-604.895) (-602.293) [-601.472] (-610.880) -- 0:00:38
615000 -- (-610.509) (-607.607) [-599.756] (-600.845) * (-610.326) (-604.990) [-601.078] (-608.808) -- 0:00:38
Average standard deviation of split frequencies: 0.009408
615500 -- (-606.307) (-606.564) (-599.176) [-602.859] * (-600.977) (-604.272) (-603.620) [-605.069] -- 0:00:38
616000 -- (-608.596) (-608.315) [-601.879] (-607.888) * (-610.537) [-600.200] (-600.244) (-612.021) -- 0:00:38
616500 -- (-616.223) (-608.340) [-602.422] (-603.865) * (-610.130) [-599.919] (-600.566) (-604.244) -- 0:00:38
617000 -- (-611.923) (-597.988) [-606.495] (-610.899) * (-601.205) (-604.882) [-608.975] (-600.604) -- 0:00:38
617500 -- (-605.492) (-599.520) [-607.628] (-611.765) * (-605.651) (-604.732) (-611.481) [-608.325] -- 0:00:38
618000 -- (-608.701) [-600.234] (-613.492) (-606.281) * (-605.794) [-606.129] (-617.891) (-604.346) -- 0:00:38
618500 -- (-611.167) (-605.739) [-607.355] (-613.102) * (-608.499) [-606.745] (-607.697) (-611.095) -- 0:00:38
619000 -- [-602.668] (-607.556) (-606.961) (-616.923) * (-606.717) (-601.494) (-604.414) [-608.637] -- 0:00:38
619500 -- (-607.632) (-606.041) (-601.325) [-600.332] * (-603.795) (-604.347) [-604.847] (-603.924) -- 0:00:38
620000 -- (-608.779) [-605.459] (-604.072) (-602.613) * (-603.439) [-604.494] (-599.725) (-603.002) -- 0:00:38
Average standard deviation of split frequencies: 0.009159
620500 -- (-609.923) (-609.125) (-608.741) [-608.103] * (-607.574) [-608.385] (-607.867) (-604.296) -- 0:00:37
621000 -- (-606.120) (-614.846) (-603.141) [-603.467] * (-605.529) (-603.654) (-605.620) [-606.485] -- 0:00:37
621500 -- [-606.786] (-615.247) (-606.130) (-605.302) * (-613.922) (-604.524) [-603.166] (-606.468) -- 0:00:37
622000 -- [-605.128] (-607.585) (-609.281) (-612.637) * (-608.953) (-601.485) (-615.168) [-609.128] -- 0:00:37
622500 -- (-605.585) (-604.353) [-602.383] (-603.909) * (-616.696) (-608.791) [-605.963] (-601.154) -- 0:00:37
623000 -- (-605.240) [-603.390] (-605.381) (-605.173) * [-601.187] (-600.525) (-604.377) (-604.712) -- 0:00:37
623500 -- [-612.965] (-600.832) (-601.348) (-609.870) * (-604.242) (-604.191) (-608.690) [-599.786] -- 0:00:37
624000 -- (-603.547) (-606.552) [-597.232] (-598.871) * (-603.792) (-601.684) (-600.711) [-599.629] -- 0:00:37
624500 -- (-607.555) [-602.313] (-599.658) (-616.038) * (-611.992) (-604.999) (-607.382) [-604.603] -- 0:00:37
625000 -- [-608.491] (-611.717) (-609.165) (-605.521) * [-601.767] (-607.616) (-612.763) (-607.333) -- 0:00:37
Average standard deviation of split frequencies: 0.009169
625500 -- (-610.691) [-601.125] (-605.013) (-603.691) * (-602.020) (-602.929) (-612.201) [-608.045] -- 0:00:37
626000 -- (-613.284) (-611.704) (-610.258) [-602.000] * (-602.906) (-604.057) [-604.514] (-599.004) -- 0:00:37
626500 -- (-601.165) [-602.561] (-609.214) (-607.707) * (-614.670) [-602.108] (-601.870) (-609.131) -- 0:00:37
627000 -- (-604.375) (-601.688) (-605.420) [-603.855] * (-606.056) (-608.505) [-613.738] (-614.535) -- 0:00:37
627500 -- (-602.557) (-611.487) [-606.170] (-603.658) * (-608.673) (-602.278) [-603.774] (-610.020) -- 0:00:37
628000 -- [-607.009] (-613.678) (-605.367) (-608.943) * (-602.461) (-608.293) [-600.282] (-604.043) -- 0:00:37
628500 -- [-607.266] (-604.992) (-611.508) (-610.721) * (-598.277) (-604.859) [-608.450] (-616.972) -- 0:00:37
629000 -- (-603.234) (-605.939) [-599.543] (-607.645) * [-602.843] (-601.667) (-604.097) (-601.181) -- 0:00:37
629500 -- (-603.087) (-600.227) (-605.353) [-600.850] * [-602.857] (-601.860) (-606.718) (-598.517) -- 0:00:37
630000 -- (-605.404) (-606.001) [-603.087] (-609.331) * (-604.805) (-610.270) [-605.051] (-603.416) -- 0:00:37
Average standard deviation of split frequencies: 0.009189
630500 -- (-612.628) (-610.868) (-602.961) [-600.681] * (-606.807) (-605.062) (-607.177) [-605.745] -- 0:00:36
631000 -- (-608.196) (-608.072) (-608.044) [-603.600] * (-606.843) [-607.527] (-614.069) (-603.009) -- 0:00:36
631500 -- (-608.822) (-605.685) (-607.408) [-600.167] * (-599.802) (-604.022) [-603.741] (-605.513) -- 0:00:36
632000 -- [-603.072] (-603.086) (-607.053) (-601.915) * [-604.127] (-602.377) (-611.405) (-603.575) -- 0:00:36
632500 -- [-610.841] (-604.368) (-611.377) (-602.960) * (-611.885) (-599.912) [-605.985] (-614.988) -- 0:00:36
633000 -- (-604.840) (-609.172) (-611.364) [-606.555] * (-599.257) (-603.571) (-599.540) [-603.865] -- 0:00:36
633500 -- (-605.855) [-604.444] (-606.520) (-608.791) * (-610.592) [-605.461] (-602.344) (-603.451) -- 0:00:36
634000 -- (-609.596) [-605.004] (-602.970) (-606.554) * (-606.857) (-600.956) (-601.221) [-598.652] -- 0:00:36
634500 -- (-608.540) (-611.333) [-603.211] (-606.631) * (-600.476) (-598.682) [-612.854] (-609.249) -- 0:00:36
635000 -- (-611.217) (-604.227) [-602.792] (-602.718) * (-604.996) (-603.804) (-603.153) [-598.030] -- 0:00:36
Average standard deviation of split frequencies: 0.009112
635500 -- (-605.382) [-597.709] (-606.602) (-599.573) * [-606.411] (-611.798) (-612.411) (-602.701) -- 0:00:36
636000 -- (-604.480) (-604.551) (-611.857) [-604.920] * (-622.268) (-600.530) (-607.018) [-597.454] -- 0:00:36
636500 -- (-606.277) [-604.876] (-603.163) (-606.980) * (-604.706) (-604.368) (-599.454) [-609.075] -- 0:00:35
637000 -- (-601.964) [-604.246] (-603.153) (-598.299) * [-601.626] (-602.058) (-607.093) (-602.512) -- 0:00:36
637500 -- (-604.384) (-604.758) (-610.134) [-597.192] * [-603.636] (-600.071) (-606.257) (-613.374) -- 0:00:36
638000 -- (-602.211) [-608.618] (-599.835) (-607.950) * (-605.827) (-608.859) (-604.930) [-606.559] -- 0:00:36
638500 -- (-613.170) (-604.501) [-601.733] (-603.898) * [-600.426] (-605.741) (-612.968) (-599.751) -- 0:00:36
639000 -- [-610.177] (-604.927) (-607.824) (-611.098) * (-608.874) (-601.871) (-607.963) [-605.138] -- 0:00:36
639500 -- [-602.995] (-603.773) (-610.356) (-608.748) * (-603.032) [-605.203] (-606.286) (-610.181) -- 0:00:36
640000 -- (-601.480) (-603.639) (-610.225) [-602.907] * [-604.842] (-607.617) (-613.583) (-618.434) -- 0:00:36
Average standard deviation of split frequencies: 0.008959
640500 -- (-620.305) (-604.594) [-603.654] (-601.520) * (-602.013) [-607.394] (-606.976) (-603.217) -- 0:00:35
641000 -- (-608.271) [-606.612] (-600.875) (-602.399) * (-611.205) (-608.642) (-603.447) [-603.550] -- 0:00:35
641500 -- (-615.072) [-606.943] (-605.436) (-606.560) * [-601.676] (-608.481) (-606.598) (-603.707) -- 0:00:35
642000 -- (-611.106) (-605.911) [-605.498] (-607.317) * (-601.333) (-602.117) (-605.636) [-603.059] -- 0:00:35
642500 -- (-602.575) [-601.085] (-608.201) (-613.681) * (-607.357) [-604.579] (-607.012) (-604.567) -- 0:00:35
643000 -- [-603.358] (-603.656) (-606.485) (-602.111) * (-618.361) [-603.635] (-601.674) (-606.880) -- 0:00:35
643500 -- [-609.355] (-604.747) (-607.928) (-601.516) * [-600.820] (-603.156) (-601.446) (-605.331) -- 0:00:35
644000 -- (-606.012) (-605.556) (-605.773) [-604.688] * (-604.542) [-601.937] (-614.788) (-608.383) -- 0:00:35
644500 -- (-607.270) (-602.743) (-602.485) [-612.870] * (-606.516) (-608.362) (-614.326) [-608.250] -- 0:00:35
645000 -- (-602.143) (-612.105) (-615.245) [-605.356] * (-608.665) (-605.254) [-603.479] (-604.786) -- 0:00:35
Average standard deviation of split frequencies: 0.008928
645500 -- (-603.708) (-599.158) (-608.013) [-603.453] * (-611.679) (-603.858) [-606.738] (-609.735) -- 0:00:35
646000 -- (-599.644) (-605.465) [-601.077] (-610.694) * (-600.029) [-609.022] (-604.247) (-604.648) -- 0:00:35
646500 -- (-605.734) (-609.259) [-603.833] (-609.804) * (-604.773) (-606.345) (-603.805) [-605.275] -- 0:00:34
647000 -- (-602.911) (-603.494) [-606.105] (-608.565) * (-611.977) (-607.299) [-604.177] (-606.894) -- 0:00:34
647500 -- [-604.733] (-607.341) (-607.576) (-608.459) * (-616.655) [-603.038] (-604.691) (-608.222) -- 0:00:35
648000 -- (-607.687) (-600.409) [-599.932] (-600.906) * (-611.627) (-603.627) [-614.476] (-604.896) -- 0:00:35
648500 -- (-602.808) (-611.158) (-601.886) [-605.425] * (-610.190) [-604.292] (-607.551) (-607.569) -- 0:00:35
649000 -- (-607.916) (-602.513) (-600.438) [-607.360] * (-607.428) (-611.517) (-608.860) [-609.277] -- 0:00:35
649500 -- (-609.571) [-602.915] (-611.001) (-609.744) * (-601.005) [-609.243] (-607.134) (-601.858) -- 0:00:35
650000 -- (-603.001) (-600.790) [-608.580] (-599.042) * (-604.705) (-600.297) (-607.515) [-601.420] -- 0:00:35
Average standard deviation of split frequencies: 0.008609
650500 -- (-605.528) (-606.623) (-603.818) [-602.870] * (-609.133) (-603.890) (-609.403) [-605.406] -- 0:00:34
651000 -- [-603.164] (-610.618) (-607.548) (-610.218) * [-599.521] (-605.173) (-610.571) (-603.581) -- 0:00:34
651500 -- (-611.231) (-601.136) (-602.187) [-606.239] * (-612.655) (-608.237) [-611.596] (-600.781) -- 0:00:34
652000 -- (-617.921) (-602.964) (-608.448) [-606.569] * (-610.511) (-610.471) (-606.331) [-609.812] -- 0:00:34
652500 -- (-603.802) (-604.311) [-609.259] (-608.813) * (-600.746) (-602.705) (-602.609) [-607.257] -- 0:00:34
653000 -- (-609.884) [-604.240] (-607.082) (-609.161) * [-602.514] (-600.980) (-601.173) (-607.451) -- 0:00:34
653500 -- (-613.883) (-601.733) [-609.242] (-611.346) * (-607.241) [-605.927] (-603.651) (-604.128) -- 0:00:34
654000 -- (-608.814) (-608.880) (-611.020) [-603.124] * [-603.256] (-604.337) (-601.776) (-603.470) -- 0:00:34
654500 -- (-606.859) (-607.251) [-606.631] (-607.454) * (-603.697) [-602.484] (-610.820) (-609.293) -- 0:00:34
655000 -- (-604.494) (-608.593) (-606.625) [-605.211] * (-610.654) (-602.226) [-608.641] (-607.787) -- 0:00:34
Average standard deviation of split frequencies: 0.008623
655500 -- (-607.461) (-601.677) (-599.822) [-603.288] * (-603.107) (-601.066) [-603.295] (-603.951) -- 0:00:34
656000 -- (-607.055) (-616.787) (-604.303) [-604.583] * (-616.623) (-597.955) (-601.527) [-604.965] -- 0:00:34
656500 -- (-602.813) (-611.836) (-601.027) [-600.089] * [-602.321] (-600.576) (-611.917) (-605.872) -- 0:00:34
657000 -- [-601.558] (-606.225) (-601.687) (-604.688) * (-601.346) (-612.334) (-600.756) [-602.079] -- 0:00:34
657500 -- [-603.162] (-608.590) (-606.176) (-606.887) * (-601.435) (-603.319) (-604.097) [-606.797] -- 0:00:34
658000 -- (-600.671) [-606.007] (-607.935) (-604.318) * (-606.133) [-602.795] (-606.099) (-603.836) -- 0:00:34
658500 -- (-604.021) [-604.017] (-605.758) (-605.170) * (-604.393) [-603.425] (-605.455) (-602.735) -- 0:00:34
659000 -- (-602.919) (-610.297) (-611.492) [-606.011] * (-598.562) (-613.880) (-614.676) [-605.586] -- 0:00:34
659500 -- [-602.076] (-604.555) (-610.086) (-605.580) * [-606.937] (-606.821) (-606.560) (-614.136) -- 0:00:34
660000 -- [-601.741] (-605.594) (-619.702) (-605.504) * (-604.443) [-605.475] (-598.651) (-599.155) -- 0:00:34
Average standard deviation of split frequencies: 0.008227
660500 -- (-606.611) [-602.754] (-607.758) (-607.614) * (-614.503) [-606.966] (-607.273) (-601.700) -- 0:00:33
661000 -- (-602.109) [-602.210] (-603.262) (-603.987) * [-600.691] (-605.130) (-606.791) (-607.967) -- 0:00:33
661500 -- (-604.620) (-600.938) [-604.752] (-601.234) * [-599.009] (-609.552) (-600.663) (-602.473) -- 0:00:33
662000 -- [-600.402] (-607.091) (-602.291) (-599.830) * [-599.961] (-613.544) (-599.111) (-605.162) -- 0:00:33
662500 -- (-603.386) [-607.517] (-604.627) (-604.008) * (-615.379) [-603.685] (-601.494) (-599.857) -- 0:00:33
663000 -- (-600.249) [-607.860] (-606.507) (-601.874) * (-600.575) (-607.110) [-602.286] (-604.495) -- 0:00:33
663500 -- (-608.494) (-600.959) [-606.483] (-605.950) * (-601.487) (-606.496) [-602.806] (-609.476) -- 0:00:33
664000 -- [-601.275] (-607.224) (-603.371) (-611.075) * (-604.753) (-601.890) [-602.144] (-607.024) -- 0:00:33
664500 -- (-603.071) (-605.922) [-606.291] (-602.151) * (-605.866) [-602.165] (-609.919) (-601.318) -- 0:00:33
665000 -- (-603.875) (-609.358) (-604.928) [-604.570] * (-606.991) [-600.736] (-602.486) (-604.579) -- 0:00:33
Average standard deviation of split frequencies: 0.008244
665500 -- (-606.006) [-606.605] (-604.880) (-599.160) * (-608.512) (-600.849) (-617.687) [-602.541] -- 0:00:33
666000 -- (-607.799) (-604.440) (-608.484) [-603.281] * (-602.044) [-600.755] (-607.790) (-601.800) -- 0:00:33
666500 -- (-609.152) (-610.918) (-601.761) [-604.657] * (-606.521) [-598.006] (-607.019) (-608.133) -- 0:00:33
667000 -- (-607.286) [-605.018] (-609.564) (-605.542) * (-602.747) [-606.217] (-605.155) (-609.538) -- 0:00:33
667500 -- (-608.094) (-609.826) (-610.000) [-603.352] * (-605.178) (-600.499) (-608.461) [-601.469] -- 0:00:33
668000 -- [-605.959] (-607.171) (-602.300) (-603.994) * (-608.591) [-597.838] (-601.541) (-608.601) -- 0:00:33
668500 -- (-609.453) (-608.439) [-601.943] (-610.927) * (-612.169) (-607.581) (-599.536) [-602.983] -- 0:00:33
669000 -- (-611.891) (-606.934) [-607.036] (-606.352) * [-606.668] (-609.606) (-610.023) (-605.127) -- 0:00:33
669500 -- (-601.021) [-604.833] (-607.484) (-611.597) * (-614.255) (-600.181) [-613.246] (-610.535) -- 0:00:33
670000 -- (-604.159) (-606.539) [-600.668] (-607.527) * [-601.823] (-604.379) (-609.198) (-606.887) -- 0:00:33
Average standard deviation of split frequencies: 0.008187
670500 -- [-608.423] (-602.522) (-604.960) (-616.085) * (-600.856) [-603.807] (-605.276) (-606.029) -- 0:00:32
671000 -- (-604.329) (-605.939) [-601.425] (-604.217) * (-601.652) (-603.378) [-598.752] (-602.042) -- 0:00:32
671500 -- [-601.384] (-607.261) (-603.701) (-611.786) * (-601.157) (-605.083) (-614.653) [-603.524] -- 0:00:32
672000 -- (-600.773) [-605.368] (-617.152) (-605.991) * [-601.775] (-603.462) (-611.837) (-604.232) -- 0:00:32
672500 -- [-599.316] (-598.531) (-615.967) (-603.385) * [-604.682] (-605.579) (-607.294) (-600.982) -- 0:00:32
673000 -- (-604.866) (-599.707) [-604.360] (-608.359) * (-609.321) (-603.049) (-607.367) [-607.438] -- 0:00:32
673500 -- (-602.358) [-597.056] (-603.629) (-602.904) * (-608.537) (-605.775) (-605.638) [-603.187] -- 0:00:32
674000 -- (-609.464) (-602.080) (-606.594) [-605.092] * (-602.721) (-609.710) (-609.301) [-610.071] -- 0:00:32
674500 -- (-607.682) [-603.295] (-601.894) (-608.790) * (-599.343) [-602.388] (-603.900) (-608.816) -- 0:00:32
675000 -- [-609.392] (-600.634) (-608.876) (-605.292) * (-605.078) (-614.334) (-604.653) [-601.270] -- 0:00:32
Average standard deviation of split frequencies: 0.008286
675500 -- (-608.108) (-608.581) (-603.499) [-609.036] * (-606.652) (-607.541) [-600.052] (-605.468) -- 0:00:32
676000 -- (-604.114) [-603.232] (-614.650) (-608.429) * (-601.270) [-609.531] (-614.467) (-603.938) -- 0:00:32
676500 -- (-606.274) [-603.799] (-603.283) (-606.656) * [-603.180] (-604.474) (-604.673) (-609.652) -- 0:00:32
677000 -- (-609.152) (-611.521) [-595.594] (-602.570) * (-610.729) [-598.647] (-604.758) (-608.742) -- 0:00:32
677500 -- [-604.555] (-613.050) (-604.203) (-602.119) * (-609.969) (-608.756) [-605.511] (-608.982) -- 0:00:32
678000 -- (-609.579) [-602.493] (-610.235) (-610.495) * (-604.922) (-607.368) (-612.316) [-606.878] -- 0:00:32
678500 -- (-606.290) (-606.102) (-604.835) [-604.579] * (-602.851) [-602.526] (-603.206) (-603.564) -- 0:00:32
679000 -- (-602.234) (-609.318) [-605.921] (-615.024) * [-601.869] (-604.131) (-604.707) (-609.759) -- 0:00:32
679500 -- (-607.996) (-606.693) (-603.492) [-605.304] * [-609.990] (-609.587) (-604.616) (-613.560) -- 0:00:32
680000 -- (-612.716) (-607.616) (-612.619) [-602.528] * (-604.867) [-598.051] (-611.001) (-604.986) -- 0:00:32
Average standard deviation of split frequencies: 0.008189
680500 -- (-610.695) (-607.799) (-604.945) [-610.459] * (-611.811) (-609.569) (-610.470) [-608.905] -- 0:00:31
681000 -- (-601.792) (-612.175) [-604.298] (-612.091) * (-605.764) [-610.089] (-605.471) (-607.530) -- 0:00:31
681500 -- (-608.601) [-607.463] (-604.741) (-606.383) * [-601.380] (-599.962) (-611.410) (-607.814) -- 0:00:31
682000 -- (-603.932) [-601.358] (-605.124) (-609.160) * (-605.513) [-604.390] (-608.500) (-603.859) -- 0:00:31
682500 -- (-609.381) (-603.917) (-604.059) [-610.420] * (-602.059) (-608.036) [-605.111] (-611.355) -- 0:00:31
683000 -- (-609.753) (-602.796) (-602.335) [-607.510] * [-603.408] (-616.488) (-603.797) (-605.621) -- 0:00:32
683500 -- [-601.864] (-610.324) (-612.289) (-610.097) * [-605.749] (-606.252) (-607.492) (-612.468) -- 0:00:31
684000 -- [-602.703] (-604.827) (-603.162) (-611.000) * (-596.675) [-609.899] (-604.426) (-612.221) -- 0:00:31
684500 -- (-605.696) (-606.597) (-610.780) [-608.802] * (-603.247) (-603.391) (-611.439) [-603.105] -- 0:00:31
685000 -- (-603.983) (-611.463) (-603.614) [-603.272] * (-611.813) (-611.102) [-601.267] (-606.004) -- 0:00:31
Average standard deviation of split frequencies: 0.008529
685500 -- (-607.413) [-598.975] (-603.519) (-608.044) * (-610.380) (-607.646) [-605.482] (-609.012) -- 0:00:31
686000 -- [-602.555] (-604.201) (-603.714) (-607.474) * (-601.433) [-606.303] (-608.344) (-607.958) -- 0:00:31
686500 -- (-610.461) (-610.289) [-610.200] (-603.835) * [-599.937] (-602.495) (-602.959) (-608.759) -- 0:00:31
687000 -- (-603.406) (-607.466) [-609.915] (-604.614) * (-605.843) (-599.253) [-607.015] (-609.120) -- 0:00:31
687500 -- (-601.742) (-615.013) [-598.906] (-604.342) * (-607.937) (-606.591) [-604.735] (-608.012) -- 0:00:31
688000 -- (-608.735) (-611.230) [-605.914] (-606.705) * [-610.709] (-609.781) (-612.533) (-604.734) -- 0:00:31
688500 -- (-610.297) (-601.210) [-605.416] (-613.619) * (-606.604) [-597.471] (-615.205) (-601.125) -- 0:00:31
689000 -- (-605.619) (-601.518) (-607.176) [-605.871] * (-609.504) [-606.365] (-611.546) (-605.893) -- 0:00:31
689500 -- (-608.617) (-602.627) (-603.848) [-602.383] * (-607.339) (-606.447) [-610.807] (-603.977) -- 0:00:31
690000 -- (-602.192) (-605.501) (-604.977) [-602.782] * (-600.962) (-601.191) (-612.977) [-601.133] -- 0:00:31
Average standard deviation of split frequencies: 0.008552
690500 -- (-598.237) [-610.399] (-615.436) (-609.348) * (-608.407) [-601.178] (-599.319) (-603.914) -- 0:00:30
691000 -- (-606.974) (-609.587) [-603.433] (-608.229) * (-598.816) [-600.475] (-597.498) (-608.941) -- 0:00:30
691500 -- (-601.010) (-607.537) [-604.135] (-613.796) * (-598.808) [-598.515] (-606.390) (-613.457) -- 0:00:30
692000 -- (-605.620) (-608.093) [-604.019] (-607.159) * [-602.166] (-606.272) (-602.315) (-611.649) -- 0:00:30
692500 -- (-602.262) (-611.903) [-603.294] (-604.203) * (-606.050) [-603.110] (-609.760) (-608.886) -- 0:00:30
693000 -- [-599.791] (-609.867) (-612.099) (-603.457) * [-610.580] (-601.839) (-608.255) (-613.062) -- 0:00:31
693500 -- (-608.532) [-598.393] (-608.667) (-609.774) * [-599.757] (-603.865) (-615.173) (-603.315) -- 0:00:30
694000 -- (-607.081) (-612.959) [-606.909] (-606.230) * (-600.976) (-608.285) [-598.269] (-603.618) -- 0:00:30
694500 -- (-602.032) (-605.174) (-598.879) [-600.746] * (-603.242) [-604.511] (-607.246) (-609.150) -- 0:00:30
695000 -- (-604.477) [-609.638] (-605.141) (-607.445) * [-601.464] (-607.828) (-599.327) (-613.941) -- 0:00:30
Average standard deviation of split frequencies: 0.008367
695500 -- (-608.087) (-616.725) (-602.407) [-608.451] * (-614.777) (-601.805) (-608.551) [-602.300] -- 0:00:30
696000 -- (-605.126) (-607.236) (-608.601) [-607.645] * (-606.311) (-608.636) [-599.937] (-601.971) -- 0:00:30
696500 -- (-613.156) (-610.898) (-606.610) [-606.573] * (-610.136) [-608.314] (-607.203) (-607.472) -- 0:00:30
697000 -- (-613.493) (-606.530) [-607.944] (-602.700) * (-614.980) (-601.534) [-597.433] (-604.318) -- 0:00:30
697500 -- (-613.912) (-603.016) [-602.252] (-614.186) * [-603.679] (-608.441) (-606.264) (-608.493) -- 0:00:30
698000 -- (-602.634) (-607.655) [-605.804] (-600.257) * (-608.017) (-603.733) (-611.185) [-607.521] -- 0:00:30
698500 -- (-602.678) (-604.135) [-609.283] (-607.709) * (-610.013) (-609.199) [-602.864] (-601.811) -- 0:00:30
699000 -- (-608.174) (-601.865) [-603.301] (-606.949) * (-610.124) [-604.091] (-608.090) (-607.080) -- 0:00:30
699500 -- [-603.260] (-605.083) (-608.804) (-613.368) * (-604.411) [-602.254] (-603.743) (-602.939) -- 0:00:30
700000 -- [-605.207] (-607.924) (-610.434) (-608.034) * (-603.301) [-603.762] (-603.973) (-607.231) -- 0:00:30
Average standard deviation of split frequencies: 0.008430
700500 -- (-604.430) (-606.343) (-608.227) [-603.126] * [-601.392] (-612.746) (-608.343) (-607.237) -- 0:00:29
701000 -- (-605.920) [-603.726] (-600.701) (-609.112) * [-605.706] (-602.846) (-607.100) (-602.335) -- 0:00:29
701500 -- [-602.599] (-612.681) (-601.703) (-603.164) * (-604.735) (-609.289) (-600.975) [-606.959] -- 0:00:29
702000 -- (-601.388) (-609.513) [-603.678] (-607.819) * (-615.410) (-611.540) [-604.869] (-609.681) -- 0:00:29
702500 -- (-618.834) [-604.929] (-611.916) (-606.030) * [-606.054] (-604.872) (-614.216) (-609.811) -- 0:00:29
703000 -- [-606.396] (-599.092) (-606.502) (-604.270) * (-607.972) [-604.095] (-602.959) (-605.348) -- 0:00:29
703500 -- (-607.687) (-613.757) [-599.389] (-606.807) * (-603.808) [-604.258] (-600.455) (-604.495) -- 0:00:29
704000 -- (-606.584) [-607.800] (-604.733) (-602.583) * (-610.328) (-604.390) (-602.873) [-601.227] -- 0:00:29
704500 -- (-613.149) (-606.476) (-609.869) [-602.813] * [-602.027] (-609.524) (-602.636) (-604.384) -- 0:00:29
705000 -- (-606.190) (-614.574) (-604.368) [-604.811] * (-603.216) [-609.771] (-605.989) (-602.375) -- 0:00:29
Average standard deviation of split frequencies: 0.008641
705500 -- [-602.997] (-605.181) (-599.160) (-605.199) * (-605.031) (-604.921) (-609.823) [-607.476] -- 0:00:29
706000 -- [-606.684] (-606.286) (-611.595) (-601.096) * (-599.835) (-605.474) [-601.404] (-607.888) -- 0:00:29
706500 -- (-609.083) (-603.663) (-603.777) [-607.905] * (-598.871) (-614.425) [-608.322] (-602.997) -- 0:00:29
707000 -- (-605.946) (-600.023) [-603.172] (-607.476) * (-608.862) [-608.888] (-605.328) (-601.889) -- 0:00:29
707500 -- (-607.021) [-599.284] (-606.493) (-605.517) * (-608.304) [-605.322] (-613.875) (-605.813) -- 0:00:29
708000 -- [-602.679] (-611.591) (-608.630) (-607.830) * (-602.574) (-607.508) (-611.189) [-606.010] -- 0:00:29
708500 -- (-606.185) [-604.862] (-606.592) (-620.163) * (-606.292) (-612.277) (-604.437) [-595.992] -- 0:00:29
709000 -- [-603.650] (-604.018) (-600.603) (-613.249) * (-602.658) [-599.132] (-612.609) (-605.971) -- 0:00:29
709500 -- (-607.136) (-603.516) (-607.604) [-610.969] * (-604.333) [-600.410] (-621.605) (-615.683) -- 0:00:29
710000 -- [-603.298] (-606.018) (-605.481) (-605.569) * (-597.883) (-601.024) [-606.682] (-610.951) -- 0:00:29
Average standard deviation of split frequencies: 0.008857
710500 -- (-612.576) [-600.514] (-603.295) (-604.456) * [-604.620] (-603.718) (-603.155) (-611.871) -- 0:00:28
711000 -- (-609.902) (-601.540) [-602.604] (-604.463) * (-606.698) [-606.780] (-605.748) (-613.497) -- 0:00:28
711500 -- [-607.079] (-608.973) (-605.504) (-606.896) * (-604.712) (-600.213) [-602.278] (-606.641) -- 0:00:28
712000 -- (-608.230) (-604.845) (-610.738) [-603.739] * [-603.751] (-608.230) (-606.494) (-601.121) -- 0:00:28
712500 -- (-603.408) (-605.550) (-607.739) [-604.116] * (-600.085) [-600.356] (-608.628) (-608.675) -- 0:00:28
713000 -- (-599.440) (-607.592) (-603.484) [-603.237] * (-605.479) (-614.626) [-600.709] (-604.878) -- 0:00:28
713500 -- (-608.395) [-600.872] (-605.735) (-602.040) * (-607.601) (-604.259) [-602.111] (-612.987) -- 0:00:28
714000 -- (-605.111) (-614.837) (-608.827) [-599.126] * (-610.252) [-604.490] (-605.553) (-607.334) -- 0:00:28
714500 -- (-605.417) [-603.520] (-606.531) (-601.444) * (-604.551) (-602.297) [-604.029] (-605.419) -- 0:00:28
715000 -- (-603.520) (-604.663) (-608.319) [-600.245] * [-599.719] (-603.217) (-603.914) (-611.551) -- 0:00:28
Average standard deviation of split frequencies: 0.008791
715500 -- (-597.824) (-610.811) (-610.081) [-601.495] * (-602.055) (-601.588) [-606.907] (-604.381) -- 0:00:28
716000 -- (-607.862) (-607.504) (-606.066) [-599.277] * (-610.816) [-601.763] (-607.408) (-607.039) -- 0:00:28
716500 -- (-601.747) (-602.815) (-606.490) [-605.490] * (-613.091) (-607.644) [-606.697] (-605.715) -- 0:00:28
717000 -- [-599.449] (-605.479) (-611.089) (-602.627) * (-613.761) [-607.935] (-603.079) (-611.233) -- 0:00:28
717500 -- (-613.391) (-606.759) (-608.224) [-606.017] * (-607.331) (-606.911) (-604.096) [-605.942] -- 0:00:28
718000 -- (-603.069) (-606.802) (-603.930) [-606.329] * [-604.989] (-601.460) (-603.012) (-604.214) -- 0:00:28
718500 -- [-603.997] (-609.780) (-600.196) (-601.552) * [-605.621] (-605.134) (-606.713) (-608.902) -- 0:00:28
719000 -- (-605.265) (-602.122) [-600.319] (-610.120) * (-604.930) (-615.833) [-608.634] (-605.720) -- 0:00:28
719500 -- (-602.262) [-603.270] (-606.621) (-601.212) * (-600.646) (-609.261) (-608.416) [-601.540] -- 0:00:28
720000 -- (-612.904) (-607.839) (-605.468) [-603.926] * (-603.441) (-615.924) [-605.135] (-611.366) -- 0:00:28
Average standard deviation of split frequencies: 0.008542
720500 -- [-604.302] (-600.619) (-609.878) (-611.936) * (-605.024) (-610.545) [-607.596] (-603.623) -- 0:00:27
721000 -- (-603.091) (-605.120) (-611.315) [-605.522] * [-604.604] (-603.312) (-606.768) (-600.030) -- 0:00:27
721500 -- (-604.218) [-602.095] (-599.958) (-600.337) * (-612.071) (-603.867) (-605.627) [-611.004] -- 0:00:27
722000 -- [-610.158] (-608.555) (-599.800) (-604.978) * (-604.337) (-603.734) [-611.682] (-604.495) -- 0:00:27
722500 -- [-601.892] (-604.798) (-606.609) (-608.770) * [-598.029] (-603.872) (-602.298) (-606.947) -- 0:00:27
723000 -- (-606.579) [-605.499] (-602.293) (-614.150) * [-613.764] (-611.727) (-607.509) (-607.807) -- 0:00:27
723500 -- (-604.138) (-603.665) (-608.237) [-604.108] * (-603.928) (-607.319) (-604.658) [-600.617] -- 0:00:27
724000 -- (-606.411) (-602.268) [-605.579] (-604.253) * (-607.442) [-604.902] (-614.269) (-605.558) -- 0:00:27
724500 -- (-604.424) [-605.567] (-609.699) (-608.459) * (-613.640) (-610.992) [-602.513] (-600.096) -- 0:00:27
725000 -- (-601.057) [-607.866] (-609.173) (-604.342) * (-600.319) (-604.459) [-607.639] (-606.198) -- 0:00:27
Average standard deviation of split frequencies: 0.008556
725500 -- (-608.955) [-610.064] (-604.085) (-601.615) * (-599.729) (-605.928) [-604.270] (-606.610) -- 0:00:27
726000 -- (-606.164) (-622.882) (-602.604) [-600.943] * (-608.128) (-607.278) (-603.562) [-601.728] -- 0:00:27
726500 -- (-608.793) (-604.494) (-607.765) [-601.951] * (-607.438) (-603.735) (-606.333) [-604.117] -- 0:00:27
727000 -- (-601.209) (-604.987) [-601.134] (-603.514) * (-606.350) [-608.554] (-604.429) (-619.258) -- 0:00:27
727500 -- (-604.444) (-606.870) [-599.696] (-606.451) * (-602.749) (-598.371) [-602.226] (-604.834) -- 0:00:27
728000 -- (-604.219) (-601.102) [-600.281] (-600.907) * [-607.148] (-606.042) (-614.821) (-605.549) -- 0:00:27
728500 -- (-609.776) (-603.117) (-609.224) [-606.249] * (-602.721) (-613.575) [-603.245] (-611.591) -- 0:00:27
729000 -- (-603.261) (-607.639) (-603.418) [-602.206] * (-602.539) (-601.425) (-610.513) [-602.275] -- 0:00:27
729500 -- (-608.135) [-611.276] (-611.371) (-603.800) * (-599.094) (-608.726) [-603.670] (-609.524) -- 0:00:27
730000 -- (-600.535) (-608.900) (-611.128) [-603.173] * [-607.415] (-604.595) (-610.751) (-609.679) -- 0:00:27
Average standard deviation of split frequencies: 0.008729
730500 -- (-603.531) (-606.284) (-605.099) [-602.569] * (-603.805) [-597.279] (-614.835) (-600.602) -- 0:00:26
731000 -- (-604.689) (-605.435) [-610.003] (-610.009) * (-608.598) [-605.081] (-608.599) (-601.567) -- 0:00:26
731500 -- (-603.419) (-608.552) (-611.421) [-600.998] * (-612.686) (-604.510) (-603.298) [-605.682] -- 0:00:26
732000 -- [-609.492] (-608.310) (-610.825) (-608.070) * (-605.819) (-603.067) [-603.454] (-604.361) -- 0:00:26
732500 -- (-604.008) (-616.935) (-601.982) [-606.235] * (-607.255) [-602.774] (-608.988) (-605.491) -- 0:00:26
733000 -- (-605.242) (-601.577) (-607.280) [-607.464] * (-613.090) (-605.337) [-604.630] (-606.120) -- 0:00:26
733500 -- (-608.711) [-602.587] (-605.956) (-611.291) * (-606.690) [-601.434] (-605.176) (-605.553) -- 0:00:26
734000 -- (-604.449) (-600.351) [-602.707] (-603.142) * [-600.072] (-601.831) (-604.937) (-608.105) -- 0:00:26
734500 -- (-609.821) (-601.523) (-604.106) [-603.760] * (-605.913) [-602.173] (-604.121) (-602.878) -- 0:00:26
735000 -- (-608.306) [-606.412] (-605.666) (-609.098) * (-608.371) (-604.189) [-601.762] (-609.592) -- 0:00:26
Average standard deviation of split frequencies: 0.008741
735500 -- (-605.211) (-601.870) [-600.667] (-614.350) * (-599.240) (-605.314) (-605.543) [-603.501] -- 0:00:26
736000 -- [-608.994] (-599.409) (-605.534) (-607.953) * (-605.695) (-602.812) [-604.970] (-600.344) -- 0:00:26
736500 -- (-598.972) (-603.199) (-611.232) [-604.148] * [-609.009] (-606.104) (-611.504) (-602.009) -- 0:00:26
737000 -- (-604.392) (-602.644) (-608.026) [-606.267] * (-604.347) (-598.942) (-602.281) [-602.170] -- 0:00:26
737500 -- (-610.735) (-609.661) [-607.746] (-600.629) * (-600.894) (-601.376) (-602.710) [-607.506] -- 0:00:26
738000 -- [-602.120] (-606.719) (-601.759) (-608.200) * (-606.441) [-605.408] (-603.489) (-604.212) -- 0:00:26
738500 -- (-598.677) (-606.649) (-603.325) [-597.631] * (-600.801) (-618.267) (-613.317) [-601.736] -- 0:00:26
739000 -- (-603.951) (-610.600) [-598.894] (-602.695) * (-604.917) (-610.785) (-608.420) [-605.718] -- 0:00:26
739500 -- (-607.993) [-603.009] (-606.681) (-603.087) * (-605.373) (-603.746) (-608.904) [-601.194] -- 0:00:26
740000 -- (-609.174) (-606.228) (-608.101) [-608.190] * (-597.424) (-614.368) [-602.453] (-609.526) -- 0:00:26
Average standard deviation of split frequencies: 0.009023
740500 -- [-605.669] (-610.447) (-611.567) (-607.232) * (-598.477) (-611.054) [-605.027] (-610.193) -- 0:00:25
741000 -- (-606.349) (-605.020) (-600.492) [-602.995] * (-604.497) (-609.448) [-608.687] (-602.750) -- 0:00:25
741500 -- [-607.370] (-606.244) (-616.752) (-611.965) * (-612.048) (-611.149) [-600.549] (-607.557) -- 0:00:25
742000 -- (-608.656) (-601.361) (-606.080) [-598.015] * (-601.777) [-604.128] (-612.085) (-608.888) -- 0:00:25
742500 -- (-607.502) (-606.351) (-604.875) [-602.400] * (-606.287) [-609.870] (-610.773) (-613.751) -- 0:00:25
743000 -- (-605.831) (-608.651) [-609.753] (-609.044) * (-601.702) (-605.534) [-603.078] (-615.420) -- 0:00:25
743500 -- (-600.959) (-603.926) (-605.255) [-602.470] * [-602.576] (-609.865) (-604.917) (-607.028) -- 0:00:25
744000 -- (-605.161) (-601.667) (-603.772) [-602.388] * [-597.003] (-602.693) (-611.129) (-603.375) -- 0:00:25
744500 -- (-607.792) (-604.285) (-611.799) [-601.219] * (-609.317) [-605.012] (-611.834) (-605.307) -- 0:00:25
745000 -- (-604.935) [-598.647] (-613.981) (-606.558) * [-603.850] (-610.507) (-606.050) (-607.164) -- 0:00:25
Average standard deviation of split frequencies: 0.009033
745500 -- (-608.173) (-597.648) [-604.529] (-615.308) * (-601.962) (-602.427) [-601.888] (-613.089) -- 0:00:25
746000 -- (-602.300) (-605.809) (-610.893) [-600.430] * (-605.066) (-606.725) (-601.920) [-602.241] -- 0:00:25
746500 -- (-607.449) (-607.223) [-602.605] (-605.711) * [-605.037] (-608.252) (-604.298) (-607.375) -- 0:00:25
747000 -- (-604.726) (-602.905) (-602.405) [-602.631] * (-606.359) (-603.097) [-602.900] (-609.883) -- 0:00:25
747500 -- (-601.151) (-608.674) [-600.915] (-607.119) * [-603.255] (-602.942) (-602.365) (-599.330) -- 0:00:25
748000 -- (-604.967) (-609.831) [-603.559] (-609.962) * (-604.957) [-605.650] (-606.101) (-607.384) -- 0:00:25
748500 -- (-611.216) [-602.095] (-599.698) (-606.940) * [-601.550] (-611.480) (-605.785) (-602.356) -- 0:00:25
749000 -- [-602.698] (-605.989) (-603.478) (-604.041) * (-607.280) (-612.841) (-601.390) [-602.408] -- 0:00:25
749500 -- [-609.870] (-615.288) (-609.786) (-608.980) * (-602.807) (-610.866) [-600.648] (-605.221) -- 0:00:25
750000 -- (-606.570) [-606.499] (-603.544) (-603.507) * (-604.683) [-603.782] (-601.621) (-602.586) -- 0:00:25
Average standard deviation of split frequencies: 0.009309
750500 -- (-605.232) (-606.287) (-602.347) [-602.177] * (-608.700) (-604.827) (-607.957) [-603.838] -- 0:00:24
751000 -- (-605.777) [-599.666] (-604.747) (-601.947) * (-599.246) [-608.834] (-604.560) (-617.462) -- 0:00:24
751500 -- (-606.808) (-602.934) (-602.415) [-603.510] * [-602.131] (-613.724) (-602.680) (-604.367) -- 0:00:24
752000 -- (-607.063) (-611.346) [-606.446] (-600.229) * (-604.961) (-609.345) [-603.954] (-608.618) -- 0:00:24
752500 -- (-603.818) [-604.020] (-602.243) (-602.844) * (-614.265) (-612.608) [-605.445] (-602.196) -- 0:00:24
753000 -- [-605.124] (-609.162) (-606.313) (-600.052) * (-601.840) (-601.323) [-604.375] (-603.841) -- 0:00:24
753500 -- [-603.810] (-609.223) (-604.471) (-609.382) * (-611.063) [-603.274] (-603.470) (-603.350) -- 0:00:24
754000 -- (-602.799) (-604.817) (-611.047) [-614.422] * [-612.029] (-606.828) (-606.488) (-603.084) -- 0:00:24
754500 -- (-610.534) (-603.565) [-609.352] (-607.348) * (-611.644) (-606.560) (-602.526) [-598.987] -- 0:00:24
755000 -- (-608.415) (-601.027) (-615.509) [-602.258] * (-599.634) (-602.599) [-603.959] (-603.257) -- 0:00:24
Average standard deviation of split frequencies: 0.009626
755500 -- (-603.094) (-605.035) [-603.708] (-607.573) * (-603.785) [-605.226] (-613.538) (-612.675) -- 0:00:24
756000 -- (-605.289) [-600.949] (-613.032) (-607.527) * [-603.153] (-605.640) (-609.541) (-605.057) -- 0:00:24
756500 -- (-604.802) [-607.707] (-609.547) (-610.251) * (-609.528) [-600.126] (-603.547) (-609.043) -- 0:00:24
757000 -- (-602.714) (-600.982) (-603.102) [-605.400] * (-602.796) (-611.069) [-604.103] (-609.827) -- 0:00:24
757500 -- (-600.909) (-613.174) [-607.269] (-604.944) * [-601.581] (-602.796) (-605.836) (-605.402) -- 0:00:24
758000 -- [-602.344] (-617.955) (-606.244) (-603.538) * [-603.764] (-601.992) (-609.275) (-606.806) -- 0:00:24
758500 -- (-608.047) [-602.856] (-606.471) (-599.954) * (-608.515) [-601.664] (-606.823) (-600.706) -- 0:00:24
759000 -- (-612.690) (-600.458) (-606.703) [-599.355] * (-606.885) (-604.996) [-605.109] (-609.400) -- 0:00:24
759500 -- (-611.427) [-598.602] (-603.542) (-605.078) * (-607.591) (-606.665) [-609.278] (-608.780) -- 0:00:24
760000 -- [-600.446] (-601.759) (-605.564) (-606.952) * [-599.062] (-605.715) (-607.801) (-603.640) -- 0:00:24
Average standard deviation of split frequencies: 0.009412
760500 -- (-599.872) [-599.260] (-604.912) (-606.093) * (-605.392) (-601.819) [-602.520] (-611.630) -- 0:00:23
761000 -- [-606.406] (-604.660) (-606.792) (-603.924) * (-602.939) (-604.145) [-600.829] (-607.909) -- 0:00:23
761500 -- (-603.820) (-603.672) [-614.515] (-605.007) * (-610.015) (-605.628) (-602.458) [-603.154] -- 0:00:23
762000 -- [-598.763] (-608.017) (-610.350) (-601.755) * (-611.688) (-606.375) [-607.962] (-602.947) -- 0:00:23
762500 -- (-601.641) [-605.851] (-624.304) (-603.918) * (-601.851) [-600.194] (-608.844) (-606.510) -- 0:00:23
763000 -- (-609.725) (-606.691) [-605.970] (-603.998) * [-607.105] (-604.021) (-608.814) (-604.805) -- 0:00:23
763500 -- [-605.905] (-604.999) (-609.512) (-607.961) * (-602.628) (-607.783) [-601.644] (-609.365) -- 0:00:23
764000 -- (-609.156) [-610.165] (-604.264) (-601.470) * [-601.253] (-602.282) (-604.594) (-603.276) -- 0:00:23
764500 -- [-602.215] (-605.693) (-607.501) (-603.411) * (-609.013) (-605.703) [-605.359] (-605.187) -- 0:00:23
765000 -- (-603.714) (-604.980) (-603.831) [-600.415] * (-614.176) [-603.284] (-610.204) (-602.452) -- 0:00:23
Average standard deviation of split frequencies: 0.009847
765500 -- (-607.537) (-605.839) (-604.365) [-606.209] * (-610.294) (-605.058) [-612.281] (-603.179) -- 0:00:23
766000 -- [-605.036] (-603.986) (-604.601) (-607.415) * (-606.275) [-600.547] (-605.702) (-606.145) -- 0:00:23
766500 -- (-609.085) (-606.497) (-603.189) [-602.908] * (-603.218) [-599.555] (-611.343) (-608.893) -- 0:00:23
767000 -- (-609.701) (-606.228) (-607.993) [-602.935] * (-603.482) (-613.371) (-601.068) [-603.451] -- 0:00:23
767500 -- (-600.464) (-610.142) (-601.283) [-603.314] * (-608.256) [-601.329] (-610.265) (-602.814) -- 0:00:23
768000 -- (-603.167) [-604.232] (-607.010) (-610.851) * [-596.827] (-608.969) (-606.032) (-609.438) -- 0:00:23
768500 -- (-607.487) [-600.607] (-605.100) (-605.059) * (-608.822) (-618.301) (-607.608) [-608.531] -- 0:00:23
769000 -- (-602.239) [-610.514] (-606.188) (-604.753) * (-613.292) (-610.520) (-615.709) [-599.577] -- 0:00:23
769500 -- (-601.608) (-609.041) [-602.231] (-603.223) * [-605.237] (-606.131) (-611.478) (-602.901) -- 0:00:23
770000 -- (-604.162) (-609.538) (-618.824) [-604.542] * (-602.632) [-602.277] (-612.660) (-601.707) -- 0:00:23
Average standard deviation of split frequencies: 0.009967
770500 -- (-605.386) [-604.042] (-607.640) (-604.253) * (-607.737) [-599.309] (-602.770) (-600.957) -- 0:00:22
771000 -- (-605.637) (-596.824) (-608.849) [-602.932] * [-604.219] (-602.890) (-605.246) (-601.996) -- 0:00:22
771500 -- (-600.897) (-605.404) (-614.615) [-602.526] * (-604.602) (-602.545) [-599.706] (-608.702) -- 0:00:22
772000 -- (-605.958) [-597.643] (-612.165) (-603.130) * (-608.146) [-605.015] (-607.506) (-604.093) -- 0:00:22
772500 -- [-604.717] (-607.084) (-605.114) (-609.265) * [-599.386] (-602.690) (-611.916) (-605.600) -- 0:00:22
773000 -- (-610.558) (-607.869) (-603.322) [-608.717] * (-602.678) (-602.393) [-605.999] (-609.317) -- 0:00:22
773500 -- (-612.582) (-603.620) [-602.236] (-607.269) * (-608.468) [-601.135] (-599.937) (-605.378) -- 0:00:22
774000 -- [-600.030] (-601.787) (-607.472) (-611.222) * (-610.874) (-609.363) (-601.661) [-601.938] -- 0:00:22
774500 -- [-608.447] (-614.075) (-607.230) (-606.056) * (-615.374) (-613.178) [-600.071] (-602.584) -- 0:00:22
775000 -- (-604.234) (-608.774) [-601.795] (-604.943) * [-598.789] (-622.373) (-602.866) (-611.505) -- 0:00:22
Average standard deviation of split frequencies: 0.009568
775500 -- (-605.952) [-607.528] (-610.789) (-602.905) * (-605.172) [-600.792] (-610.950) (-609.296) -- 0:00:22
776000 -- (-604.244) (-605.238) (-614.224) [-608.958] * [-602.791] (-606.334) (-609.364) (-616.551) -- 0:00:22
776500 -- (-600.670) (-604.468) (-604.083) [-599.408] * (-604.692) (-605.312) [-602.602] (-604.428) -- 0:00:22
777000 -- (-608.956) [-605.711] (-611.090) (-602.043) * (-608.302) (-608.847) (-602.628) [-605.952] -- 0:00:22
777500 -- (-613.997) (-608.554) [-606.215] (-602.684) * [-606.506] (-604.737) (-601.394) (-602.685) -- 0:00:22
778000 -- (-607.610) (-603.781) (-606.418) [-602.958] * (-606.040) [-605.238] (-602.314) (-605.920) -- 0:00:22
778500 -- (-604.391) [-605.947] (-603.936) (-614.371) * (-606.252) (-600.945) (-603.900) [-601.231] -- 0:00:22
779000 -- [-605.592] (-610.986) (-616.530) (-604.304) * (-602.675) (-603.840) (-607.234) [-599.957] -- 0:00:22
779500 -- [-610.259] (-599.928) (-608.689) (-602.101) * (-612.120) [-606.414] (-597.397) (-601.452) -- 0:00:22
780000 -- (-609.783) (-613.993) [-601.669] (-605.168) * (-611.856) (-599.079) (-606.425) [-609.600] -- 0:00:22
Average standard deviation of split frequencies: 0.009586
780500 -- [-603.732] (-611.504) (-604.372) (-608.465) * (-611.464) (-609.222) (-604.878) [-596.791] -- 0:00:21
781000 -- [-602.519] (-611.594) (-602.122) (-613.858) * (-605.766) [-600.694] (-600.602) (-602.017) -- 0:00:21
781500 -- (-607.576) (-613.576) [-599.124] (-611.452) * (-604.902) [-600.549] (-605.862) (-604.597) -- 0:00:21
782000 -- (-606.389) (-608.474) (-609.531) [-605.522] * (-604.109) (-602.600) (-607.132) [-606.988] -- 0:00:21
782500 -- [-606.750] (-612.213) (-608.854) (-612.500) * [-600.420] (-605.679) (-610.642) (-599.998) -- 0:00:21
783000 -- [-603.245] (-602.861) (-614.467) (-605.274) * (-608.117) (-601.958) (-603.831) [-609.249] -- 0:00:21
783500 -- (-611.128) (-610.076) [-601.531] (-602.780) * (-607.438) (-605.711) [-601.280] (-608.548) -- 0:00:21
784000 -- (-612.017) [-603.168] (-607.788) (-606.542) * (-601.601) (-607.551) (-609.458) [-604.216] -- 0:00:21
784500 -- (-610.648) [-604.735] (-612.110) (-597.367) * (-609.755) [-603.066] (-601.934) (-603.990) -- 0:00:21
785000 -- (-604.401) [-605.425] (-606.286) (-608.349) * [-605.370] (-602.625) (-601.991) (-599.445) -- 0:00:21
Average standard deviation of split frequencies: 0.009559
785500 -- [-604.728] (-604.014) (-606.933) (-614.826) * (-600.862) [-599.905] (-605.453) (-605.155) -- 0:00:21
786000 -- [-604.267] (-614.113) (-606.029) (-613.019) * (-609.756) (-607.241) [-604.098] (-600.854) -- 0:00:21
786500 -- (-610.982) (-604.178) (-603.033) [-603.639] * [-602.276] (-607.216) (-603.788) (-615.940) -- 0:00:21
787000 -- (-605.234) (-606.278) [-606.185] (-607.338) * (-609.454) (-608.003) (-599.249) [-600.721] -- 0:00:21
787500 -- (-600.324) (-601.691) [-606.832] (-605.899) * (-608.019) (-602.867) [-601.091] (-611.279) -- 0:00:21
788000 -- (-602.962) (-608.941) [-604.334] (-619.787) * (-599.345) (-606.836) [-601.192] (-613.339) -- 0:00:21
788500 -- [-600.567] (-607.083) (-604.095) (-601.766) * (-601.623) [-602.805] (-605.777) (-606.946) -- 0:00:21
789000 -- (-612.193) (-607.485) (-611.263) [-604.242] * (-611.403) (-622.040) (-602.674) [-602.815] -- 0:00:21
789500 -- (-607.929) (-618.329) [-610.846] (-609.503) * (-602.433) (-607.049) (-599.476) [-609.367] -- 0:00:21
790000 -- (-603.678) [-610.404] (-601.834) (-601.888) * [-605.744] (-609.505) (-607.526) (-599.276) -- 0:00:21
Average standard deviation of split frequencies: 0.009129
790500 -- (-610.726) [-603.206] (-608.111) (-604.686) * (-605.583) [-604.889] (-607.507) (-605.770) -- 0:00:20
791000 -- (-610.245) (-600.083) (-605.637) [-601.455] * [-602.512] (-600.564) (-606.513) (-604.251) -- 0:00:20
791500 -- (-613.094) (-608.365) [-606.906] (-605.230) * (-613.133) [-606.894] (-606.898) (-603.262) -- 0:00:20
792000 -- (-608.001) [-604.965] (-608.169) (-614.754) * (-623.627) [-600.793] (-599.773) (-608.778) -- 0:00:20
792500 -- (-607.637) (-605.958) (-616.319) [-604.501] * (-616.031) (-603.008) [-600.238] (-603.813) -- 0:00:20
793000 -- (-604.119) (-602.044) [-601.439] (-609.139) * (-612.296) (-604.345) (-611.252) [-600.971] -- 0:00:20
793500 -- (-601.482) [-600.522] (-605.331) (-602.292) * (-620.276) (-604.701) [-604.446] (-607.059) -- 0:00:20
794000 -- (-607.791) (-608.810) [-605.540] (-609.314) * (-600.760) (-603.075) (-609.469) [-608.990] -- 0:00:20
794500 -- [-600.620] (-602.415) (-608.855) (-605.147) * [-605.697] (-605.636) (-603.705) (-607.566) -- 0:00:20
795000 -- (-606.290) (-607.604) (-605.498) [-607.023] * (-606.575) [-600.400] (-611.212) (-604.956) -- 0:00:20
Average standard deviation of split frequencies: 0.009327
795500 -- (-611.737) [-599.327] (-600.760) (-601.950) * (-604.148) (-602.523) (-611.483) [-603.617] -- 0:00:20
796000 -- (-612.278) [-601.638] (-602.460) (-620.470) * (-602.925) (-605.415) [-608.628] (-605.833) -- 0:00:20
796500 -- [-606.110] (-603.736) (-615.604) (-605.838) * (-607.467) (-605.184) (-604.158) [-601.687] -- 0:00:20
797000 -- (-597.739) (-605.398) [-604.492] (-604.630) * (-609.063) [-601.235] (-615.128) (-604.009) -- 0:00:20
797500 -- (-603.175) [-602.692] (-609.281) (-606.081) * (-602.687) (-606.935) [-606.683] (-614.662) -- 0:00:20
798000 -- [-604.111] (-605.234) (-616.679) (-604.298) * (-617.499) (-606.960) (-602.059) [-603.835] -- 0:00:20
798500 -- (-616.021) (-607.878) [-607.511] (-606.135) * (-607.122) (-605.616) (-600.677) [-602.120] -- 0:00:20
799000 -- [-607.444] (-603.351) (-608.430) (-618.456) * (-614.126) [-605.996] (-606.641) (-616.738) -- 0:00:20
799500 -- [-600.795] (-605.310) (-608.944) (-604.249) * [-601.461] (-613.010) (-604.663) (-604.082) -- 0:00:20
800000 -- (-609.288) (-602.804) [-603.968] (-628.331) * [-607.533] (-616.874) (-605.620) (-607.081) -- 0:00:20
Average standard deviation of split frequencies: 0.009347
800500 -- (-600.297) (-608.289) [-608.996] (-609.986) * (-605.780) [-600.235] (-605.137) (-601.205) -- 0:00:19
801000 -- (-602.970) (-613.449) (-612.435) [-606.335] * [-606.859] (-609.812) (-607.763) (-603.342) -- 0:00:19
801500 -- (-610.319) (-606.214) (-605.786) [-604.581] * (-601.599) (-610.886) [-601.949] (-607.187) -- 0:00:19
802000 -- (-604.739) (-607.449) [-605.456] (-603.073) * (-611.899) (-606.493) (-604.626) [-602.504] -- 0:00:19
802500 -- (-613.393) (-608.385) [-600.498] (-607.656) * (-601.827) (-607.032) (-606.848) [-607.129] -- 0:00:19
803000 -- (-607.265) [-605.449] (-606.334) (-608.850) * [-606.360] (-618.121) (-606.031) (-603.520) -- 0:00:19
803500 -- (-604.601) (-607.189) (-605.912) [-606.423] * (-612.054) (-607.807) [-598.845] (-610.135) -- 0:00:19
804000 -- (-603.977) [-604.696] (-607.889) (-606.604) * (-618.170) (-605.816) [-609.884] (-615.165) -- 0:00:19
804500 -- (-604.096) (-610.659) [-607.485] (-607.262) * [-605.171] (-607.704) (-606.291) (-600.617) -- 0:00:19
805000 -- [-601.748] (-612.151) (-601.096) (-605.673) * (-600.627) (-604.904) (-609.035) [-599.699] -- 0:00:19
Average standard deviation of split frequencies: 0.009943
805500 -- [-607.188] (-601.791) (-601.348) (-604.756) * (-599.484) (-608.612) (-613.472) [-601.933] -- 0:00:19
806000 -- (-609.647) (-614.802) (-606.317) [-603.261] * (-606.713) (-608.350) (-605.803) [-603.571] -- 0:00:19
806500 -- (-604.317) (-610.245) [-603.061] (-604.122) * [-604.040] (-609.736) (-606.672) (-600.665) -- 0:00:19
807000 -- (-596.649) (-603.173) (-612.218) [-604.237] * (-607.705) (-607.521) (-607.104) [-599.299] -- 0:00:19
807500 -- [-604.178] (-614.448) (-607.057) (-604.190) * (-607.825) (-601.592) (-610.119) [-601.126] -- 0:00:19
808000 -- (-604.009) [-603.107] (-606.021) (-601.831) * (-602.536) (-601.719) (-607.017) [-606.695] -- 0:00:19
808500 -- (-604.478) (-602.936) [-601.473] (-605.709) * (-611.097) [-602.300] (-614.236) (-607.169) -- 0:00:19
809000 -- (-607.336) (-603.058) (-602.440) [-604.843] * (-604.509) (-619.897) [-607.932] (-617.110) -- 0:00:19
809500 -- (-603.948) (-609.056) [-604.159] (-610.767) * (-605.794) (-602.341) (-613.425) [-605.098] -- 0:00:19
810000 -- [-601.718] (-613.830) (-604.478) (-603.076) * (-610.496) (-611.682) (-601.415) [-602.801] -- 0:00:19
Average standard deviation of split frequencies: 0.009595
810500 -- (-604.335) (-608.541) (-610.137) [-607.157] * [-601.327] (-605.928) (-612.743) (-612.235) -- 0:00:18
811000 -- (-613.393) (-603.298) (-612.524) [-603.897] * [-603.234] (-608.003) (-609.314) (-598.845) -- 0:00:18
811500 -- (-604.823) [-605.136] (-608.793) (-620.113) * (-605.290) (-608.476) (-607.420) [-603.258] -- 0:00:18
812000 -- [-601.623] (-609.508) (-599.945) (-604.800) * (-607.625) [-605.726] (-603.288) (-606.848) -- 0:00:18
812500 -- [-611.190] (-606.096) (-599.749) (-603.219) * (-604.149) [-608.948] (-601.925) (-602.161) -- 0:00:18
813000 -- [-605.306] (-607.663) (-605.276) (-605.065) * (-605.744) (-607.566) (-604.332) [-602.144] -- 0:00:18
813500 -- [-605.946] (-606.278) (-611.732) (-602.995) * (-603.770) (-603.952) [-604.795] (-609.802) -- 0:00:18
814000 -- [-605.655] (-604.869) (-602.040) (-605.681) * (-598.276) (-605.011) (-606.605) [-603.857] -- 0:00:18
814500 -- (-604.008) (-608.425) [-605.672] (-617.394) * (-605.107) (-609.056) [-602.523] (-608.035) -- 0:00:18
815000 -- [-604.028] (-607.442) (-605.900) (-623.472) * (-605.752) [-602.660] (-615.093) (-613.878) -- 0:00:18
Average standard deviation of split frequencies: 0.009604
815500 -- (-605.061) [-605.145] (-602.647) (-604.396) * [-602.997] (-608.000) (-614.557) (-618.894) -- 0:00:18
816000 -- [-607.508] (-611.083) (-603.859) (-610.485) * (-603.460) [-599.750] (-604.152) (-599.354) -- 0:00:18
816500 -- (-604.929) (-614.406) [-610.017] (-605.737) * (-618.138) (-606.488) [-604.018] (-606.010) -- 0:00:18
817000 -- (-603.337) [-606.133] (-613.032) (-603.493) * (-610.232) (-599.177) (-618.226) [-602.849] -- 0:00:18
817500 -- (-603.333) [-606.303] (-601.411) (-615.425) * (-608.130) (-603.746) (-602.481) [-603.916] -- 0:00:18
818000 -- (-602.217) (-610.397) [-600.050] (-605.081) * [-607.824] (-605.156) (-603.421) (-612.996) -- 0:00:18
818500 -- [-602.751] (-607.345) (-605.616) (-604.812) * (-598.315) [-605.918] (-605.815) (-603.180) -- 0:00:18
819000 -- [-607.567] (-599.168) (-604.983) (-611.166) * (-604.850) [-599.853] (-612.859) (-601.789) -- 0:00:18
819500 -- [-601.112] (-604.269) (-603.730) (-612.397) * [-607.023] (-607.205) (-609.607) (-606.918) -- 0:00:18
820000 -- [-607.717] (-608.910) (-603.176) (-602.890) * (-605.697) [-606.933] (-604.743) (-601.769) -- 0:00:18
Average standard deviation of split frequencies: 0.009801
820500 -- (-602.033) [-602.199] (-611.218) (-607.104) * (-606.993) (-603.279) [-608.745] (-604.458) -- 0:00:17
821000 -- [-605.127] (-606.972) (-609.326) (-606.739) * [-609.413] (-605.878) (-603.172) (-604.384) -- 0:00:17
821500 -- (-607.135) (-603.172) (-610.264) [-596.508] * (-606.210) (-608.983) (-610.937) [-602.221] -- 0:00:17
822000 -- (-599.472) (-603.582) (-603.663) [-607.990] * [-604.858] (-605.089) (-616.215) (-601.956) -- 0:00:17
822500 -- [-602.446] (-598.509) (-609.513) (-604.908) * (-608.798) (-598.049) (-603.251) [-603.449] -- 0:00:17
823000 -- [-603.799] (-605.380) (-602.367) (-612.948) * (-605.928) (-602.837) [-609.944] (-606.827) -- 0:00:17
823500 -- (-605.993) [-600.068] (-615.687) (-607.758) * [-610.531] (-602.836) (-613.211) (-606.591) -- 0:00:17
824000 -- (-605.210) (-611.116) (-608.133) [-599.918] * (-605.495) [-601.698] (-615.093) (-617.762) -- 0:00:17
824500 -- (-612.391) (-601.847) [-602.991] (-623.906) * (-603.390) (-608.192) (-608.708) [-610.107] -- 0:00:17
825000 -- [-609.020] (-607.118) (-608.667) (-610.219) * [-604.022] (-599.602) (-611.207) (-610.631) -- 0:00:17
Average standard deviation of split frequencies: 0.009809
825500 -- (-611.725) (-605.212) [-602.696] (-607.807) * (-606.472) [-606.216] (-603.644) (-605.965) -- 0:00:17
826000 -- (-608.482) [-602.798] (-606.603) (-611.440) * [-602.201] (-606.972) (-610.184) (-598.871) -- 0:00:17
826500 -- [-603.992] (-604.260) (-601.609) (-605.184) * (-607.203) (-611.893) (-609.311) [-601.833] -- 0:00:17
827000 -- (-605.353) [-607.658] (-607.901) (-601.958) * (-604.744) (-606.397) [-607.815] (-607.884) -- 0:00:17
827500 -- (-602.478) (-604.577) (-608.809) [-601.571] * [-603.596] (-612.967) (-613.893) (-607.634) -- 0:00:17
828000 -- (-605.911) (-611.939) [-601.142] (-603.202) * [-605.655] (-608.116) (-604.530) (-599.848) -- 0:00:17
828500 -- (-604.967) (-609.224) [-603.537] (-604.880) * (-607.033) (-611.663) (-613.601) [-604.256] -- 0:00:17
829000 -- [-609.710] (-608.092) (-604.768) (-606.307) * (-600.360) (-612.242) [-604.651] (-602.324) -- 0:00:17
829500 -- (-607.323) (-609.149) [-608.931] (-600.008) * (-602.437) [-605.741] (-601.331) (-599.570) -- 0:00:17
830000 -- (-615.939) (-601.488) [-604.098] (-603.133) * (-610.602) (-603.322) [-607.590] (-604.479) -- 0:00:17
Average standard deviation of split frequencies: 0.009541
830500 -- [-603.812] (-600.303) (-611.749) (-602.582) * [-605.063] (-602.718) (-609.916) (-599.208) -- 0:00:16
831000 -- (-600.187) [-606.024] (-603.901) (-605.675) * (-609.123) [-599.275] (-612.780) (-611.613) -- 0:00:16
831500 -- (-607.178) (-614.237) (-613.261) [-604.964] * (-610.644) (-599.716) [-603.018] (-608.015) -- 0:00:16
832000 -- (-600.262) [-607.015] (-609.463) (-602.448) * (-607.975) [-610.772] (-604.265) (-602.328) -- 0:00:16
832500 -- (-617.584) [-602.861] (-604.739) (-602.176) * (-606.838) (-606.057) (-607.331) [-601.231] -- 0:00:16
833000 -- (-607.327) [-602.497] (-614.142) (-609.413) * [-605.071] (-608.604) (-604.806) (-609.403) -- 0:00:16
833500 -- (-610.606) [-609.121] (-609.203) (-608.741) * (-606.507) [-605.940] (-606.312) (-610.355) -- 0:00:16
834000 -- (-603.895) [-608.114] (-604.371) (-608.125) * [-609.218] (-605.354) (-608.115) (-599.860) -- 0:00:16
834500 -- (-603.882) (-605.239) [-604.203] (-604.667) * [-601.646] (-606.192) (-607.801) (-611.365) -- 0:00:16
835000 -- [-601.474] (-598.618) (-611.440) (-618.519) * (-606.448) [-602.158] (-612.195) (-607.764) -- 0:00:16
Average standard deviation of split frequencies: 0.009198
835500 -- (-606.909) (-600.597) [-602.995] (-603.761) * (-605.177) [-604.113] (-604.770) (-608.700) -- 0:00:16
836000 -- (-607.642) [-603.774] (-613.649) (-600.333) * (-607.161) [-603.978] (-603.637) (-604.640) -- 0:00:16
836500 -- (-604.427) [-600.640] (-607.818) (-605.431) * (-609.534) (-601.653) [-602.365] (-608.434) -- 0:00:16
837000 -- [-603.108] (-610.832) (-603.553) (-605.443) * (-607.778) (-602.213) (-601.590) [-602.106] -- 0:00:16
837500 -- (-606.161) (-604.395) [-601.394] (-600.765) * (-614.051) (-603.238) (-615.581) [-602.838] -- 0:00:16
838000 -- [-601.456] (-622.418) (-605.153) (-605.861) * [-604.354] (-600.182) (-604.268) (-602.170) -- 0:00:16
838500 -- [-601.896] (-604.976) (-603.820) (-606.588) * (-604.194) (-600.547) (-605.420) [-602.450] -- 0:00:16
839000 -- [-598.798] (-604.045) (-607.388) (-607.498) * (-617.923) (-605.343) (-599.586) [-604.919] -- 0:00:16
839500 -- (-613.241) [-598.105] (-608.402) (-609.833) * (-601.421) (-600.912) (-599.797) [-603.281] -- 0:00:16
840000 -- (-606.368) [-602.425] (-605.297) (-609.025) * (-609.977) [-604.465] (-601.445) (-602.398) -- 0:00:16
Average standard deviation of split frequencies: 0.009287
840500 -- (-609.883) (-604.158) (-600.951) [-606.012] * (-608.502) (-600.872) [-604.270] (-604.592) -- 0:00:15
841000 -- (-600.374) (-601.556) [-608.030] (-605.352) * (-601.868) (-608.174) [-604.892] (-601.311) -- 0:00:15
841500 -- (-605.476) (-601.122) [-602.486] (-607.638) * (-611.148) (-603.940) (-603.051) [-602.801] -- 0:00:15
842000 -- (-604.683) (-614.793) [-599.245] (-604.768) * (-613.253) [-606.095] (-603.092) (-615.952) -- 0:00:15
842500 -- [-601.624] (-600.078) (-601.924) (-610.906) * (-612.958) [-604.217] (-602.248) (-605.076) -- 0:00:15
843000 -- [-601.730] (-616.896) (-602.692) (-604.536) * (-606.069) (-601.434) (-605.945) [-600.997] -- 0:00:15
843500 -- [-600.138] (-609.354) (-608.197) (-600.705) * (-607.485) (-602.817) (-605.731) [-598.647] -- 0:00:15
844000 -- (-610.025) (-604.346) (-603.627) [-602.634] * (-604.401) (-601.530) (-614.868) [-605.381] -- 0:00:15
844500 -- (-602.661) (-606.802) [-600.582] (-604.939) * (-599.834) (-602.855) (-609.191) [-604.435] -- 0:00:15
845000 -- (-610.484) (-609.166) [-602.469] (-609.495) * (-598.731) (-609.607) [-599.787] (-602.735) -- 0:00:15
Average standard deviation of split frequencies: 0.009333
845500 -- (-606.009) (-608.829) [-605.783] (-607.745) * (-608.069) (-607.433) [-602.558] (-606.591) -- 0:00:15
846000 -- (-603.556) (-602.839) [-604.844] (-608.695) * (-599.979) (-606.029) (-602.401) [-602.117] -- 0:00:15
846500 -- (-604.176) [-603.121] (-605.154) (-604.815) * [-609.663] (-613.054) (-598.943) (-603.885) -- 0:00:15
847000 -- [-605.992] (-607.673) (-607.789) (-609.934) * (-600.517) (-606.129) (-607.742) [-602.668] -- 0:00:15
847500 -- [-604.756] (-604.713) (-607.634) (-614.784) * [-603.548] (-608.546) (-607.866) (-602.303) -- 0:00:15
848000 -- (-604.826) [-606.156] (-614.506) (-609.640) * [-602.184] (-605.104) (-604.002) (-615.275) -- 0:00:15
848500 -- (-601.329) (-602.738) [-604.717] (-615.790) * (-606.849) (-599.784) [-604.282] (-603.996) -- 0:00:15
849000 -- [-597.035] (-607.903) (-606.752) (-604.862) * [-602.056] (-601.898) (-609.672) (-609.715) -- 0:00:15
849500 -- (-603.805) [-602.945] (-606.287) (-606.245) * (-601.562) (-606.443) [-603.569] (-601.806) -- 0:00:15
850000 -- (-607.878) (-604.298) [-603.764] (-601.523) * [-600.598] (-606.151) (-603.075) (-604.543) -- 0:00:15
Average standard deviation of split frequencies: 0.009351
850500 -- (-612.297) (-609.413) (-610.717) [-601.422] * (-605.168) [-598.954] (-613.347) (-603.518) -- 0:00:14
851000 -- (-604.920) [-603.508] (-601.381) (-609.983) * (-603.133) (-604.861) (-608.253) [-604.088] -- 0:00:14
851500 -- [-607.310] (-606.815) (-609.770) (-606.801) * (-611.389) [-600.463] (-604.150) (-611.201) -- 0:00:14
852000 -- (-607.854) (-600.546) (-610.375) [-611.240] * (-607.184) [-600.962] (-612.524) (-602.542) -- 0:00:14
852500 -- (-608.535) (-604.565) (-606.892) [-607.545] * [-600.496] (-609.199) (-607.666) (-599.885) -- 0:00:14
853000 -- (-597.505) [-610.985] (-605.510) (-611.897) * (-607.506) (-606.302) [-609.809] (-613.779) -- 0:00:14
853500 -- (-601.156) [-602.091] (-602.568) (-611.270) * (-611.914) [-601.224] (-602.160) (-614.330) -- 0:00:14
854000 -- (-605.093) [-598.630] (-611.001) (-607.128) * (-611.465) (-605.156) [-602.662] (-603.888) -- 0:00:14
854500 -- [-603.923] (-611.273) (-609.552) (-604.743) * [-605.164] (-602.268) (-607.494) (-602.369) -- 0:00:14
855000 -- (-602.248) (-604.231) [-602.376] (-604.529) * (-601.399) (-603.136) (-611.187) [-605.585] -- 0:00:14
Average standard deviation of split frequencies: 0.008880
855500 -- (-601.663) (-604.895) (-607.021) [-606.301] * (-614.596) (-601.961) (-609.757) [-600.265] -- 0:00:14
856000 -- (-603.166) (-611.254) (-604.282) [-601.200] * (-606.463) [-603.842] (-606.130) (-604.550) -- 0:00:14
856500 -- [-602.888] (-608.690) (-610.132) (-606.990) * (-603.131) [-601.506] (-600.324) (-607.290) -- 0:00:14
857000 -- (-613.650) [-603.296] (-603.559) (-605.910) * (-598.447) [-602.809] (-608.408) (-600.592) -- 0:00:14
857500 -- [-609.776] (-606.087) (-608.937) (-610.214) * (-606.906) (-606.230) [-606.374] (-606.048) -- 0:00:14
858000 -- (-611.056) [-603.442] (-605.326) (-604.608) * (-609.240) (-601.474) [-600.542] (-603.489) -- 0:00:14
858500 -- (-605.826) (-601.412) (-605.884) [-602.722] * [-604.589] (-602.993) (-606.911) (-608.386) -- 0:00:14
859000 -- (-603.906) (-609.600) [-608.383] (-608.651) * (-607.275) (-604.025) [-609.670] (-607.758) -- 0:00:14
859500 -- (-603.640) (-604.674) [-603.037] (-607.176) * [-601.877] (-607.171) (-599.761) (-608.797) -- 0:00:14
860000 -- [-597.445] (-607.325) (-602.894) (-610.410) * (-604.022) [-608.290] (-602.471) (-605.444) -- 0:00:14
Average standard deviation of split frequencies: 0.008832
860500 -- (-610.186) (-614.155) (-610.230) [-600.321] * (-607.831) [-604.087] (-602.892) (-604.577) -- 0:00:13
861000 -- [-606.219] (-605.152) (-606.518) (-606.681) * (-615.498) (-609.853) (-610.976) [-609.891] -- 0:00:13
861500 -- (-609.368) (-604.579) (-605.727) [-608.532] * [-603.655] (-605.380) (-607.166) (-609.169) -- 0:00:13
862000 -- (-606.021) [-603.784] (-601.824) (-607.654) * (-609.514) (-601.346) (-604.365) [-604.216] -- 0:00:13
862500 -- (-610.277) (-605.709) [-610.454] (-617.515) * [-611.938] (-602.622) (-604.187) (-608.822) -- 0:00:13
863000 -- (-605.079) (-602.990) (-613.217) [-599.454] * (-604.969) [-603.447] (-603.983) (-607.626) -- 0:00:13
863500 -- (-610.806) (-607.554) [-603.183] (-600.390) * (-607.708) (-601.097) (-607.672) [-606.530] -- 0:00:13
864000 -- (-603.438) (-609.574) (-607.693) [-601.006] * [-606.351] (-606.441) (-607.007) (-603.971) -- 0:00:13
864500 -- (-600.637) [-600.917] (-608.400) (-610.263) * (-604.674) [-599.442] (-607.737) (-611.854) -- 0:00:13
865000 -- (-602.484) (-601.139) (-610.697) [-606.154] * (-618.351) (-600.445) [-604.770] (-606.997) -- 0:00:13
Average standard deviation of split frequencies: 0.008539
865500 -- (-605.493) (-617.113) (-604.718) [-603.074] * [-602.848] (-602.178) (-605.218) (-608.026) -- 0:00:13
866000 -- [-600.480] (-607.473) (-603.109) (-602.584) * (-606.728) (-599.550) (-609.088) [-602.711] -- 0:00:13
866500 -- (-607.865) [-614.489] (-607.187) (-608.342) * (-610.979) (-603.053) [-604.036] (-602.696) -- 0:00:13
867000 -- (-604.217) (-604.993) [-607.987] (-603.040) * (-610.525) (-606.257) [-600.006] (-601.016) -- 0:00:13
867500 -- (-609.081) (-615.692) (-604.820) [-598.472] * [-601.529] (-603.227) (-607.498) (-604.160) -- 0:00:13
868000 -- (-604.901) [-603.850] (-609.087) (-605.708) * (-602.722) (-601.628) (-607.012) [-601.108] -- 0:00:13
868500 -- (-610.274) (-598.646) [-609.676] (-613.580) * (-608.439) (-601.666) [-602.661] (-599.643) -- 0:00:13
869000 -- (-602.322) [-600.741] (-604.663) (-607.032) * [-600.596] (-606.768) (-604.873) (-600.322) -- 0:00:13
869500 -- [-601.271] (-606.909) (-607.025) (-606.790) * [-604.221] (-607.325) (-606.871) (-606.543) -- 0:00:13
870000 -- (-603.053) (-606.946) [-602.687] (-606.956) * (-615.436) [-604.180] (-605.136) (-603.550) -- 0:00:13
Average standard deviation of split frequencies: 0.008663
870500 -- [-604.149] (-603.636) (-602.018) (-606.905) * (-605.622) [-599.750] (-606.422) (-613.356) -- 0:00:12
871000 -- (-606.484) (-604.879) [-602.190] (-606.249) * (-598.419) [-601.254] (-613.212) (-607.027) -- 0:00:12
871500 -- (-609.537) (-603.708) [-600.667] (-602.285) * (-602.791) (-612.749) [-601.102] (-603.334) -- 0:00:12
872000 -- [-607.088] (-611.517) (-604.864) (-604.138) * (-615.348) [-601.656] (-604.735) (-604.496) -- 0:00:12
872500 -- (-609.566) (-610.424) [-600.694] (-608.292) * (-604.148) (-610.465) [-605.377] (-613.230) -- 0:00:12
873000 -- (-616.465) (-604.631) [-604.465] (-609.106) * [-603.683] (-606.095) (-608.620) (-611.241) -- 0:00:12
873500 -- [-605.360] (-604.205) (-605.283) (-614.931) * (-614.780) [-609.911] (-605.059) (-608.708) -- 0:00:12
874000 -- (-612.859) [-600.489] (-602.732) (-608.364) * (-602.837) [-599.769] (-606.682) (-604.079) -- 0:00:12
874500 -- [-602.968] (-603.318) (-600.885) (-614.061) * (-608.412) (-607.847) (-608.073) [-607.666] -- 0:00:12
875000 -- (-604.052) (-603.209) (-605.834) [-603.112] * (-609.496) [-605.483] (-605.903) (-600.373) -- 0:00:12
Average standard deviation of split frequencies: 0.008879
875500 -- (-604.781) (-602.414) [-607.895] (-605.110) * [-604.740] (-599.475) (-605.954) (-603.225) -- 0:00:12
876000 -- (-603.946) (-603.374) [-598.800] (-608.213) * (-606.935) [-601.414] (-606.767) (-601.306) -- 0:00:12
876500 -- (-609.303) [-602.188] (-608.848) (-606.268) * (-602.850) [-603.855] (-603.466) (-608.182) -- 0:00:12
877000 -- [-608.126] (-607.368) (-612.630) (-603.543) * [-602.150] (-606.336) (-613.978) (-600.709) -- 0:00:12
877500 -- [-606.768] (-606.099) (-614.784) (-608.215) * (-603.473) (-604.223) (-608.697) [-601.747] -- 0:00:12
878000 -- (-605.451) [-614.379] (-609.773) (-609.927) * (-602.246) (-607.440) [-607.517] (-609.617) -- 0:00:12
878500 -- (-610.980) (-619.261) [-602.922] (-605.447) * (-613.303) (-602.643) (-611.434) [-603.843] -- 0:00:12
879000 -- (-600.409) (-601.913) [-603.835] (-603.853) * (-606.425) (-611.692) [-599.876] (-603.425) -- 0:00:12
879500 -- (-616.380) (-601.572) (-611.799) [-604.482] * [-605.636] (-617.838) (-607.629) (-611.825) -- 0:00:12
880000 -- [-609.903] (-605.486) (-612.917) (-602.025) * [-597.719] (-601.077) (-604.852) (-602.614) -- 0:00:12
Average standard deviation of split frequencies: 0.008431
880500 -- (-606.941) (-609.330) [-602.665] (-605.237) * (-601.541) [-604.763] (-605.823) (-606.828) -- 0:00:11
881000 -- (-614.846) (-606.200) (-606.873) [-605.064] * (-607.666) (-610.752) (-601.671) [-601.191] -- 0:00:11
881500 -- (-613.002) (-606.816) (-606.437) [-599.280] * (-611.342) (-607.079) (-607.364) [-605.646] -- 0:00:11
882000 -- [-604.325] (-603.621) (-605.768) (-603.504) * (-612.623) (-607.954) [-600.838] (-599.548) -- 0:00:11
882500 -- (-611.038) (-606.789) [-606.080] (-608.478) * (-605.291) (-611.931) [-603.862] (-604.467) -- 0:00:11
883000 -- (-613.099) (-603.205) [-601.445] (-604.213) * (-601.032) (-605.803) [-605.719] (-603.744) -- 0:00:11
883500 -- [-606.907] (-599.887) (-601.777) (-613.308) * (-603.889) (-609.214) (-603.003) [-602.300] -- 0:00:11
884000 -- [-599.779] (-609.134) (-598.051) (-603.965) * [-599.477] (-609.544) (-605.271) (-602.898) -- 0:00:11
884500 -- (-606.641) [-604.149] (-614.899) (-615.164) * [-602.158] (-605.238) (-601.919) (-602.563) -- 0:00:11
885000 -- (-602.647) (-602.792) (-606.901) [-607.073] * (-601.121) [-611.885] (-608.963) (-602.059) -- 0:00:11
Average standard deviation of split frequencies: 0.008247
885500 -- [-604.764] (-606.201) (-601.702) (-605.814) * (-612.937) [-604.099] (-606.791) (-599.903) -- 0:00:11
886000 -- [-603.366] (-615.332) (-601.661) (-603.479) * [-609.409] (-606.732) (-607.327) (-612.793) -- 0:00:11
886500 -- (-600.222) [-603.375] (-607.185) (-612.950) * (-610.256) (-602.021) [-604.999] (-614.094) -- 0:00:11
887000 -- (-602.396) (-608.745) [-607.132] (-604.089) * (-604.774) (-608.820) [-603.366] (-604.905) -- 0:00:11
887500 -- (-603.835) (-609.484) (-604.097) [-601.216] * (-601.250) (-599.907) (-611.768) [-599.999] -- 0:00:11
888000 -- (-605.615) (-603.464) (-601.588) [-604.305] * (-614.958) (-606.565) [-607.310] (-605.101) -- 0:00:11
888500 -- (-617.857) (-610.923) [-605.791] (-608.708) * (-606.628) [-600.927] (-606.277) (-610.448) -- 0:00:11
889000 -- (-605.026) (-609.308) (-608.923) [-606.356] * (-611.334) [-601.795] (-606.546) (-601.219) -- 0:00:11
889500 -- [-601.510] (-604.031) (-612.664) (-611.245) * (-606.818) [-606.103] (-605.207) (-600.089) -- 0:00:11
890000 -- (-606.871) (-605.631) (-601.760) [-604.474] * (-607.911) [-602.522] (-609.410) (-607.085) -- 0:00:11
Average standard deviation of split frequencies: 0.008468
890500 -- [-599.432] (-607.762) (-609.548) (-605.028) * (-604.137) (-597.816) (-607.529) [-606.184] -- 0:00:10
891000 -- (-600.713) [-602.034] (-612.933) (-607.245) * (-605.349) [-603.465] (-616.921) (-605.010) -- 0:00:10
891500 -- (-601.987) [-608.328] (-607.489) (-608.197) * (-607.722) [-601.614] (-607.029) (-609.996) -- 0:00:10
892000 -- [-601.970] (-604.191) (-604.305) (-607.520) * [-601.349] (-614.563) (-608.335) (-608.553) -- 0:00:10
892500 -- (-599.947) (-612.129) [-600.523] (-606.097) * (-606.884) (-607.726) [-599.851] (-612.904) -- 0:00:10
893000 -- (-602.222) (-612.673) (-615.354) [-607.609] * (-603.226) (-613.572) [-608.413] (-607.020) -- 0:00:10
893500 -- (-608.100) (-612.888) (-608.414) [-599.015] * [-602.463] (-606.348) (-606.280) (-610.622) -- 0:00:10
894000 -- (-600.545) (-614.199) [-602.579] (-608.394) * [-601.967] (-605.617) (-607.671) (-611.377) -- 0:00:10
894500 -- (-604.098) (-607.420) [-607.329] (-611.114) * (-603.408) [-605.587] (-607.733) (-601.288) -- 0:00:10
895000 -- (-608.673) (-601.843) (-606.640) [-605.374] * (-607.054) [-600.570] (-609.095) (-610.926) -- 0:00:10
Average standard deviation of split frequencies: 0.008780
895500 -- [-600.484] (-601.353) (-604.678) (-605.417) * (-610.395) (-602.524) [-603.456] (-602.328) -- 0:00:10
896000 -- (-599.102) (-612.452) (-607.890) [-600.065] * [-607.149] (-604.196) (-607.734) (-599.250) -- 0:00:10
896500 -- (-604.134) [-602.486] (-599.716) (-610.102) * (-607.152) (-605.977) (-608.915) [-604.416] -- 0:00:10
897000 -- (-608.710) [-612.816] (-608.683) (-599.425) * (-599.053) [-610.645] (-608.374) (-604.290) -- 0:00:10
897500 -- (-604.676) [-602.647] (-608.090) (-609.377) * (-606.057) (-607.306) [-606.061] (-607.456) -- 0:00:10
898000 -- (-607.523) [-603.170] (-604.367) (-608.954) * (-606.914) [-605.238] (-604.905) (-603.716) -- 0:00:10
898500 -- (-603.615) (-601.174) (-600.330) [-602.951] * (-603.713) [-599.258] (-606.918) (-611.677) -- 0:00:10
899000 -- (-606.935) (-611.873) (-612.532) [-605.926] * (-610.613) (-602.534) (-599.319) [-603.282] -- 0:00:10
899500 -- [-605.221] (-611.667) (-612.368) (-604.408) * (-602.900) (-601.199) [-600.040] (-604.056) -- 0:00:10
900000 -- (-607.451) (-602.982) (-608.688) [-606.431] * (-607.390) [-599.635] (-602.763) (-604.926) -- 0:00:10
Average standard deviation of split frequencies: 0.008440
900500 -- [-606.954] (-602.709) (-610.043) (-604.663) * [-605.963] (-600.822) (-604.617) (-605.859) -- 0:00:09
901000 -- (-608.348) (-612.151) (-608.065) [-597.327] * (-605.547) (-603.937) [-602.461] (-609.998) -- 0:00:09
901500 -- (-602.940) (-617.513) [-604.676] (-606.351) * (-609.331) (-601.249) [-602.243] (-615.388) -- 0:00:09
902000 -- (-599.474) (-619.801) (-598.686) [-602.021] * (-607.386) (-603.645) [-601.154] (-613.539) -- 0:00:09
902500 -- (-607.729) (-607.908) (-602.582) [-600.890] * (-606.372) [-598.749] (-605.061) (-604.515) -- 0:00:09
903000 -- (-606.746) [-602.534] (-604.902) (-606.795) * (-605.694) (-600.055) (-612.854) [-616.098] -- 0:00:09
903500 -- (-610.699) (-609.835) [-599.452] (-601.874) * [-608.998] (-601.669) (-606.102) (-603.178) -- 0:00:09
904000 -- [-605.016] (-606.729) (-608.882) (-606.252) * (-607.232) (-607.765) (-611.606) [-602.654] -- 0:00:09
904500 -- [-607.775] (-605.399) (-611.635) (-606.371) * (-610.127) (-604.138) [-599.879] (-600.960) -- 0:00:09
905000 -- (-606.717) (-604.769) [-601.149] (-611.445) * (-603.549) [-604.899] (-605.165) (-607.523) -- 0:00:09
Average standard deviation of split frequencies: 0.008358
905500 -- (-602.858) (-607.638) (-606.912) [-606.186] * [-602.671] (-608.161) (-607.326) (-605.937) -- 0:00:09
906000 -- [-602.580] (-608.330) (-612.832) (-614.939) * (-609.269) (-603.797) (-605.762) [-602.579] -- 0:00:09
906500 -- (-604.586) [-600.940] (-608.381) (-603.276) * [-607.550] (-597.640) (-605.086) (-608.563) -- 0:00:09
907000 -- (-610.932) [-604.262] (-601.032) (-601.189) * (-605.772) (-600.610) [-599.766] (-608.390) -- 0:00:09
907500 -- (-603.310) [-600.821] (-605.228) (-608.053) * (-602.876) (-605.825) (-600.642) [-602.996] -- 0:00:09
908000 -- (-603.413) [-606.761] (-597.206) (-606.005) * (-611.459) (-600.400) (-609.327) [-602.099] -- 0:00:09
908500 -- [-605.562] (-606.751) (-609.449) (-605.002) * (-605.647) (-603.664) (-605.396) [-604.252] -- 0:00:09
909000 -- [-610.529] (-602.941) (-613.136) (-602.253) * [-607.390] (-610.760) (-605.826) (-604.692) -- 0:00:09
909500 -- (-607.479) [-600.519] (-602.335) (-609.233) * [-613.062] (-604.280) (-610.940) (-609.833) -- 0:00:09
910000 -- (-606.677) [-598.181] (-599.749) (-606.523) * (-605.757) (-606.989) [-605.470] (-605.844) -- 0:00:09
Average standard deviation of split frequencies: 0.008315
910500 -- (-604.732) [-603.811] (-599.295) (-604.667) * (-608.486) [-600.025] (-603.782) (-610.246) -- 0:00:08
911000 -- [-605.187] (-602.498) (-603.308) (-613.498) * (-601.298) [-602.388] (-612.722) (-613.113) -- 0:00:08
911500 -- (-610.396) (-610.072) (-610.356) [-606.654] * (-605.167) [-603.353] (-606.212) (-608.173) -- 0:00:08
912000 -- (-604.540) (-604.387) [-605.101] (-615.519) * (-607.460) [-598.549] (-605.931) (-608.148) -- 0:00:08
912500 -- (-607.295) (-605.956) [-601.317] (-603.826) * (-603.170) [-606.904] (-611.145) (-613.545) -- 0:00:08
913000 -- [-603.592] (-610.375) (-605.205) (-609.744) * [-604.492] (-603.316) (-603.165) (-603.105) -- 0:00:08
913500 -- (-604.546) (-605.664) [-604.718] (-610.594) * (-607.838) [-607.477] (-603.463) (-604.831) -- 0:00:08
914000 -- (-610.462) (-605.906) [-601.462] (-602.769) * (-602.310) (-600.336) [-610.627] (-607.620) -- 0:00:08
914500 -- (-607.983) [-601.148] (-608.179) (-604.402) * (-602.003) (-603.462) (-608.133) [-603.812] -- 0:00:08
915000 -- (-609.100) (-599.158) (-606.196) [-602.210] * [-606.553] (-608.747) (-608.121) (-610.447) -- 0:00:08
Average standard deviation of split frequencies: 0.008749
915500 -- (-605.875) (-607.502) [-603.498] (-607.613) * (-604.335) [-605.352] (-603.297) (-604.212) -- 0:00:08
916000 -- (-615.098) (-608.342) [-607.512] (-605.425) * (-606.157) (-603.073) (-611.424) [-601.995] -- 0:00:08
916500 -- (-613.864) [-607.807] (-610.000) (-607.707) * [-606.051] (-603.194) (-611.332) (-606.374) -- 0:00:08
917000 -- [-604.084] (-607.714) (-602.039) (-602.231) * [-606.025] (-608.556) (-610.174) (-614.089) -- 0:00:08
917500 -- (-607.380) (-613.428) [-606.017] (-604.098) * (-609.177) (-605.615) (-605.438) [-604.845] -- 0:00:08
918000 -- (-615.260) (-607.858) [-601.828] (-609.174) * (-607.214) (-606.118) [-606.307] (-601.625) -- 0:00:08
918500 -- (-616.317) (-610.186) (-602.461) [-607.806] * (-604.075) (-603.295) [-603.363] (-604.971) -- 0:00:08
919000 -- (-614.953) (-607.081) [-604.403] (-602.878) * (-620.216) (-601.932) [-604.019] (-606.558) -- 0:00:08
919500 -- (-612.369) (-610.635) [-602.189] (-604.420) * (-607.190) (-614.817) [-607.241] (-596.923) -- 0:00:08
920000 -- (-612.330) (-606.537) [-598.249] (-606.864) * (-616.327) (-610.704) (-609.738) [-603.593] -- 0:00:08
Average standard deviation of split frequencies: 0.008512
920500 -- (-604.392) (-607.857) (-601.640) [-601.417] * (-602.937) (-604.317) (-606.832) [-602.649] -- 0:00:07
921000 -- [-601.036] (-603.319) (-607.161) (-607.935) * (-608.000) (-604.922) [-605.720] (-609.259) -- 0:00:07
921500 -- (-602.273) [-599.779] (-605.550) (-610.244) * [-600.855] (-599.320) (-609.323) (-601.391) -- 0:00:07
922000 -- [-600.062] (-606.583) (-601.261) (-605.007) * (-610.369) [-602.937] (-604.463) (-607.003) -- 0:00:07
922500 -- (-614.146) [-605.471] (-601.836) (-610.150) * (-605.724) [-606.550] (-602.565) (-614.118) -- 0:00:07
923000 -- (-605.298) (-603.928) [-608.355] (-608.390) * [-608.057] (-605.088) (-605.106) (-607.589) -- 0:00:07
923500 -- (-601.961) (-611.075) [-611.845] (-607.338) * [-604.356] (-605.709) (-606.401) (-604.060) -- 0:00:07
924000 -- (-607.179) (-614.514) [-605.180] (-600.595) * [-605.784] (-606.682) (-600.488) (-609.849) -- 0:00:07
924500 -- (-610.439) [-601.442] (-604.311) (-614.556) * (-602.392) (-605.619) (-607.778) [-605.285] -- 0:00:07
925000 -- (-606.577) (-601.624) (-612.506) [-604.960] * (-602.757) (-609.488) (-614.908) [-600.693] -- 0:00:07
Average standard deviation of split frequencies: 0.008336
925500 -- [-602.621] (-605.553) (-609.272) (-603.173) * (-604.525) [-601.190] (-603.489) (-606.373) -- 0:00:07
926000 -- (-609.719) [-601.643] (-602.192) (-604.902) * (-605.151) [-600.323] (-610.864) (-607.098) -- 0:00:07
926500 -- (-608.493) [-601.893] (-610.829) (-602.641) * (-608.651) (-605.713) (-602.736) [-614.674] -- 0:00:07
927000 -- (-608.476) (-604.244) [-601.929] (-608.535) * (-604.440) [-600.219] (-604.649) (-609.686) -- 0:00:07
927500 -- (-600.649) (-606.770) (-602.131) [-606.904] * (-604.500) (-616.037) (-602.079) [-607.558] -- 0:00:07
928000 -- (-601.289) [-600.608] (-610.744) (-605.272) * (-603.117) [-600.227] (-602.260) (-602.337) -- 0:00:07
928500 -- (-606.441) [-611.504] (-604.844) (-607.324) * (-608.437) (-608.515) [-599.255] (-611.073) -- 0:00:07
929000 -- (-601.927) (-601.409) [-605.514] (-600.553) * [-604.281] (-608.130) (-605.149) (-601.817) -- 0:00:07
929500 -- (-605.390) [-600.855] (-603.576) (-608.480) * (-609.701) (-601.306) (-601.093) [-604.880] -- 0:00:07
930000 -- (-602.279) (-599.511) [-604.693] (-621.085) * (-606.155) [-603.347] (-603.494) (-603.563) -- 0:00:07
Average standard deviation of split frequencies: 0.008611
930500 -- (-608.145) [-603.507] (-612.244) (-605.686) * (-607.334) [-605.717] (-604.373) (-602.941) -- 0:00:06
931000 -- (-607.575) [-604.896] (-612.203) (-606.171) * (-604.830) (-603.953) (-612.497) [-597.921] -- 0:00:06
931500 -- (-603.411) (-610.488) [-605.582] (-605.055) * (-601.888) [-601.187] (-600.495) (-601.101) -- 0:00:06
932000 -- [-604.813] (-602.065) (-604.057) (-613.261) * (-605.490) (-601.925) (-604.650) [-600.348] -- 0:00:06
932500 -- (-605.159) [-605.691] (-601.384) (-605.930) * [-601.634] (-612.038) (-611.482) (-601.541) -- 0:00:06
933000 -- (-609.339) (-604.479) (-602.966) [-601.644] * (-603.106) [-600.822] (-602.890) (-600.835) -- 0:00:06
933500 -- [-614.381] (-600.064) (-604.584) (-603.848) * (-605.321) (-601.793) [-600.368] (-604.389) -- 0:00:06
934000 -- (-606.173) (-608.229) [-603.624] (-608.327) * [-606.417] (-602.833) (-602.114) (-602.172) -- 0:00:06
934500 -- [-604.873] (-606.602) (-603.343) (-599.551) * (-604.355) (-604.051) (-609.205) [-607.022] -- 0:00:06
935000 -- (-603.444) (-609.413) [-601.702] (-607.321) * (-607.814) [-604.226] (-604.676) (-612.386) -- 0:00:06
Average standard deviation of split frequencies: 0.008499
935500 -- (-604.638) (-602.057) [-599.921] (-612.207) * (-605.564) (-604.993) (-603.569) [-602.183] -- 0:00:06
936000 -- (-605.502) (-606.036) [-600.531] (-607.362) * [-612.129] (-603.575) (-602.507) (-609.301) -- 0:00:06
936500 -- (-606.049) [-599.179] (-605.872) (-605.127) * (-604.007) (-624.278) [-601.116] (-603.506) -- 0:00:06
937000 -- [-603.203] (-603.623) (-602.865) (-607.020) * [-601.900] (-610.849) (-605.579) (-608.322) -- 0:00:06
937500 -- (-607.061) [-602.937] (-604.417) (-602.287) * (-607.015) (-605.752) [-605.159] (-605.013) -- 0:00:06
938000 -- (-605.007) (-604.690) (-600.756) [-606.386] * (-604.554) [-604.479] (-601.684) (-607.196) -- 0:00:06
938500 -- (-604.335) (-598.091) (-620.659) [-603.505] * (-607.678) (-600.085) (-606.528) [-603.900] -- 0:00:06
939000 -- (-601.150) (-605.040) [-602.294] (-608.614) * (-604.713) (-603.189) (-600.723) [-606.307] -- 0:00:06
939500 -- (-599.233) [-605.745] (-606.006) (-604.910) * (-605.325) [-599.896] (-607.200) (-611.974) -- 0:00:06
940000 -- [-602.684] (-602.277) (-611.932) (-607.732) * (-605.239) (-609.448) (-608.446) [-604.372] -- 0:00:06
Average standard deviation of split frequencies: 0.008833
940500 -- (-603.332) (-602.031) [-599.713] (-608.571) * (-611.093) [-605.289] (-606.142) (-605.494) -- 0:00:05
941000 -- [-600.442] (-612.352) (-604.856) (-608.833) * (-602.084) (-603.989) (-603.099) [-606.474] -- 0:00:05
941500 -- (-608.727) (-602.548) (-604.855) [-604.037] * (-601.658) (-615.208) (-606.278) [-601.802] -- 0:00:05
942000 -- [-600.469] (-606.086) (-605.628) (-605.917) * (-602.818) [-605.164] (-606.450) (-601.818) -- 0:00:05
942500 -- (-602.420) (-605.898) (-602.262) [-604.654] * (-600.627) (-608.076) [-602.490] (-602.090) -- 0:00:05
943000 -- (-607.228) [-601.804] (-603.192) (-605.791) * (-609.247) [-600.672] (-606.316) (-607.507) -- 0:00:05
943500 -- (-609.367) (-609.341) [-604.859] (-604.153) * (-611.092) (-601.934) (-607.746) [-605.936] -- 0:00:05
944000 -- (-606.829) [-608.422] (-609.734) (-607.142) * (-606.431) [-600.583] (-614.362) (-606.732) -- 0:00:05
944500 -- (-604.166) (-604.522) (-607.464) [-606.565] * (-604.192) (-598.787) [-605.016] (-604.584) -- 0:00:05
945000 -- (-605.614) (-602.977) (-610.456) [-603.191] * (-605.361) [-610.732] (-612.656) (-611.466) -- 0:00:05
Average standard deviation of split frequencies: 0.008534
945500 -- [-603.246] (-603.298) (-608.803) (-603.629) * (-612.789) (-612.384) [-603.624] (-605.091) -- 0:00:05
946000 -- (-604.274) [-598.537] (-604.815) (-604.291) * (-605.536) [-603.357] (-606.638) (-608.107) -- 0:00:05
946500 -- (-614.888) (-605.498) [-600.637] (-609.956) * (-605.785) [-605.650] (-610.712) (-608.381) -- 0:00:05
947000 -- (-600.920) [-601.207] (-605.502) (-611.577) * (-605.541) (-605.835) (-601.489) [-606.578] -- 0:00:05
947500 -- (-606.639) (-602.544) [-611.522] (-615.328) * (-605.164) (-604.097) [-599.904] (-615.529) -- 0:00:05
948000 -- (-606.161) (-604.743) (-608.552) [-602.686] * (-610.917) (-611.886) [-608.121] (-603.824) -- 0:00:05
948500 -- (-602.958) (-620.429) (-610.482) [-602.134] * (-609.644) [-602.990] (-610.751) (-610.513) -- 0:00:05
949000 -- (-602.605) (-611.595) (-601.927) [-602.410] * [-598.421] (-601.018) (-608.348) (-605.160) -- 0:00:05
949500 -- (-606.798) [-599.057] (-603.805) (-606.666) * (-604.709) (-606.415) (-605.419) [-601.964] -- 0:00:05
950000 -- (-599.777) (-612.903) [-603.242] (-604.575) * (-604.878) [-608.107] (-607.248) (-608.567) -- 0:00:05
Average standard deviation of split frequencies: 0.008616
950500 -- (-604.702) (-614.388) [-610.160] (-602.996) * (-606.754) (-606.756) [-603.801] (-608.627) -- 0:00:04
951000 -- [-608.155] (-607.928) (-609.091) (-608.190) * (-611.326) [-605.508] (-612.749) (-604.801) -- 0:00:04
951500 -- [-603.084] (-604.207) (-606.661) (-600.230) * (-603.114) (-610.869) [-605.474] (-606.117) -- 0:00:04
952000 -- (-602.594) [-602.096] (-601.825) (-604.244) * [-601.063] (-616.847) (-608.215) (-606.420) -- 0:00:04
952500 -- (-611.440) (-603.963) (-605.568) [-612.534] * (-606.254) (-607.656) (-607.438) [-601.344] -- 0:00:04
953000 -- (-611.478) (-607.490) [-602.096] (-607.200) * (-606.725) (-604.031) [-603.238] (-609.769) -- 0:00:04
953500 -- [-604.569] (-607.263) (-602.251) (-602.373) * [-602.076] (-604.139) (-607.953) (-605.444) -- 0:00:04
954000 -- (-601.213) (-606.189) [-607.394] (-607.167) * (-603.893) [-608.952] (-608.214) (-606.097) -- 0:00:04
954500 -- [-601.624] (-607.861) (-609.444) (-621.099) * (-600.912) [-601.472] (-606.514) (-604.771) -- 0:00:04
955000 -- (-601.515) [-601.268] (-606.853) (-611.641) * [-603.288] (-608.113) (-607.809) (-606.987) -- 0:00:04
Average standard deviation of split frequencies: 0.008290
955500 -- (-601.538) (-603.000) (-608.594) [-605.079] * (-610.456) [-599.996] (-603.229) (-605.203) -- 0:00:04
956000 -- (-613.897) (-611.363) [-604.941] (-609.419) * [-606.910] (-601.212) (-606.923) (-605.162) -- 0:00:04
956500 -- (-604.411) (-604.831) [-601.163] (-602.930) * (-605.654) [-600.844] (-603.453) (-604.231) -- 0:00:04
957000 -- (-602.711) (-610.642) [-605.240] (-607.027) * (-603.128) (-612.514) (-602.821) [-601.779] -- 0:00:04
957500 -- (-603.561) (-610.485) (-601.407) [-601.441] * (-605.651) (-600.390) (-600.626) [-600.267] -- 0:00:04
958000 -- (-604.100) (-606.800) (-598.879) [-600.557] * [-605.831] (-616.084) (-605.752) (-611.512) -- 0:00:04
958500 -- (-605.450) (-613.978) (-604.622) [-603.901] * (-606.936) (-610.212) [-602.424] (-604.112) -- 0:00:04
959000 -- (-607.272) (-614.145) [-605.671] (-609.177) * (-609.615) (-608.273) [-603.457] (-601.529) -- 0:00:04
959500 -- (-611.574) (-608.563) (-604.862) [-602.329] * (-602.720) [-610.813] (-604.377) (-608.020) -- 0:00:04
960000 -- [-605.661] (-616.234) (-603.473) (-611.424) * [-603.289] (-621.519) (-602.148) (-599.549) -- 0:00:04
Average standard deviation of split frequencies: 0.008189
960500 -- (-605.334) (-613.500) (-615.790) [-600.333] * (-603.139) (-626.495) [-607.630] (-604.681) -- 0:00:03
961000 -- [-604.277] (-602.528) (-606.263) (-601.512) * (-599.075) (-610.800) (-606.510) [-601.281] -- 0:00:03
961500 -- [-602.998] (-605.167) (-606.976) (-602.839) * (-615.281) (-605.510) [-601.359] (-603.506) -- 0:00:03
962000 -- [-600.817] (-612.316) (-604.460) (-617.375) * (-604.989) (-609.465) (-600.137) [-604.730] -- 0:00:03
962500 -- [-598.805] (-601.715) (-600.880) (-607.049) * (-605.709) (-607.314) [-605.188] (-604.273) -- 0:00:03
963000 -- (-605.000) (-604.878) [-600.177] (-603.268) * [-607.826] (-617.443) (-610.785) (-608.089) -- 0:00:03
963500 -- (-606.290) (-607.078) [-601.210] (-610.810) * [-605.490] (-602.555) (-609.680) (-605.882) -- 0:00:03
964000 -- (-614.039) (-604.441) (-607.447) [-607.840] * (-605.650) [-597.717] (-602.238) (-604.421) -- 0:00:03
964500 -- [-604.755] (-611.823) (-602.696) (-610.057) * [-601.685] (-602.431) (-598.937) (-601.706) -- 0:00:03
965000 -- (-598.977) (-609.913) (-604.910) [-603.671] * (-606.212) (-602.608) (-613.765) [-602.060] -- 0:00:03
Average standard deviation of split frequencies: 0.008357
965500 -- (-608.096) (-600.508) [-605.799] (-605.679) * (-607.322) (-603.130) [-604.849] (-605.423) -- 0:00:03
966000 -- (-611.390) [-608.569] (-605.104) (-602.488) * (-605.872) [-609.323] (-609.376) (-612.200) -- 0:00:03
966500 -- (-599.942) (-601.791) [-600.226] (-606.246) * (-603.067) (-604.984) (-606.002) [-613.241] -- 0:00:03
967000 -- (-609.238) (-604.158) [-605.320] (-605.392) * (-600.902) (-608.170) (-610.629) [-607.781] -- 0:00:03
967500 -- (-608.780) [-601.106] (-603.534) (-608.279) * (-605.570) [-607.080] (-605.290) (-599.529) -- 0:00:03
968000 -- (-604.217) (-608.113) (-603.307) [-601.079] * (-604.276) [-605.442] (-606.700) (-604.080) -- 0:00:03
968500 -- (-610.848) (-606.849) [-599.292] (-612.320) * (-615.943) [-608.701] (-600.061) (-601.769) -- 0:00:03
969000 -- (-603.506) (-600.983) [-604.285] (-605.370) * (-606.738) (-606.183) (-605.274) [-600.684] -- 0:00:03
969500 -- (-599.624) (-608.427) [-602.586] (-608.593) * (-602.873) [-609.265] (-608.385) (-603.183) -- 0:00:03
970000 -- (-598.228) [-605.236] (-605.162) (-618.284) * [-604.274] (-606.685) (-609.502) (-599.517) -- 0:00:03
Average standard deviation of split frequencies: 0.008286
970500 -- (-607.878) (-601.703) [-602.549] (-612.633) * (-613.188) (-598.363) (-608.090) [-599.991] -- 0:00:02
971000 -- (-602.643) [-600.789] (-603.290) (-602.866) * (-604.802) (-606.735) [-600.739] (-603.470) -- 0:00:02
971500 -- (-610.613) (-606.436) [-607.721] (-604.634) * (-606.964) (-606.038) [-604.255] (-611.344) -- 0:00:02
972000 -- (-601.201) [-600.436] (-611.718) (-604.717) * (-608.718) (-606.652) [-600.481] (-612.668) -- 0:00:02
972500 -- (-604.408) (-607.000) (-609.404) [-603.456] * (-602.158) [-602.818] (-605.611) (-601.840) -- 0:00:02
973000 -- (-605.432) (-602.818) [-606.636] (-602.042) * [-605.342] (-602.364) (-600.744) (-606.330) -- 0:00:02
973500 -- [-596.698] (-600.912) (-613.590) (-613.912) * (-603.425) (-610.179) (-611.608) [-605.278] -- 0:00:02
974000 -- (-602.107) [-600.786] (-612.841) (-602.495) * (-607.786) [-602.923] (-610.686) (-609.332) -- 0:00:02
974500 -- (-604.179) [-602.016] (-606.853) (-604.877) * (-602.919) (-616.499) [-601.685] (-615.371) -- 0:00:02
975000 -- [-602.035] (-599.529) (-612.324) (-612.122) * (-601.667) (-601.329) [-609.979] (-604.221) -- 0:00:02
Average standard deviation of split frequencies: 0.008362
975500 -- (-604.849) (-613.332) [-605.630] (-609.943) * [-602.536] (-601.793) (-614.324) (-611.984) -- 0:00:02
976000 -- (-600.099) (-605.075) [-602.499] (-604.260) * [-603.656] (-603.126) (-603.577) (-604.866) -- 0:00:02
976500 -- (-601.030) (-606.510) (-605.944) [-602.659] * [-612.966] (-601.675) (-604.956) (-603.257) -- 0:00:02
977000 -- (-604.402) (-610.927) (-605.967) [-602.757] * (-607.460) (-604.597) (-608.566) [-600.040] -- 0:00:02
977500 -- (-607.999) (-608.838) [-603.434] (-602.125) * (-610.502) (-623.456) (-611.543) [-600.114] -- 0:00:02
978000 -- [-601.322] (-604.774) (-601.150) (-610.445) * (-606.617) [-602.560] (-604.766) (-604.135) -- 0:00:02
978500 -- (-602.380) (-606.256) (-609.070) [-606.218] * (-602.197) (-604.389) [-606.157] (-605.204) -- 0:00:02
979000 -- [-603.913] (-609.513) (-606.564) (-606.415) * (-608.936) (-605.214) (-605.705) [-604.989] -- 0:00:02
979500 -- [-605.885] (-606.234) (-604.338) (-603.714) * (-602.739) [-602.417] (-604.299) (-599.147) -- 0:00:02
980000 -- (-604.371) (-602.288) (-611.238) [-598.112] * (-607.982) (-605.307) [-607.532] (-603.069) -- 0:00:02
Average standard deviation of split frequencies: 0.008442
980500 -- (-603.942) [-598.884] (-602.751) (-604.981) * (-607.453) [-601.072] (-609.103) (-604.662) -- 0:00:01
981000 -- (-602.921) [-603.960] (-605.133) (-613.649) * (-614.179) (-611.627) (-604.186) [-604.765] -- 0:00:01
981500 -- (-603.230) (-601.123) (-611.950) [-603.159] * (-602.865) (-616.218) [-603.875] (-609.965) -- 0:00:01
982000 -- (-614.405) (-599.498) [-611.093] (-603.919) * (-602.650) (-609.422) (-612.507) [-596.711] -- 0:00:01
982500 -- (-607.836) [-603.867] (-602.085) (-612.899) * (-605.931) (-605.492) (-603.562) [-600.832] -- 0:00:01
983000 -- (-610.336) (-602.294) (-612.480) [-605.724] * (-604.358) (-604.009) [-602.933] (-604.987) -- 0:00:01
983500 -- (-605.068) (-604.890) [-611.551] (-608.408) * (-602.726) (-604.684) [-600.554] (-609.028) -- 0:00:01
984000 -- (-605.204) (-601.346) [-601.303] (-609.862) * [-603.707] (-609.124) (-605.394) (-608.114) -- 0:00:01
984500 -- (-602.033) (-612.927) (-601.435) [-602.114] * [-599.056] (-609.529) (-605.920) (-606.896) -- 0:00:01
985000 -- (-607.824) (-605.891) (-606.101) [-605.291] * [-600.841] (-605.050) (-610.847) (-604.995) -- 0:00:01
Average standard deviation of split frequencies: 0.008337
985500 -- [-607.812] (-607.693) (-602.592) (-607.331) * [-600.283] (-606.474) (-608.635) (-607.327) -- 0:00:01
986000 -- (-609.156) (-603.827) [-605.879] (-601.776) * (-599.557) (-603.004) (-616.108) [-600.876] -- 0:00:01
986500 -- (-603.433) (-606.928) [-606.592] (-607.287) * (-597.311) (-611.535) [-601.321] (-604.691) -- 0:00:01
987000 -- (-604.004) (-609.766) (-603.696) [-603.813] * (-606.601) [-603.976] (-607.996) (-602.088) -- 0:00:01
987500 -- [-603.229] (-604.427) (-606.497) (-609.462) * (-602.403) (-612.293) (-606.258) [-606.531] -- 0:00:01
988000 -- (-604.862) (-611.713) [-601.945] (-610.796) * (-604.923) [-607.759] (-599.089) (-618.982) -- 0:00:01
988500 -- (-599.153) (-607.300) [-604.515] (-619.716) * (-599.133) (-606.874) [-599.171] (-604.982) -- 0:00:01
989000 -- [-596.916] (-599.296) (-601.597) (-610.207) * (-604.188) [-600.592] (-601.663) (-607.511) -- 0:00:01
989500 -- (-606.925) [-606.974] (-608.151) (-604.437) * (-606.878) [-607.298] (-603.142) (-599.934) -- 0:00:01
990000 -- (-609.681) [-603.800] (-603.826) (-609.523) * (-605.018) (-605.197) (-601.614) [-607.147] -- 0:00:01
Average standard deviation of split frequencies: 0.007941
990500 -- (-607.523) (-606.196) [-603.617] (-605.334) * (-609.448) (-603.374) (-601.501) [-598.934] -- 0:00:00
991000 -- [-599.766] (-605.868) (-605.505) (-606.687) * (-609.460) (-611.898) (-605.846) [-600.417] -- 0:00:00
991500 -- [-599.426] (-608.811) (-604.783) (-605.031) * (-618.523) (-603.323) (-608.154) [-609.545] -- 0:00:00
992000 -- (-600.012) (-608.935) [-600.719] (-609.460) * (-603.993) (-603.187) (-609.997) [-610.467] -- 0:00:00
992500 -- (-604.513) (-611.178) [-605.304] (-620.388) * (-604.825) (-608.745) (-612.516) [-597.983] -- 0:00:00
993000 -- (-605.003) [-605.415] (-603.309) (-602.033) * [-601.914] (-603.777) (-602.644) (-599.699) -- 0:00:00
993500 -- (-611.368) (-604.187) (-599.454) [-604.776] * (-611.965) [-609.239] (-604.335) (-608.536) -- 0:00:00
994000 -- (-607.941) (-611.371) [-598.762] (-603.368) * (-624.363) (-607.054) (-601.941) [-605.193] -- 0:00:00
994500 -- (-605.350) (-600.628) [-609.413] (-606.557) * (-600.160) (-608.379) (-596.839) [-603.576] -- 0:00:00
995000 -- [-600.724] (-601.936) (-609.469) (-612.103) * (-610.986) [-605.644] (-596.888) (-600.586) -- 0:00:00
Average standard deviation of split frequencies: 0.007750
995500 -- (-611.611) [-606.434] (-613.402) (-604.788) * (-601.098) [-610.353] (-604.155) (-602.212) -- 0:00:00
996000 -- (-609.937) (-608.314) [-606.200] (-605.407) * (-610.028) (-606.671) [-603.069] (-600.891) -- 0:00:00
996500 -- (-601.768) (-606.016) [-608.604] (-608.123) * [-607.519] (-606.463) (-605.768) (-604.553) -- 0:00:00
997000 -- (-603.317) (-601.703) (-610.116) [-608.704] * (-603.592) (-603.101) (-611.085) [-599.975] -- 0:00:00
997500 -- [-598.327] (-609.261) (-612.634) (-604.614) * [-601.499] (-604.696) (-605.602) (-603.375) -- 0:00:00
998000 -- [-604.232] (-601.144) (-603.005) (-612.227) * (-608.308) (-614.913) [-605.965] (-612.455) -- 0:00:00
998500 -- [-608.173] (-606.090) (-602.449) (-608.066) * (-605.009) (-605.930) [-601.742] (-602.706) -- 0:00:00
999000 -- (-606.333) [-598.498] (-604.724) (-604.662) * (-604.407) (-613.763) [-602.134] (-600.562) -- 0:00:00
999500 -- [-604.697] (-605.104) (-616.854) (-602.585) * (-602.488) (-616.010) (-615.905) [-604.994] -- 0:00:00
1000000 -- (-616.320) (-601.389) [-602.560] (-599.598) * (-604.183) (-607.275) (-604.483) [-607.299] -- 0:00:00
Average standard deviation of split frequencies: 0.007537
Analysis completed in 1 mins 40 seconds
Analysis used 98.28 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -594.71
Likelihood of best state for "cold" chain of run 2 was -594.48
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 64 %) Dirichlet(Revmat{all})
91.4 % ( 90 %) Slider(Revmat{all})
35.5 % ( 34 %) Dirichlet(Pi{all})
35.2 % ( 20 %) Slider(Pi{all})
67.9 % ( 44 %) Multiplier(Alpha{1,2})
68.3 % ( 36 %) Multiplier(Alpha{3})
74.6 % ( 67 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 72 %) ExtTBR(Tau{all},V{all})
99.8 % (100 %) NNI(Tau{all},V{all})
89.1 % ( 94 %) ParsSPR(Tau{all},V{all})
27.9 % ( 23 %) Multiplier(V{all})
85.6 % ( 90 %) Nodeslider(V{all})
28.4 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.2 % ( 70 %) Dirichlet(Revmat{all})
91.1 % ( 85 %) Slider(Revmat{all})
36.0 % ( 32 %) Dirichlet(Pi{all})
35.3 % ( 27 %) Slider(Pi{all})
68.0 % ( 43 %) Multiplier(Alpha{1,2})
68.4 % ( 36 %) Multiplier(Alpha{3})
75.7 % ( 52 %) Slider(Pinvar{all})
98.6 % ( 95 %) ExtSPR(Tau{all},V{all})
69.8 % ( 62 %) ExtTBR(Tau{all},V{all})
99.8 % (100 %) NNI(Tau{all},V{all})
88.9 % ( 98 %) ParsSPR(Tau{all},V{all})
27.9 % ( 22 %) Multiplier(V{all})
85.4 % ( 82 %) Nodeslider(V{all})
28.1 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.79 0.61 0.47
2 | 166188 0.81 0.64
3 | 167250 166826 0.82
4 | 166704 166636 166396
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.79 0.62 0.47
2 | 166651 0.81 0.65
3 | 166865 166575 0.83
4 | 165844 167208 166857
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -602.49
| 1 2 2 1 |
| 11 12 |
| 2 2 2 2 2 1 2 21 |
| 2 2 1 |
| * 2 12 12 2 222 21 1|
| 2 2 2 21 2 11 2 22 121211 2 |
|2 1 1 2 2 1 1 2 21 |
| 11 1 1 2 2 12 12 * 2 * 11 1 2 1 |
|1 1 1 22 2 1 2 1 11 1 2 2|
| 222 11 1 1 2 1 1 21 1 1 |
| 1 1 2 |
| 11 2 2 |
| 1 |
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -606.04
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -600.52 -613.77
2 -600.52 -609.92
--------------------------------------
TOTAL -600.52 -613.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.298624 0.015739 0.112103 0.543842 0.274100 914.82 1004.15 1.000
r(A<->C){all} 0.250261 0.016986 0.000969 0.491888 0.237398 312.48 316.76 1.003
r(A<->G){all} 0.203171 0.014810 0.001069 0.433390 0.185778 297.00 420.38 1.000
r(A<->T){all} 0.112348 0.008344 0.000056 0.294181 0.090325 282.47 302.57 1.002
r(C<->G){all} 0.162278 0.010000 0.000281 0.358641 0.146816 281.68 368.77 1.005
r(C<->T){all} 0.129631 0.007542 0.000049 0.296889 0.115126 358.52 365.00 1.004
r(G<->T){all} 0.142311 0.007460 0.002392 0.309241 0.129255 343.12 381.81 1.000
pi(A){all} 0.160717 0.000364 0.123610 0.197835 0.159655 1108.72 1205.55 1.000
pi(C){all} 0.271864 0.000504 0.231233 0.317202 0.271774 1219.00 1261.51 1.000
pi(G){all} 0.313788 0.000555 0.268238 0.361514 0.313226 1272.53 1302.47 1.000
pi(T){all} 0.253631 0.000484 0.211894 0.297924 0.253538 1335.13 1418.07 1.001
alpha{1,2} 0.325615 0.126679 0.000114 1.073284 0.208654 1011.22 1074.80 1.000
alpha{3} 0.568945 0.246111 0.000269 1.525811 0.438244 1158.85 1269.80 1.000
pinvar{all} 0.454302 0.042575 0.067151 0.809308 0.468668 681.66 734.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..**..
8 -- ...*.*
9 -- .*.*..
10 -- .**.**
11 -- ..****
12 -- .*.***
13 -- ...**.
14 -- .*...*
15 -- .**...
16 -- .*..*.
17 -- .****.
18 -- ....**
19 -- .***.*
20 -- ..*..*
21 -- ..*.*.
22 -- ...***
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 440 0.146569 0.005653 0.142572 0.150566 2
8 438 0.145903 0.000942 0.145237 0.146569 2
9 437 0.145570 0.003298 0.143238 0.147901 2
10 436 0.145237 0.005653 0.141239 0.149234 2
11 435 0.144903 0.011777 0.136576 0.153231 2
12 435 0.144903 0.014604 0.134577 0.155230 2
13 434 0.144570 0.005653 0.140573 0.148568 2
14 433 0.144237 0.015546 0.133245 0.155230 2
15 428 0.142572 0.007537 0.137242 0.147901 2
16 427 0.142239 0.004240 0.139241 0.145237 2
17 425 0.141572 0.004240 0.138574 0.144570 2
18 424 0.141239 0.010364 0.133911 0.148568 2
19 422 0.140573 0.001884 0.139241 0.141905 2
20 413 0.137575 0.008009 0.131912 0.143238 2
21 413 0.137575 0.007066 0.132578 0.142572 2
22 296 0.098601 0.014133 0.088608 0.108594 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.003360 0.000012 0.000001 0.010097 0.002248 1.000 2
length{all}[2] 0.003332 0.000012 0.000004 0.010161 0.002346 1.000 2
length{all}[3] 0.003345 0.000012 0.000000 0.010109 0.002267 1.001 2
length{all}[4] 0.003409 0.000013 0.000000 0.010514 0.002236 1.000 2
length{all}[5] 0.271915 0.015130 0.099261 0.515598 0.246124 1.000 2
length{all}[6] 0.003371 0.000012 0.000000 0.010132 0.002281 1.000 2
length{all}[7] 0.003240 0.000010 0.000013 0.009015 0.002140 1.001 2
length{all}[8] 0.003084 0.000009 0.000009 0.009462 0.002092 0.998 2
length{all}[9] 0.003256 0.000012 0.000006 0.010110 0.002194 0.998 2
length{all}[10] 0.003460 0.000014 0.000002 0.010468 0.002226 0.998 2
length{all}[11] 0.003647 0.000014 0.000001 0.011212 0.002520 0.998 2
length{all}[12] 0.003565 0.000012 0.000001 0.010090 0.002670 1.000 2
length{all}[13] 0.003251 0.000011 0.000009 0.009058 0.002289 1.007 2
length{all}[14] 0.003141 0.000009 0.000004 0.009912 0.002182 0.998 2
length{all}[15] 0.003322 0.000011 0.000005 0.009819 0.002330 1.002 2
length{all}[16] 0.003287 0.000011 0.000001 0.009642 0.002225 1.008 2
length{all}[17] 0.003427 0.000013 0.000003 0.010437 0.002158 1.005 2
length{all}[18] 0.003106 0.000010 0.000004 0.009555 0.001962 0.998 2
length{all}[19] 0.003379 0.000014 0.000001 0.009599 0.002205 0.998 2
length{all}[20] 0.003245 0.000011 0.000002 0.010129 0.002244 0.998 2
length{all}[21] 0.003085 0.000010 0.000006 0.009461 0.002044 0.998 2
length{all}[22] 0.003427 0.000011 0.000004 0.009254 0.002352 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007537
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/- C1 (1)
|
|- C2 (2)
|
|- C3 (3)
+
|- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\- C6 (6)
|-------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 339
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sites with gaps or missing data are removed.
42 ambiguity characters in seq. 5
14 sites are removed. 100 101 102 103 104 105 106 107 108 109 110 111 112 113
Sequences read..
Counting site patterns.. 0:00
Compressing, 55 patterns at 99 / 99 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 55 patterns at 99 / 99 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
53680 bytes for conP
4840 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 13
0.109242 0.061307 0.057496 0.079420 0.080189 0.011017 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -589.146145
Iterating by ming2
Initial: fx= 589.146145
x= 0.10924 0.06131 0.05750 0.07942 0.08019 0.01102 0.30000 1.30000
1 h-m-p 0.0000 0.0001 369.5049 ++ 576.011527 m 0.0001 13 | 1/8
2 h-m-p 0.0001 0.0003 284.4659 ++ 557.548837 m 0.0003 24 | 2/8
3 h-m-p 0.0000 0.0001 120.0920 ++ 556.175436 m 0.0001 35 | 3/8
4 h-m-p 0.0001 0.0006 45.3932 ++ 552.534323 m 0.0006 46 | 4/8
5 h-m-p 0.0035 0.5748 5.2522 ------------.. | 4/8
6 h-m-p 0.0000 0.0003 208.9893 +++ 541.855252 m 0.0003 79 | 5/8
7 h-m-p 0.0039 0.3894 14.8777 ++CYCCC 538.447846 4 0.0488 99 | 5/8
8 h-m-p 0.0669 0.3345 3.3911 YCYCYC 536.016790 5 0.1898 118 | 5/8
9 h-m-p 1.6000 8.0000 0.2320 YYYCCC 531.042455 5 1.7748 136 | 5/8
10 h-m-p 0.5099 2.5497 0.3408 CYCYCC 530.367381 5 0.9757 159 | 5/8
11 h-m-p 1.6000 8.0000 0.0130 CCC 530.352416 2 2.0026 177 | 5/8
12 h-m-p 1.3152 8.0000 0.0197 YC 530.350946 1 0.6070 192 | 5/8
13 h-m-p 1.6000 8.0000 0.0048 YC 530.350256 1 3.0905 207 | 5/8
14 h-m-p 1.6000 8.0000 0.0001 Y 530.350256 0 1.0347 221 | 5/8
15 h-m-p 1.6000 8.0000 0.0000 ---C 530.350256 0 0.0063 238
Out..
lnL = -530.350256
239 lfun, 239 eigenQcodon, 1434 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 13
0.086763 0.063470 0.058843 0.017345 0.026631 0.010149 0.993748 0.775414 0.302283
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.586380
np = 9
lnL0 = -601.520972
Iterating by ming2
Initial: fx= 601.520972
x= 0.08676 0.06347 0.05884 0.01735 0.02663 0.01015 0.99375 0.77541 0.30228
1 h-m-p 0.0000 0.0001 1093.1626 ++ 556.158567 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0001 203.6399 ++ 553.328880 m 0.0001 26 | 2/9
3 h-m-p 0.0003 0.0072 47.9174 +++ 541.942301 m 0.0072 39 | 3/9
4 h-m-p 0.0000 0.0001 56.4113 ++ 541.060239 m 0.0001 51 | 4/9
5 h-m-p 0.0002 0.0055 34.2796 +++ 536.671472 m 0.0055 64 | 5/9
6 h-m-p 0.2947 2.0584 0.6343 ---------------.. | 5/9
7 h-m-p 0.0000 0.0143 137.1478 +++YYYYC 525.518767 4 0.0019 112 | 5/9
8 h-m-p 0.0017 0.0086 19.4004 ++ 521.432989 m 0.0086 124 | 6/9
9 h-m-p 0.1157 4.1779 0.6786 ---------------.. | 6/9
10 h-m-p 0.0001 0.0285 13.9372 ++++YCYCCC 520.210637 5 0.0103 176 | 6/9
11 h-m-p 0.0967 0.4876 1.4833 CYC 520.187889 2 0.0206 191 | 6/9
12 h-m-p 0.0122 0.3881 2.5057 +YCCCC 520.041148 4 0.0972 211 | 6/9
13 h-m-p 1.6000 8.0000 0.0067 YC 520.039455 1 0.8186 224 | 6/9
14 h-m-p 1.6000 8.0000 0.0022 CC 520.039318 1 0.6336 241 | 6/9
15 h-m-p 1.2120 8.0000 0.0012 Y 520.039316 0 0.7519 256 | 6/9
16 h-m-p 1.6000 8.0000 0.0000 Y 520.039316 0 1.0208 271 | 6/9
17 h-m-p 1.6000 8.0000 0.0000 C 520.039316 0 1.6000 286 | 6/9
18 h-m-p 1.6000 8.0000 0.0000 ----C 520.039316 0 0.0016 305
Out..
lnL = -520.039316
306 lfun, 918 eigenQcodon, 3672 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 13
initial w for M2:NSpselection reset.
0.011508 0.050349 0.062391 0.087422 0.038021 0.014577 0.729818 1.059792 0.400334 0.330117 2.014751
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.995614
np = 11
lnL0 = -590.152737
Iterating by ming2
Initial: fx= 590.152737
x= 0.01151 0.05035 0.06239 0.08742 0.03802 0.01458 0.72982 1.05979 0.40033 0.33012 2.01475
1 h-m-p 0.0000 0.0001 757.9039 ++ 555.711742 m 0.0001 16 | 1/11
2 h-m-p 0.0000 0.0000 208.1036 ++ 554.522922 m 0.0000 30 | 2/11
3 h-m-p 0.0002 0.0138 24.4834 +++ 548.421283 m 0.0138 45 | 3/11
4 h-m-p 0.0011 0.0061 69.1030 ++ 535.138684 m 0.0061 59 | 4/11
5 h-m-p 0.0000 0.0000 17722.6183 ++ 532.931189 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 1109.4611 ++ 531.914885 m 0.0000 87 | 6/11
7 h-m-p 0.0160 8.0000 6.1176 +++CYC 509.669735 2 1.2654 107 | 6/11
8 h-m-p 0.2089 1.0444 3.8901 +YYCCCC 505.451274 5 0.7223 130 | 6/11
9 h-m-p 0.1507 0.7537 3.9855 +YYYCCC 503.738452 5 0.5662 152 | 6/11
10 h-m-p 0.4999 8.0000 4.5142 CYCCC 502.457414 4 0.4068 173 | 6/11
11 h-m-p 1.0258 6.3025 1.7901 ++ 499.230730 m 6.3025 187 | 6/11
12 h-m-p 0.7246 8.0000 15.5703 YCCC 493.858272 3 1.6731 206 | 6/11
13 h-m-p 1.6000 8.0000 6.7821 CYC 492.052394 2 1.7229 223 | 6/11
14 h-m-p 0.9992 8.0000 11.6941 +YCC 489.247566 2 5.4550 241 | 6/11
15 h-m-p 0.5609 2.8047 18.0389 +YC 487.905698 1 2.5101 257 | 6/11
16 h-m-p 0.0340 0.1701 30.3966 ++ 487.799708 m 0.1701 271 | 6/11
17 h-m-p -0.0000 -0.0000 92.0159
h-m-p: -0.00000000e+00 -0.00000000e+00 9.20159005e+01 487.799708
.. | 6/11
18 h-m-p 0.0031 1.5684 1.9876 ++CCC 487.648536 2 0.0762 302 | 6/11
19 h-m-p 0.1686 1.3081 0.8985 +CYCCC 487.215988 4 0.9065 325 | 6/11
20 h-m-p 1.6000 8.0000 0.1765 C 487.176009 0 1.5995 344 | 6/11
21 h-m-p 0.8985 4.4924 0.1148 YCC 487.172485 2 0.5797 366 | 6/11
22 h-m-p 0.9387 8.0000 0.0709 CC 487.170306 1 0.7982 387 | 6/11
23 h-m-p 1.6000 8.0000 0.0276 ++ 487.168331 m 8.0000 406 | 6/11
24 h-m-p 1.6000 8.0000 0.1152 ++ 487.148295 m 8.0000 425 | 6/11
25 h-m-p 0.0569 8.0000 16.2092 ++YC 486.807088 1 2.1615 447 | 6/11
26 h-m-p 1.6000 8.0000 20.7272 ++ 485.565549 m 8.0000 461 | 6/11
27 h-m-p 1.6000 8.0000 50.8162 CCC 485.041317 2 1.4561 479 | 6/11
28 h-m-p 1.0291 5.1457 50.7701 ++ 484.254583 m 5.1457 493 | 6/11
29 h-m-p 0.6044 3.0218 103.6861 ++ 483.926594 m 3.0218 507 | 7/11
30 h-m-p 0.5888 2.9438 3.9541 YYYC 483.827681 3 0.5331 524 | 7/11
31 h-m-p 0.9789 4.8945 0.1409 CCC 483.824584 2 1.2378 542 | 7/11
32 h-m-p 1.6000 8.0000 0.0214 CC 483.824195 1 2.0207 562 | 7/11
33 h-m-p 0.5965 8.0000 0.0726 CC 483.824138 1 0.9455 582 | 7/11
34 h-m-p 1.6000 8.0000 0.0002 Y 483.824138 0 1.0502 600 | 7/11
35 h-m-p 1.6000 8.0000 0.0000 Y 483.824138 0 0.4000 618
Out..
lnL = -483.824138
619 lfun, 2476 eigenQcodon, 11142 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -531.848327 S = -498.326742 -62.476001
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:04
did 20 / 55 patterns 0:04
did 30 / 55 patterns 0:04
did 40 / 55 patterns 0:04
did 50 / 55 patterns 0:04
did 55 / 55 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 13
0.090860 0.049232 0.010458 0.061865 0.092757 0.081079 0.104615 0.944297 1.865791
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 16.596798
np = 9
lnL0 = -584.766716
Iterating by ming2
Initial: fx= 584.766716
x= 0.09086 0.04923 0.01046 0.06187 0.09276 0.08108 0.10462 0.94430 1.86579
1 h-m-p 0.0000 0.0001 340.4055 ++ 573.528882 m 0.0001 14 | 1/9
2 h-m-p 0.0000 0.0002 326.2159 ++ 557.371512 m 0.0002 26 | 2/9
3 h-m-p 0.0000 0.0000 750.2023 ++ 552.816869 m 0.0000 38 | 3/9
4 h-m-p 0.0001 0.0004 80.1787 ++ 548.622745 m 0.0004 50 | 4/9
5 h-m-p 0.0000 0.0002 56.7885 ++ 547.380674 m 0.0002 62 | 5/9
6 h-m-p 0.0035 0.4339 2.1848 +++YYYYYCYCYC 542.236443 10 0.2830 89 | 5/9
7 h-m-p 0.0935 0.4676 3.9672 +YYCCC 531.800783 4 0.3250 108 | 5/9
8 h-m-p 1.2779 8.0000 1.0089 YYYCCC 529.057526 5 1.6782 127 | 5/9
9 h-m-p 0.4959 2.4793 0.7324 +YYYYYCCC 526.052940 7 1.9369 149 | 5/9
10 h-m-p 0.0213 0.1064 5.2591 YCYCCCC 525.865780 6 0.0313 175 | 5/9
11 h-m-p 0.0481 0.2404 3.0381 +YYYYYYCCYC 523.579211 10 0.2191 201 | 5/9
12 h-m-p 0.0104 0.0520 2.1822 +YCCCC 523.343534 4 0.0407 221 | 5/9
13 h-m-p 1.6000 8.0000 0.0162 CC 523.309307 1 2.0565 235 | 5/9
14 h-m-p 0.0448 0.2238 0.1803 +YCCC 523.294140 3 0.1444 257 | 5/9
15 h-m-p 1.6000 8.0000 0.0024 +YC 523.293408 1 4.0013 275 | 5/9
16 h-m-p 0.6801 3.4005 0.0036 +YC 523.293054 1 1.7640 293 | 5/9
17 h-m-p 0.4099 2.0496 0.0023 ++ 523.292954 m 2.0496 309 | 5/9
18 h-m-p -0.0000 -0.0000 0.0040
h-m-p: -0.00000000e+00 -0.00000000e+00 4.03670835e-03 523.292954
.. | 5/9
19 h-m-p 0.0061 3.0253 0.0872 Y 523.292942 0 0.0029 338 | 5/9
20 h-m-p 0.0040 0.0263 0.0622 +Y 523.292924 0 0.0128 355 | 5/9
21 h-m-p 0.0096 0.0698 0.0826 ++ 523.292836 m 0.0698 371 | 5/9
22 h-m-p -0.0000 -0.0000 0.0047
h-m-p: -0.00000000e+00 -0.00000000e+00 4.69259676e-03 523.292836
.. | 5/9
23 h-m-p 0.0154 7.6845 0.0126 C 523.292836 0 0.0047 400 | 5/9
24 h-m-p 0.0026 0.0131 0.0122 ++ 523.292835 m 0.0131 416 | 5/9
25 h-m-p -0.0000 -0.0000 0.0176
h-m-p: -0.00000000e+00 -0.00000000e+00 1.76244509e-02 523.292835
.. | 5/9
26 h-m-p 0.0160 8.0000 0.0115 Y 523.292835 0 0.0082 445 | 5/9
27 h-m-p 0.0008 0.0040 0.0116 ++ 523.292834 m 0.0040 461 | 5/9
28 h-m-p -0.0000 -0.0000 0.0152
h-m-p: -0.00000000e+00 -0.00000000e+00 1.52147983e-02 523.292834
.. | 5/9
29 h-m-p 0.0160 8.0000 0.0067 C 523.292834 0 0.0210 490 | 5/9
30 h-m-p 0.0001 0.0004 0.0166 ++ 523.292834 m 0.0004 506 | 6/9
31 h-m-p 0.0030 1.4808 0.0496 +C 523.292832 0 0.0142 523 | 6/9
32 h-m-p 0.3314 8.0000 0.0021 Y 523.292832 0 0.0493 538 | 6/9
33 h-m-p 1.0818 8.0000 0.0001 -------C 523.292832 0 0.0000 560
Out..
lnL = -523.292832
561 lfun, 6171 eigenQcodon, 33660 P(t)
Time used: 0:12
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 13
initial w for M8:NSbetaw>1 reset.
0.043951 0.100659 0.056800 0.015999 0.023463 0.073252 0.593721 0.900000 0.904569 1.898553 2.185063
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 10.379745
np = 11
lnL0 = -607.738588
Iterating by ming2
Initial: fx= 607.738588
x= 0.04395 0.10066 0.05680 0.01600 0.02346 0.07325 0.59372 0.90000 0.90457 1.89855 2.18506
1 h-m-p 0.0000 0.0002 1252.3923 +++ 547.184843 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0003 195.4261 ++ 536.221882 m 0.0003 31 | 2/11
3 h-m-p 0.0000 0.0002 229.4541 ++ 532.117815 m 0.0002 45 | 3/11
4 h-m-p 0.0001 0.0004 60.0974 ++ 528.697579 m 0.0004 59 | 4/11
5 h-m-p 0.0012 0.0062 12.8876 ++ 525.635882 m 0.0062 73 | 5/11
6 h-m-p 0.0134 0.2022 5.5814 +
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
+ 517.023667 m 0.2022 87
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.191851e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26443) = 1.151646e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.26442) = 1.151647e-160 2000 rounds
| 6/11
7 h-m-p 0.1288 1.4819 5.5350
QuantileBeta(0.15, 0.00500, 2.55435) = 9.924995e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42412) = 7.008302e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
+ 508.700876 m 1.4819 101
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.173069e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60029) = 4.032300e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.60028) = 4.032302e-161 2000 rounds
| 6/11
8 h-m-p 0.1049 0.5244 8.7111
QuantileBeta(0.15, 0.00500, 5.64890) = 3.994362e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.79477) = 3.884701e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.66481) = 3.982104e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.72979) = 3.932801e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67163) = 3.976875e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.70071) = 3.954715e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67296) = 3.975854e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.68683) = 3.965256e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67315) = 3.975706e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.67999) = 3.970474e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
C 506.221177 4 0.1572 123
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 4.114484e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975691e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67317) = 3.975694e-161 2000 rounds
| 6/11
9 h-m-p 0.7819 4.9031 1.7515
QuantileBeta(0.15, 0.00500, 6.57961) = 3.384617e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.89978) = 3.809406e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.80093) = 3.880203e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 5.79129) = 3.887246e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.73223) = 3.930973e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77844) = 3.896675e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 5.77765) = 3.897257e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.75494) = 3.914043e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77694) = 3.897779e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.76594) = 3.905894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
C 505.659048 5 0.0895 145
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 4.033883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897810e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.77690) = 3.897812e-161 2000 rounds
| 6/11
10 h-m-p 0.0583 8.0000 2.6894
QuantileBeta(0.15, 0.00500, 5.82437) = 3.863178e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.96678) = 3.762867e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.53643) = 3.408763e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.81502) = 2.476258e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
+ 498.235851 m 8.0000 161
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.807501e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29377) = 1.746530e-161 2000 rounds
| 6/11
11 h-m-p 1.6000 8.0000 8.9120
QuantileBeta(0.15, 0.00500, 16.72310) = 1.269934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 30.01110) = 6.982444e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
+ 493.145961 m 8.0000 175
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 5.058637e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44046) = 4.891368e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 34.44044) = 4.891370e-162 2000 rounds
| 6/11
12 h-m-p 1.6000 8.0000 5.8351
QuantileBeta(0.15, 0.00500, 37.24328) = 4.518297e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 45.65180) = 3.676950e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.08269) = 4.090883e-162 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 41.16617) = 4.082486e-162 2000 rounds
C
QuantileBeta(0.15, 0.00500, 43.40899) = 3.869121e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.59944) = 4.039454e-162 2000 rounds
C
QuantileBeta(0.15, 0.00500, 42.50421) = 3.952453e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.63048) = 4.036406e-162 2000 rounds
C
QuantileBeta(0.15, 0.00500, 42.06735) = 3.993988e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64108) = 4.035365e-162 2000 rounds
C
QuantileBeta(0.15, 0.00500, 41.85421) = 4.014570e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
C 490.812567 5 4.1108 198
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.173308e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64162) = 4.035313e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 41.64160) = 4.035315e-162 2000 rounds
| 6/11
13 h-m-p 1.5387 8.0000 15.5889
QuantileBeta(0.15, 0.00500, 49.06114) = 2.045763e-162 2000 rounds
++ 489.331055 m 8.0000 212 | 6/11
14 h-m-p 0.4350 2.1750 28.2114 ++ 488.290290 m 2.1750 226 | 6/11
15 h-m-p 0.0000 0.0000 49.1259
h-m-p: 0.00000000e+00 0.00000000e+00 4.91259271e+01 488.290290
.. | 6/11
16 h-m-p 0.0002 0.0923 9.8724 +YCC 488.261905 2 0.0006 255 | 6/11
17 h-m-p 0.0115 5.7726 1.3325 ++++CYCCC 486.597483 4 2.6689 280 | 7/11
18 h-m-p 0.6054 3.0271 0.7001 +YYCYCCC 485.482445 6 2.7556 304 | 7/11
19 h-m-p 1.6000 8.0000 0.2561 YCC 485.473525 2 0.6643 325 | 7/11
20 h-m-p 0.2284 1.4573 0.7451 CCC 485.461066 2 0.2946 347 | 7/11
21 h-m-p 1.3621 8.0000 0.1612 YCCC 485.436921 3 3.0333 370 | 7/11
22 h-m-p 1.6000 8.0000 0.0174 YC 485.436776 1 1.1504 389 | 7/11
23 h-m-p 1.6000 8.0000 0.0086 ++ 485.436377 m 8.0000 407 | 7/11
24 h-m-p 0.0892 8.0000 0.7725 ++YC 485.430399 1 2.4491 428 | 7/11
25 h-m-p 1.5472 8.0000 1.2227 ++ 485.369089 m 8.0000 446 | 7/11
26 h-m-p 0.0560 3.9346 174.7308 ++++ 483.905505 m 3.9346 462 | 8/11
27 h-m-p 0.7322 3.6609 2.6195 YYYC 483.845463 3 0.6749 479 | 8/11
28 h-m-p 0.6137 3.0683 0.2502 +YCCC 483.825262 3 1.6377 499 | 8/11
29 h-m-p 1.5659 7.8738 0.2617 YC 483.824139 1 1.1075 517 | 8/11
30 h-m-p 1.6000 8.0000 0.0110 Y 483.824132 0 0.9518 534 | 8/11
31 h-m-p 1.6000 8.0000 0.0007 C 483.824132 0 0.6096 551 | 8/11
32 h-m-p 1.6000 8.0000 0.0002 Y 483.824132 0 1.0103 568 | 8/11
33 h-m-p 1.6000 8.0000 0.0000 C 483.824132 0 2.3065 585
Out..
lnL = -483.824132
586 lfun, 7032 eigenQcodon, 38676 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -531.279816 S = -498.326718 -56.969422
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 55 patterns 0:31
did 20 / 55 patterns 0:32
did 30 / 55 patterns 0:32
did 40 / 55 patterns 0:32
did 50 / 55 patterns 0:32
did 55 / 55 patterns 0:32
Time used: 0:32
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=113
NC_011896_1_WP_010907599_1_212_MLBR_RS01045 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NC_002677_1_NP_301275_1_147_ML0208 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP
**************************************************
NC_011896_1_WP_010907599_1_212_MLBR_RS01045 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
NC_002677_1_NP_301275_1_147_ML0208 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRRPQSPQQCPVRCo
NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140 NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR
************************************* : : . .
NC_011896_1_WP_010907599_1_212_MLBR_RS01045 VVALEGARAPEPF
NC_002677_1_NP_301275_1_147_ML0208 VVALEGARAPEPF
NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105 VVALEGARAPEPF
NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595 VVALEGARAPEPF
NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105 ooooooooooooo
NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140 VVALEGARAPEPF
>NC_011896_1_WP_010907599_1_212_MLBR_RS01045 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC >NC_002677_1_NP_301275_1_147_ML0208 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC >NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC >NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC >NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA TCTACATACGTAGGCCTCAATCACCCCAACAATGCCCCGTCCGATGC--- --------------------------------------- >NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140 ATGAACTGGATCCAGGTGCTGCTGATCGGATCGATCATCGTGCTGCTGAT TTACTTGCTGCGGTCGCGCCGCAACGTGCGATCTCGGGCCTGGGTGAAGG TCGGGTACATCGCGTTTGTGCTCGGCGGTGTCTATGCTGTGCTCCGGCCT AACGACACCACCGTGGTGGCGCACTGGTTTGGGGTATGCCGCGGAACTGA TCTGATGCTCTATGCACTAATTATGGCGTTCAGTTTTACTACGCTGAGCA TCTACATACGGTTCAAGGACTTGGAGTTGCGCTACGCGTGTTTGGCTCGC GTCGTTGCGCTGGAAGGAGCGCGCGCGCCCGAGCCGTTC
>NC_011896_1_WP_010907599_1_212_MLBR_RS01045 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR VVALEGARAPEPF >NC_002677_1_NP_301275_1_147_ML0208 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR VVALEGARAPEPF >NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR VVALEGARAPEPF >NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR VVALEGARAPEPF >NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRRPQSPQQCPVRC- ------------- >NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140 MNWIQVLLIGSIIVLLIYLLRSRRNVRSRAWVKVGYIAFVLGGVYAVLRP NDTTVVAHWFGVCRGTDLMLYALIMAFSFTTLSIYIRFKDLELRYACLAR VVALEGARAPEPF
#NEXUS
[ID: 0975441945]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907599_1_212_MLBR_RS01045
NC_002677_1_NP_301275_1_147_ML0208
NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105
NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595
NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105
NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907599_1_212_MLBR_RS01045,
2 NC_002677_1_NP_301275_1_147_ML0208,
3 NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105,
4 NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595,
5 NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105,
6 NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.002248303,2:0.002346398,3:0.002267212,4:0.002235917,5:0.2461242,6:0.002280897);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.002248303,2:0.002346398,3:0.002267212,4:0.002235917,5:0.2461242,6:0.002280897);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -600.52 -613.77
2 -600.52 -609.92
--------------------------------------
TOTAL -600.52 -613.09
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0208/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.298624 0.015739 0.112103 0.543842 0.274100 914.82 1004.15 1.000
r(A<->C){all} 0.250261 0.016986 0.000969 0.491888 0.237398 312.48 316.76 1.003
r(A<->G){all} 0.203171 0.014810 0.001069 0.433390 0.185778 297.00 420.38 1.000
r(A<->T){all} 0.112348 0.008344 0.000056 0.294181 0.090325 282.47 302.57 1.002
r(C<->G){all} 0.162278 0.010000 0.000281 0.358641 0.146816 281.68 368.77 1.005
r(C<->T){all} 0.129631 0.007542 0.000049 0.296889 0.115126 358.52 365.00 1.004
r(G<->T){all} 0.142311 0.007460 0.002392 0.309241 0.129255 343.12 381.81 1.000
pi(A){all} 0.160717 0.000364 0.123610 0.197835 0.159655 1108.72 1205.55 1.000
pi(C){all} 0.271864 0.000504 0.231233 0.317202 0.271774 1219.00 1261.51 1.000
pi(G){all} 0.313788 0.000555 0.268238 0.361514 0.313226 1272.53 1302.47 1.000
pi(T){all} 0.253631 0.000484 0.211894 0.297924 0.253538 1335.13 1418.07 1.001
alpha{1,2} 0.325615 0.126679 0.000114 1.073284 0.208654 1011.22 1074.80 1.000
alpha{3} 0.568945 0.246111 0.000269 1.525811 0.438244 1158.85 1269.80 1.000
pinvar{all} 0.454302 0.042575 0.067151 0.809308 0.468668 681.66 734.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/4res/ML0208/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 99
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 0 1
TTC 2 2 2 2 1 2 | TCC 0 0 0 0 0 0 | TAC 4 4 4 4 3 4 | TGC 1 1 1 1 3 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 1 4 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 1 1 2 1 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 1 0
CTC 3 3 3 3 3 3 | CCC 0 0 0 0 2 0 | CAC 1 1 1 1 1 1 | CGC 4 4 4 4 3 4
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 3 0 | CGA 1 1 1 1 2 1
CTG 7 7 7 7 7 7 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 4 4 4 4 3 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 2 2 2 2 2 2 | AAC 3 3 3 3 3 3 | AGC 1 1 1 1 1 1
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 2 2 2 2 1 2 | AGG 0 0 0 0 1 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 1 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 1 1 1 1 1 1
GTC 2 2 2 2 3 2 | GCC 1 1 1 1 1 1 | GAC 2 2 2 2 1 2 | GGC 1 1 1 1 1 1
GTA 1 1 1 1 1 1 | GCA 1 1 1 1 1 1 | Glu GAA 0 0 0 0 0 0 | GGA 2 2 2 2 2 2
GTG 8 8 8 8 8 8 | GCG 4 4 4 4 3 4 | GAG 1 1 1 1 0 1 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907599_1_212_MLBR_RS01045
position 1: T:0.23232 C:0.23232 A:0.24242 G:0.29293
position 2: T:0.43434 C:0.17172 A:0.17172 G:0.22222
position 3: T:0.17172 C:0.33333 A:0.07071 G:0.42424
Average T:0.27946 C:0.24579 A:0.16162 G:0.31313
#2: NC_002677_1_NP_301275_1_147_ML0208
position 1: T:0.23232 C:0.23232 A:0.24242 G:0.29293
position 2: T:0.43434 C:0.17172 A:0.17172 G:0.22222
position 3: T:0.17172 C:0.33333 A:0.07071 G:0.42424
Average T:0.27946 C:0.24579 A:0.16162 G:0.31313
#3: NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105
position 1: T:0.23232 C:0.23232 A:0.24242 G:0.29293
position 2: T:0.43434 C:0.17172 A:0.17172 G:0.22222
position 3: T:0.17172 C:0.33333 A:0.07071 G:0.42424
Average T:0.27946 C:0.24579 A:0.16162 G:0.31313
#4: NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595
position 1: T:0.23232 C:0.23232 A:0.24242 G:0.29293
position 2: T:0.43434 C:0.17172 A:0.17172 G:0.22222
position 3: T:0.17172 C:0.33333 A:0.07071 G:0.42424
Average T:0.27946 C:0.24579 A:0.16162 G:0.31313
#5: NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105
position 1: T:0.20202 C:0.29293 A:0.24242 G:0.26263
position 2: T:0.40404 C:0.19192 A:0.16162 G:0.24242
position 3: T:0.17172 C:0.34343 A:0.12121 G:0.36364
Average T:0.25926 C:0.27609 A:0.17508 G:0.28956
#6: NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140
position 1: T:0.23232 C:0.23232 A:0.24242 G:0.29293
position 2: T:0.43434 C:0.17172 A:0.17172 G:0.22222
position 3: T:0.17172 C:0.33333 A:0.07071 G:0.42424
Average T:0.27946 C:0.24579 A:0.16162 G:0.31313
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 5
TTC 11 | TCC 0 | TAC 23 | TGC 8
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 21 | TCG 12 | TAG 0 | Trp W TGG 18
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 7 | His H CAT 0 | Arg R CGT 1
CTC 18 | CCC 2 | CAC 6 | CGC 23
CTA 6 | CCA 0 | Gln Q CAA 3 | CGA 7
CTG 42 | CCG 0 | CAG 6 | CGG 23
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 12 | Asn N AAT 0 | Ser S AGT 6
ATC 36 | ACC 12 | AAC 18 | AGC 6
ATA 6 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 18 | ACG 6 | AAG 11 | AGG 1
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 11 | Asp D GAT 6 | Gly G GGT 6
GTC 13 | GCC 6 | GAC 11 | GGC 6
GTA 6 | GCA 6 | Glu E GAA 0 | GGA 12
GTG 48 | GCG 23 | GAG 5 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.22727 C:0.24242 A:0.24242 G:0.28788
position 2: T:0.42929 C:0.17508 A:0.17003 G:0.22559
position 3: T:0.17172 C:0.33502 A:0.07912 G:0.41414
Average T:0.27609 C:0.25084 A:0.16386 G:0.30920
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 13
lnL(ntime: 6 np: 8): -530.350256 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.349743 0.000004 0.993748 0.544651
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.349763
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.349743, 6: 0.000004);
(NC_011896_1_WP_010907599_1_212_MLBR_RS01045: 0.000004, NC_002677_1_NP_301275_1_147_ML0208: 0.000004, NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105: 0.000004, NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595: 0.000004, NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105: 0.349743, NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.99375
omega (dN/dS) = 0.54465
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 230.6 66.4 0.5447 0.0000 0.0000 0.0 0.0
7..2 0.000 230.6 66.4 0.5447 0.0000 0.0000 0.0 0.0
7..3 0.000 230.6 66.4 0.5447 0.0000 0.0000 0.0 0.0
7..4 0.000 230.6 66.4 0.5447 0.0000 0.0000 0.0 0.0
7..5 0.350 230.6 66.4 0.5447 0.0982 0.1803 22.6 12.0
7..6 0.000 230.6 66.4 0.5447 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0982
tree length for dS: 0.1803
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 13
lnL(ntime: 6 np: 9): -520.039316 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.429335 0.000004 0.729818 0.761473 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.429355
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.429335, 6: 0.000004);
(NC_011896_1_WP_010907599_1_212_MLBR_RS01045: 0.000004, NC_002677_1_NP_301275_1_147_ML0208: 0.000004, NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105: 0.000004, NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595: 0.000004, NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105: 0.429335, NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.72982
MLEs of dN/dS (w) for site classes (K=2)
p: 0.76147 0.23853
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 232.6 64.4 0.2385 0.0000 0.0000 0.0 0.0
7..2 0.000 232.6 64.4 0.2385 0.0000 0.0000 0.0 0.0
7..3 0.000 232.6 64.4 0.2385 0.0000 0.0000 0.0 0.0
7..4 0.000 232.6 64.4 0.2385 0.0000 0.0000 0.0 0.0
7..5 0.429 232.6 64.4 0.2385 0.0846 0.3545 19.7 22.8
7..6 0.000 232.6 64.4 0.2385 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 13
lnL(ntime: 6 np: 11): -483.824138 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 9.246614 0.000004 0.104615 0.873661 0.000000 0.000001 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 9.246634
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 9.246614, 6: 0.000004);
(NC_011896_1_WP_010907599_1_212_MLBR_RS01045: 0.000004, NC_002677_1_NP_301275_1_147_ML0208: 0.000004, NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105: 0.000004, NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595: 0.000004, NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105: 9.246614, NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.10462
MLEs of dN/dS (w) for site classes (K=3)
p: 0.87366 0.00000 0.12634
w: 0.00000 1.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..2 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..3 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..4 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..5 9.247 239.2 57.8 126.2126 3.8200 0.0303 913.7 1.7
7..6 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 1.000** 999.000
89 K 1.000** 999.000
90 D 1.000** 999.000
91 L 1.000** 999.000
92 E 1.000** 999.000
93 L 1.000** 999.000
94 R 1.000** 999.000
95 Y 1.000** 998.999
96 A 1.000** 999.000
97 C 1.000** 999.000
98 L 1.000** 999.000
99 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 0.998** 10.262 +- 0.668
89 K 0.995** 10.236 +- 0.829
90 D 0.983* 10.122 +- 1.316
91 L 0.957* 9.872 +- 1.997
92 E 0.996** 10.248 +- 0.758
93 L 0.998** 10.268 +- 0.624
94 R 0.988* 10.168 +- 1.148
95 Y 0.901 9.343 +- 2.878
96 A 0.829 8.658 +- 3.612
97 C 0.997** 10.253 +- 0.731
98 L 0.993** 10.215 +- 0.942
99 A 0.991** 10.201 +- 1.006
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.289 0.204 0.145 0.105 0.077 0.057 0.043 0.033 0.026 0.021
w2: 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.025 0.155 0.816
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.000
0.001 0.000 0.000
0.007 0.003 0.001 0.000 0.000
0.005 0.008 0.010 0.004 0.002 0.000 0.000
0.001 0.004 0.007 0.012 0.014 0.006 0.003 0.000 0.000
0.000 0.001 0.002 0.005 0.011 0.017 0.020 0.008 0.003 0.000 0.000
0.000 0.000 0.000 0.001 0.002 0.008 0.016 0.026 0.030 0.012 0.005 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.001 0.004 0.013 0.025 0.039 0.045 0.017 0.007 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.006 0.021 0.040 0.060 0.068 0.025 0.009 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.004 0.010 0.034 0.065 0.093 0.104 0.036 0.013 0.000 0.000
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 13
lnL(ntime: 6 np: 9): -523.292832 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.391863 0.000004 0.593721 0.005000 0.046347
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.391883
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.391863, 6: 0.000004);
(NC_011896_1_WP_010907599_1_212_MLBR_RS01045: 0.000004, NC_002677_1_NP_301275_1_147_ML0208: 0.000004, NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105: 0.000004, NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595: 0.000004, NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105: 0.391863, NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.59372
Parameters in M7 (beta):
p = 0.00500 q = 0.04635
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.8 63.2 0.1000 0.0000 0.0000 0.0 0.0
7..2 0.000 233.8 63.2 0.1000 0.0000 0.0000 0.0 0.0
7..3 0.000 233.8 63.2 0.1000 0.0000 0.0000 0.0 0.0
7..4 0.000 233.8 63.2 0.1000 0.0000 0.0000 0.0 0.0
7..5 0.392 233.8 63.2 0.1000 0.0448 0.4479 10.5 28.3
7..6 0.000 233.8 63.2 0.1000 0.0000 0.0000 0.0 0.0
Time used: 0:12
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 13
lnL(ntime: 6 np: 11): -483.824132 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 9.246656 0.000004 0.104611 0.873661 0.005000 99.000000 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 9.246676
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 9.246656, 6: 0.000004);
(NC_011896_1_WP_010907599_1_212_MLBR_RS01045: 0.000004, NC_002677_1_NP_301275_1_147_ML0208: 0.000004, NZ_LVXE01000098_1_WP_010907599_1_2929_A3216_RS14105: 0.000004, NZ_LYPH01000069_1_WP_010907599_1_2410_A8144_RS11595: 0.000004, NZ_CP029543_1_WP_111480950_1_213_DIJ64_RS01105: 9.246656, NZ_AP014567_1_WP_010907599_1_220_JK2ML_RS01140: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.10461
Parameters in M8 (beta&w>1):
p0 = 0.87366 p = 0.00500 q = 99.00000
(p1 = 0.12634) w = 999.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.08737 0.08737 0.08737 0.08737 0.08737 0.08737 0.08737 0.08737 0.08737 0.08737 0.12634
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..2 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..3 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..4 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
7..5 9.247 239.2 57.8 126.2126 3.8200 0.0303 913.7 1.7
7..6 0.000 239.2 57.8 126.2126 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 1.000** 999.000
89 K 1.000** 999.000
90 D 1.000** 999.000
91 L 1.000** 999.000
92 E 1.000** 999.000
93 L 1.000** 999.000
94 R 1.000** 999.000
95 Y 1.000** 999.000
96 A 1.000** 999.000
97 C 1.000** 999.000
98 L 1.000** 999.000
99 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 0.999** 10.274 +- 0.575
89 K 0.998** 10.260 +- 0.682
90 D 0.991** 10.200 +- 1.016
91 L 0.972* 10.013 +- 1.671
92 E 0.998** 10.267 +- 0.635
93 L 0.999** 10.274 +- 0.578
94 R 0.993** 10.220 +- 0.919
95 Y 0.934 9.648 +- 2.446
96 A 0.881 9.126 +- 3.178
97 C 0.998** 10.268 +- 0.626
98 L 0.996** 10.243 +- 0.798
99 A 0.996** 10.242 +- 0.802
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.002 0.039 0.272 0.561 0.126 0.000
p : 0.298 0.181 0.126 0.094 0.074 0.060 0.051 0.044 0.039 0.035
q : 0.019 0.042 0.062 0.080 0.097 0.113 0.127 0.141 0.153 0.165
ws: 0.000 0.000 0.000 0.000 0.000 0.000 0.003 0.025 0.155 0.816
Time used: 0:32
Model 1: NearlyNeutral -520.039316
Model 2: PositiveSelection -483.824138
Model 0: one-ratio -530.350256
Model 7: beta -523.292832
Model 8: beta&w>1 -483.824132
Model 0 vs 1 20.62187999999992
Model 2 vs 1 72.43035599999996
Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 1.000** 999.000
89 K 1.000** 999.000
90 D 1.000** 999.000
91 L 1.000** 999.000
92 E 1.000** 999.000
93 L 1.000** 999.000
94 R 1.000** 999.000
95 Y 1.000** 998.999
96 A 1.000** 999.000
97 C 1.000** 999.000
98 L 1.000** 999.000
99 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 0.998** 10.262 +- 0.668
89 K 0.995** 10.236 +- 0.829
90 D 0.983* 10.122 +- 1.316
91 L 0.957* 9.872 +- 1.997
92 E 0.996** 10.248 +- 0.758
93 L 0.998** 10.268 +- 0.624
94 R 0.988* 10.168 +- 1.148
95 Y 0.901 9.343 +- 2.878
96 A 0.829 8.658 +- 3.612
97 C 0.997** 10.253 +- 0.731
98 L 0.993** 10.215 +- 0.942
99 A 0.991** 10.201 +- 1.006
Model 8 vs 7 78.93739999999991
Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 1.000** 999.000
89 K 1.000** 999.000
90 D 1.000** 999.000
91 L 1.000** 999.000
92 E 1.000** 999.000
93 L 1.000** 999.000
94 R 1.000** 999.000
95 Y 1.000** 999.000
96 A 1.000** 999.000
97 C 1.000** 999.000
98 L 1.000** 999.000
99 A 1.000** 999.000
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907599_1_212_MLBR_RS01045)
Pr(w>1) post mean +- SE for w
88 F 0.999** 10.274 +- 0.575
89 K 0.998** 10.260 +- 0.682
90 D 0.991** 10.200 +- 1.016
91 L 0.972* 10.013 +- 1.671
92 E 0.998** 10.267 +- 0.635
93 L 0.999** 10.274 +- 0.578
94 R 0.993** 10.220 +- 0.919
95 Y 0.934 9.648 +- 2.446
96 A 0.881 9.126 +- 3.178
97 C 0.998** 10.268 +- 0.626
98 L 0.996** 10.243 +- 0.798
99 A 0.996** 10.242 +- 0.802
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
