--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:18:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/secG/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -316.58 -320.82
2 -316.56 -321.50
--------------------------------------
TOTAL -316.57 -321.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884991 0.088870 0.372568 1.486494 0.848733 1151.18 1248.86 1.000
r(A<->C){all} 0.164010 0.017891 0.000141 0.424871 0.129783 143.84 158.73 1.006
r(A<->G){all} 0.163601 0.019046 0.000029 0.436627 0.129349 242.64 275.45 1.000
r(A<->T){all} 0.163587 0.018602 0.000014 0.439088 0.132149 201.87 215.14 1.000
r(C<->G){all} 0.169234 0.019252 0.000005 0.440734 0.136021 176.67 182.08 1.003
r(C<->T){all} 0.173853 0.020658 0.000165 0.467439 0.135131 151.44 171.91 1.000
r(G<->T){all} 0.165715 0.019161 0.000134 0.438866 0.134164 213.01 252.77 1.002
pi(A){all} 0.169777 0.000587 0.122379 0.217060 0.168673 1142.31 1205.99 1.000
pi(C){all} 0.251185 0.000785 0.195625 0.305239 0.250501 1277.45 1303.36 1.000
pi(G){all} 0.315517 0.000924 0.255047 0.372915 0.315347 1266.64 1295.14 1.000
pi(T){all} 0.263521 0.000808 0.209767 0.320148 0.262995 1312.39 1406.69 1.000
alpha{1,2} 0.419431 0.223093 0.000180 1.370737 0.254492 770.77 1030.31 1.000
alpha{3} 0.445868 0.226961 0.000172 1.403514 0.287029 1314.36 1355.74 1.000
pinvar{all} 0.992879 0.000076 0.976604 0.999997 0.995721 1086.88 1189.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -297.443684
Model 2: PositiveSelection -297.443465
Model 0: one-ratio -297.443465
Model 7: beta -297.443684
Model 8: beta&w>1 -297.443465
Model 0 vs 1 4.380000000310247E-4
Model 2 vs 1 4.380000000310247E-4
Model 8 vs 7 4.380000000310247E-4
>C1
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C2
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C3
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C4
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C5
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C6
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=77
C1 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C2 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C3 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C4 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C5 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C6 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
**************************************************
C1 NLDRLTLFVTGIWLVSIIGVALLTKYR
C2 NLDRLTLFVTGIWLVSIIGVALLTKYR
C3 NLDRLTLFVTGIWLVSIIGVALLTKYR
C4 NLDRLTLFVTGIWLVSIIGVALLTKYR
C5 NLDRLTLFVTGIWLVSIIGVALLTKYR
C6 NLDRLTLFVTGIWLVSIIGVALLTKYR
***************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 77 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 77 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2310]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2310]--->[2310]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.432 Mb, Max= 30.582 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C2 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C3 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C4 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C5 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C6 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
**************************************************
C1 NLDRLTLFVTGIWLVSIIGVALLTKYR
C2 NLDRLTLFVTGIWLVSIIGVALLTKYR
C3 NLDRLTLFVTGIWLVSIIGVALLTKYR
C4 NLDRLTLFVTGIWLVSIIGVALLTKYR
C5 NLDRLTLFVTGIWLVSIIGVALLTKYR
C6 NLDRLTLFVTGIWLVSIIGVALLTKYR
***************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C2 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C3 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C4 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C5 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C6 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
**************************************************
C1 GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C2 GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C3 GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C4 GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C5 GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C6 GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
**************************************************
C1 TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C2 TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C3 TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C4 TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C5 TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C6 TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
**************************************************
C1 AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C2 AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C3 AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C4 AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C5 AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C6 AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
**************************************************
C1 TATCGGCGTAGCCCTGCTAACTAAATACCGT
C2 TATCGGCGTAGCCCTGCTAACTAAATACCGT
C3 TATCGGCGTAGCCCTGCTAACTAAATACCGT
C4 TATCGGCGTAGCCCTGCTAACTAAATACCGT
C5 TATCGGCGTAGCCCTGCTAACTAAATACCGT
C6 TATCGGCGTAGCCCTGCTAACTAAATACCGT
*******************************
>C1
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C2
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C3
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C4
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C5
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C6
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C1
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C2
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C3
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C4
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C5
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C6
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 231 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579789066
Setting output file names to "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2101055562
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0425343050
Seed = 1502308910
Swapseed = 1579789066
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -516.989042 -- -24.965149
Chain 2 -- -516.989042 -- -24.965149
Chain 3 -- -516.989072 -- -24.965149
Chain 4 -- -516.989072 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -516.989042 -- -24.965149
Chain 2 -- -516.989042 -- -24.965149
Chain 3 -- -516.989072 -- -24.965149
Chain 4 -- -516.989042 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-516.989] (-516.989) (-516.989) (-516.989) * [-516.989] (-516.989) (-516.989) (-516.989)
500 -- (-318.491) (-328.086) [-321.594] (-328.042) * [-330.869] (-332.657) (-325.984) (-326.316) -- 0:00:00
1000 -- (-326.288) (-335.902) [-331.717] (-326.272) * (-328.795) (-324.060) (-328.343) [-324.291] -- 0:00:00
1500 -- (-327.259) (-321.727) [-326.113] (-329.003) * (-324.987) (-328.956) (-335.838) [-327.269] -- 0:00:00
2000 -- (-330.467) [-329.626] (-328.866) (-326.729) * (-323.900) [-325.588] (-332.618) (-325.631) -- 0:00:00
2500 -- (-330.097) (-328.401) [-325.206] (-329.642) * [-322.871] (-325.127) (-329.400) (-331.966) -- 0:00:00
3000 -- [-321.337] (-329.192) (-323.385) (-324.488) * (-321.437) (-325.637) [-330.239] (-324.307) -- 0:00:00
3500 -- (-335.407) (-320.567) [-325.845] (-322.445) * (-328.684) [-318.542] (-319.994) (-323.797) -- 0:00:00
4000 -- (-325.717) (-321.927) [-325.294] (-325.622) * [-327.855] (-321.499) (-327.966) (-323.782) -- 0:00:00
4500 -- [-322.980] (-323.778) (-327.023) (-322.535) * [-322.258] (-332.289) (-327.926) (-328.250) -- 0:00:00
5000 -- [-323.715] (-333.932) (-334.257) (-332.082) * (-322.896) (-327.110) (-328.323) [-327.431] -- 0:00:00
Average standard deviation of split frequencies: 0.099995
5500 -- (-326.274) [-326.235] (-325.865) (-323.388) * [-328.143] (-327.477) (-325.014) (-323.651) -- 0:00:00
6000 -- [-322.742] (-324.383) (-330.504) (-336.626) * (-335.623) (-326.280) [-331.050] (-324.852) -- 0:00:00
6500 -- [-327.487] (-330.187) (-327.354) (-325.780) * (-328.032) (-338.960) [-326.613] (-328.805) -- 0:00:00
7000 -- [-324.794] (-336.249) (-325.449) (-325.833) * (-324.995) (-337.954) (-330.818) [-321.563] -- 0:00:00
7500 -- [-324.444] (-327.959) (-322.975) (-326.860) * (-328.200) (-334.506) [-327.974] (-324.593) -- 0:00:00
8000 -- (-322.317) (-325.530) [-329.887] (-326.301) * [-328.525] (-350.844) (-324.112) (-328.589) -- 0:00:00
8500 -- (-326.324) [-326.583] (-329.994) (-327.720) * [-320.194] (-334.906) (-329.038) (-333.815) -- 0:00:00
9000 -- (-338.240) (-331.886) [-324.617] (-324.463) * (-330.756) (-321.767) (-332.857) [-321.419] -- 0:00:00
9500 -- (-329.855) (-331.231) (-327.416) [-322.536] * (-331.195) [-316.935] (-327.172) (-328.769) -- 0:00:00
10000 -- [-327.295] (-324.612) (-325.122) (-332.931) * (-322.230) (-317.678) [-331.021] (-326.461) -- 0:00:00
Average standard deviation of split frequencies: 0.079970
10500 -- [-326.637] (-334.862) (-327.824) (-324.776) * (-331.493) (-317.089) (-343.886) [-320.601] -- 0:00:00
11000 -- (-322.205) (-326.681) [-320.801] (-324.277) * (-326.781) (-316.335) (-332.156) [-327.965] -- 0:01:29
11500 -- [-321.366] (-323.262) (-326.313) (-321.277) * (-325.458) (-316.170) [-329.976] (-321.721) -- 0:01:25
12000 -- (-328.025) [-323.517] (-330.951) (-329.293) * [-324.667] (-316.371) (-323.418) (-317.711) -- 0:01:22
12500 -- [-322.682] (-348.199) (-331.237) (-324.385) * (-330.122) (-315.769) [-328.865] (-317.236) -- 0:01:19
13000 -- (-331.510) (-336.330) [-329.073] (-325.862) * [-330.020] (-318.122) (-325.969) (-317.423) -- 0:01:15
13500 -- (-331.529) (-335.400) [-324.490] (-327.387) * (-327.276) (-315.608) (-320.351) [-318.143] -- 0:01:13
14000 -- (-331.949) (-327.066) [-326.508] (-326.454) * [-322.271] (-317.603) (-330.264) (-317.461) -- 0:01:10
14500 -- (-334.435) [-319.664] (-336.953) (-328.898) * (-321.471) [-319.423] (-335.709) (-318.342) -- 0:01:07
15000 -- (-325.554) (-316.565) (-331.828) [-327.076] * (-326.977) [-319.173] (-338.159) (-320.165) -- 0:01:05
Average standard deviation of split frequencies: 0.068230
15500 -- (-332.821) (-316.194) [-325.431] (-330.360) * [-325.784] (-318.617) (-327.822) (-320.525) -- 0:01:03
16000 -- [-328.700] (-318.690) (-338.258) (-330.009) * (-324.814) [-315.478] (-333.480) (-317.414) -- 0:01:01
16500 -- (-326.602) [-318.905] (-327.568) (-328.438) * (-329.344) (-318.962) (-329.812) [-317.646] -- 0:00:59
17000 -- (-325.802) (-319.382) [-328.664] (-328.533) * (-329.638) (-320.634) (-326.383) [-317.860] -- 0:00:57
17500 -- (-329.602) (-321.287) [-320.157] (-329.615) * (-324.646) [-317.873] (-322.791) (-322.779) -- 0:00:56
18000 -- [-325.659] (-317.501) (-327.912) (-319.019) * (-327.387) [-316.930] (-327.899) (-316.727) -- 0:00:54
18500 -- [-318.861] (-317.208) (-326.372) (-324.636) * [-327.974] (-316.437) (-333.760) (-317.618) -- 0:00:53
19000 -- (-322.573) (-317.063) (-327.754) [-328.946] * (-322.592) [-315.792] (-320.110) (-318.039) -- 0:00:51
19500 -- (-319.088) (-320.220) (-327.255) [-327.696] * (-343.797) [-315.539] (-326.400) (-318.204) -- 0:00:50
20000 -- (-325.584) (-317.330) (-326.908) [-332.084] * (-335.599) [-318.569] (-327.607) (-321.529) -- 0:00:49
Average standard deviation of split frequencies: 0.060026
20500 -- (-322.409) (-321.271) [-324.414] (-324.279) * (-334.983) [-316.701] (-326.907) (-320.950) -- 0:00:47
21000 -- [-320.941] (-316.005) (-324.770) (-322.894) * (-337.845) [-316.482] (-326.985) (-316.142) -- 0:00:46
21500 -- (-317.921) [-321.548] (-328.561) (-332.096) * (-327.448) (-316.743) (-327.327) [-317.777] -- 0:00:45
22000 -- (-320.905) (-317.434) [-323.653] (-323.300) * (-326.449) (-318.237) (-329.099) [-317.820] -- 0:00:44
22500 -- (-318.502) (-321.931) [-320.598] (-335.406) * [-323.067] (-317.421) (-323.575) (-317.140) -- 0:00:43
23000 -- [-316.429] (-317.696) (-333.073) (-327.007) * (-320.851) [-316.534] (-320.798) (-319.472) -- 0:00:42
23500 -- (-318.118) (-319.097) [-327.932] (-330.467) * (-316.719) (-317.832) (-325.597) [-318.146] -- 0:00:41
24000 -- [-318.079] (-321.839) (-332.880) (-321.563) * (-317.994) [-318.746] (-323.746) (-319.374) -- 0:00:40
24500 -- [-317.572] (-317.753) (-334.575) (-325.045) * (-316.708) [-315.490] (-340.337) (-316.126) -- 0:00:39
25000 -- (-318.188) (-321.640) (-328.792) [-329.534] * (-320.452) [-315.150] (-333.817) (-318.560) -- 0:00:39
Average standard deviation of split frequencies: 0.049213
25500 -- (-319.239) (-317.263) (-328.845) [-323.272] * (-321.499) [-316.263] (-323.181) (-316.738) -- 0:00:38
26000 -- (-316.736) [-318.606] (-333.163) (-321.997) * (-317.556) (-315.973) [-316.969] (-319.307) -- 0:01:14
26500 -- (-317.954) (-316.559) [-329.924] (-327.912) * (-315.957) [-318.507] (-317.057) (-317.606) -- 0:01:13
27000 -- (-317.351) (-316.895) (-329.892) [-330.372] * (-315.667) (-324.413) [-317.569] (-318.765) -- 0:01:12
27500 -- (-317.179) [-318.046] (-322.023) (-341.781) * (-316.315) (-318.044) (-317.852) [-317.685] -- 0:01:10
28000 -- (-316.718) [-316.066] (-329.431) (-315.213) * [-316.542] (-316.774) (-316.317) (-324.131) -- 0:01:09
28500 -- (-315.342) (-316.818) (-328.332) [-316.213] * (-315.599) [-315.528] (-315.617) (-320.593) -- 0:01:08
29000 -- (-315.838) (-316.361) (-323.368) [-316.545] * (-317.370) (-318.641) [-318.497] (-318.382) -- 0:01:06
29500 -- [-318.601] (-318.851) (-321.242) (-315.561) * (-317.527) (-319.776) (-317.267) [-317.791] -- 0:01:05
30000 -- (-315.672) (-316.824) (-333.435) [-315.605] * (-318.259) (-317.686) [-317.141] (-315.658) -- 0:01:04
Average standard deviation of split frequencies: 0.036407
30500 -- [-318.433] (-319.092) (-328.765) (-317.516) * (-317.316) [-316.962] (-318.444) (-316.455) -- 0:01:03
31000 -- [-316.913] (-317.009) (-320.592) (-318.659) * (-319.253) [-316.162] (-316.936) (-315.825) -- 0:01:02
31500 -- [-317.225] (-316.581) (-325.193) (-319.478) * [-315.376] (-315.941) (-319.253) (-316.336) -- 0:01:01
32000 -- (-319.175) (-316.980) (-338.858) [-318.587] * (-316.901) [-315.368] (-320.916) (-317.139) -- 0:01:00
32500 -- (-323.779) (-315.760) (-324.484) [-319.568] * (-319.926) (-318.382) [-320.404] (-319.533) -- 0:00:59
33000 -- (-319.468) (-316.944) [-320.811] (-322.079) * (-318.816) (-317.294) (-317.018) [-316.052] -- 0:00:58
33500 -- [-319.617] (-316.902) (-327.793) (-320.345) * [-320.061] (-316.891) (-319.992) (-317.298) -- 0:00:57
34000 -- (-319.485) [-316.082] (-330.958) (-317.565) * (-317.820) [-316.790] (-317.966) (-317.007) -- 0:00:56
34500 -- (-316.784) [-315.735] (-327.092) (-315.933) * (-318.795) (-316.606) (-316.782) [-317.515] -- 0:00:55
35000 -- (-317.290) (-316.912) (-345.165) [-317.778] * (-318.657) (-316.045) [-316.565] (-316.192) -- 0:00:55
Average standard deviation of split frequencies: 0.035542
35500 -- [-320.773] (-316.660) (-341.855) (-316.474) * [-319.062] (-316.508) (-317.239) (-319.739) -- 0:00:54
36000 -- (-317.883) [-315.853] (-329.036) (-320.066) * (-319.540) [-318.413] (-321.395) (-322.576) -- 0:00:53
36500 -- (-316.816) [-315.839] (-319.746) (-318.869) * [-318.011] (-319.481) (-319.151) (-320.536) -- 0:00:52
37000 -- (-319.404) [-316.737] (-323.999) (-317.167) * (-316.635) [-316.615] (-320.061) (-316.146) -- 0:00:52
37500 -- [-320.552] (-317.263) (-315.749) (-316.665) * (-317.592) [-319.395] (-318.540) (-317.218) -- 0:00:51
38000 -- (-317.944) [-320.612] (-316.186) (-315.894) * [-315.593] (-316.275) (-319.888) (-316.751) -- 0:00:50
38500 -- (-316.357) (-320.141) [-318.888] (-316.354) * (-318.521) (-316.957) [-320.362] (-316.900) -- 0:00:49
39000 -- [-317.799] (-316.350) (-317.937) (-318.634) * (-319.689) (-316.907) [-319.924] (-317.559) -- 0:00:49
39500 -- (-319.725) (-316.731) [-317.279] (-316.883) * (-318.656) [-317.161] (-317.027) (-316.894) -- 0:00:48
40000 -- (-317.257) (-319.368) [-317.557] (-318.762) * [-318.222] (-318.802) (-315.726) (-316.606) -- 0:00:48
Average standard deviation of split frequencies: 0.030268
40500 -- (-318.683) (-317.106) [-319.433] (-322.829) * (-319.950) (-317.777) (-316.588) [-320.249] -- 0:00:47
41000 -- (-318.950) [-315.380] (-319.891) (-323.243) * (-317.378) [-317.228] (-315.578) (-316.046) -- 0:01:10
41500 -- (-316.851) (-316.513) [-316.117] (-322.063) * (-315.107) [-318.524] (-316.877) (-316.552) -- 0:01:09
42000 -- (-323.470) (-319.197) [-318.276] (-315.404) * (-315.573) [-315.847] (-315.774) (-318.954) -- 0:01:08
42500 -- [-316.135] (-318.273) (-316.222) (-317.228) * (-316.458) (-316.312) [-316.575] (-319.327) -- 0:01:07
43000 -- (-316.389) [-317.810] (-317.010) (-318.448) * [-318.413] (-316.166) (-316.682) (-322.647) -- 0:01:06
43500 -- [-318.022] (-317.577) (-319.062) (-320.624) * (-317.636) (-318.060) [-317.167] (-321.898) -- 0:01:05
44000 -- (-315.966) (-319.037) (-317.297) [-321.030] * [-316.668] (-316.563) (-318.073) (-322.052) -- 0:01:05
44500 -- (-318.260) [-317.265] (-316.942) (-316.737) * (-316.194) (-317.294) [-318.387] (-315.250) -- 0:01:04
45000 -- (-317.217) [-317.684] (-316.398) (-316.560) * (-317.071) (-316.461) [-318.404] (-316.666) -- 0:01:03
Average standard deviation of split frequencies: 0.031283
45500 -- (-318.227) [-319.057] (-319.529) (-319.333) * (-317.048) (-316.180) [-317.555] (-318.813) -- 0:01:02
46000 -- (-318.682) (-316.188) [-317.136] (-316.313) * (-319.582) (-317.515) [-317.700] (-320.223) -- 0:01:02
46500 -- (-319.962) [-319.445] (-317.050) (-318.335) * (-318.609) [-318.288] (-318.252) (-318.157) -- 0:01:01
47000 -- [-316.843] (-322.077) (-317.973) (-317.590) * (-319.898) [-315.134] (-316.529) (-320.469) -- 0:01:00
47500 -- [-318.094] (-318.003) (-318.506) (-318.310) * (-316.481) [-317.306] (-318.868) (-321.696) -- 0:01:00
48000 -- (-319.081) (-318.973) [-315.677] (-317.270) * (-316.647) (-317.598) [-318.373] (-318.383) -- 0:00:59
48500 -- (-321.730) [-317.145] (-315.912) (-320.898) * (-316.367) [-315.534] (-323.630) (-317.950) -- 0:00:58
49000 -- (-316.134) (-316.466) [-316.542] (-316.989) * (-316.691) [-317.530] (-317.353) (-320.811) -- 0:00:58
49500 -- (-317.916) (-316.988) [-316.595] (-320.666) * (-318.862) (-320.966) [-318.398] (-317.367) -- 0:00:57
50000 -- (-322.374) (-319.125) [-316.419] (-315.493) * (-320.157) (-317.728) [-317.037] (-315.169) -- 0:00:57
Average standard deviation of split frequencies: 0.034425
50500 -- [-319.184] (-317.925) (-316.977) (-319.750) * (-317.226) (-322.672) [-317.786] (-315.294) -- 0:00:56
51000 -- (-318.029) (-315.654) (-315.376) [-316.285] * (-318.772) (-319.905) [-317.111] (-317.302) -- 0:00:55
51500 -- [-315.545] (-317.420) (-318.724) (-316.147) * [-316.335] (-316.726) (-319.990) (-316.398) -- 0:00:55
52000 -- [-319.273] (-317.519) (-320.916) (-319.585) * [-315.248] (-317.135) (-318.187) (-319.796) -- 0:00:54
52500 -- (-326.405) (-317.130) [-318.840] (-316.650) * (-319.669) [-320.228] (-316.505) (-321.446) -- 0:00:54
53000 -- (-318.945) (-316.262) [-315.950] (-318.903) * [-317.190] (-319.936) (-316.795) (-317.008) -- 0:00:53
53500 -- (-317.856) [-318.575] (-318.426) (-316.847) * (-319.777) (-317.263) [-317.292] (-318.168) -- 0:00:53
54000 -- (-316.767) (-315.869) [-317.853] (-318.121) * (-325.915) (-315.641) [-318.238] (-317.684) -- 0:00:52
54500 -- (-318.072) [-317.649] (-316.981) (-316.299) * (-320.069) (-316.258) [-316.295] (-315.862) -- 0:00:52
55000 -- (-318.351) [-317.810] (-315.964) (-316.979) * (-315.905) (-318.257) (-316.872) [-316.869] -- 0:00:51
Average standard deviation of split frequencies: 0.037216
55500 -- (-317.315) [-316.465] (-315.800) (-317.420) * (-316.023) [-317.730] (-317.920) (-317.300) -- 0:00:51
56000 -- (-316.116) (-322.151) [-318.234] (-317.087) * (-316.118) [-317.687] (-318.105) (-317.582) -- 0:00:50
56500 -- (-316.658) [-316.434] (-316.650) (-316.531) * (-316.098) [-316.985] (-316.602) (-321.291) -- 0:00:50
57000 -- (-320.475) (-316.285) (-317.478) [-316.057] * (-317.080) (-315.872) [-317.492] (-320.185) -- 0:01:06
57500 -- [-318.203] (-315.675) (-315.312) (-315.657) * (-316.458) [-315.517] (-322.018) (-316.092) -- 0:01:05
58000 -- [-316.464] (-316.443) (-316.264) (-320.216) * (-315.947) (-315.908) [-324.765] (-319.088) -- 0:01:04
58500 -- [-315.431] (-316.779) (-320.010) (-316.567) * [-319.028] (-317.879) (-327.031) (-319.585) -- 0:01:04
59000 -- (-315.583) [-317.366] (-323.048) (-317.166) * (-315.801) (-317.397) (-315.577) [-316.854] -- 0:01:03
59500 -- (-315.385) (-320.754) (-321.611) [-315.657] * (-318.930) [-321.949] (-320.039) (-320.473) -- 0:01:03
60000 -- (-316.309) (-320.277) (-318.652) [-318.376] * [-315.173] (-321.911) (-315.725) (-319.016) -- 0:01:02
Average standard deviation of split frequencies: 0.035989
60500 -- (-315.715) (-321.018) [-316.561] (-316.663) * (-318.516) (-320.848) [-316.230] (-319.158) -- 0:01:02
61000 -- [-315.567] (-315.493) (-318.565) (-316.798) * (-318.716) (-317.850) (-315.579) [-316.777] -- 0:01:01
61500 -- (-316.099) (-316.288) (-316.360) [-316.111] * (-317.526) (-318.552) (-317.548) [-316.488] -- 0:01:01
62000 -- (-316.926) (-318.302) [-316.492] (-316.294) * [-318.298] (-319.343) (-316.388) (-318.718) -- 0:01:00
62500 -- (-317.884) (-316.564) (-317.291) [-316.145] * (-316.042) [-316.583] (-318.207) (-316.493) -- 0:01:00
63000 -- (-319.371) (-318.252) [-318.306] (-318.867) * (-316.960) (-319.414) (-315.732) [-316.530] -- 0:00:59
63500 -- (-317.240) [-316.236] (-320.073) (-315.352) * (-318.091) (-317.517) (-315.421) [-316.937] -- 0:00:58
64000 -- (-316.680) [-316.733] (-318.305) (-317.831) * (-316.323) (-315.610) [-316.682] (-315.818) -- 0:00:58
64500 -- (-322.355) (-316.528) [-315.210] (-317.518) * (-316.403) (-318.587) [-320.415] (-316.161) -- 0:00:58
65000 -- (-316.088) (-315.658) [-315.232] (-316.337) * (-321.878) (-320.385) (-318.339) [-314.992] -- 0:00:57
Average standard deviation of split frequencies: 0.029322
65500 -- (-320.214) (-317.109) (-315.285) [-316.979] * (-318.230) [-316.665] (-315.829) (-317.621) -- 0:00:57
66000 -- (-317.892) (-317.564) (-318.446) [-317.939] * (-317.136) (-317.497) [-317.591] (-318.052) -- 0:00:56
66500 -- (-316.846) [-315.345] (-318.405) (-317.090) * (-317.784) (-319.036) [-318.841] (-316.295) -- 0:00:56
67000 -- (-318.313) (-317.731) [-318.180] (-317.702) * (-316.163) (-316.938) [-319.997] (-316.946) -- 0:00:55
67500 -- (-317.558) (-319.284) [-316.734] (-319.121) * (-316.576) [-317.211] (-319.849) (-319.252) -- 0:00:55
68000 -- (-319.794) (-319.698) [-317.763] (-317.707) * [-315.822] (-322.031) (-316.535) (-315.863) -- 0:00:54
68500 -- [-320.118] (-317.507) (-315.895) (-317.153) * (-319.327) (-321.175) (-316.239) [-315.292] -- 0:00:54
69000 -- (-316.984) [-316.541] (-316.885) (-319.915) * (-318.776) (-321.806) [-316.806] (-318.228) -- 0:00:53
69500 -- (-316.752) (-317.001) [-316.168] (-316.958) * (-318.008) (-320.806) [-320.893] (-318.369) -- 0:00:53
70000 -- (-317.626) (-315.552) (-316.132) [-315.579] * [-316.201] (-317.253) (-315.465) (-318.059) -- 0:00:53
Average standard deviation of split frequencies: 0.025349
70500 -- (-316.344) [-316.310] (-317.600) (-316.834) * (-316.272) [-315.345] (-316.073) (-316.137) -- 0:00:52
71000 -- (-317.167) [-316.092] (-316.279) (-317.209) * (-315.766) (-316.606) (-318.655) [-315.431] -- 0:00:52
71500 -- [-318.049] (-315.504) (-315.262) (-316.995) * (-317.358) [-318.161] (-320.420) (-317.911) -- 0:00:51
72000 -- (-317.494) (-319.205) (-315.311) [-320.681] * (-316.048) [-320.877] (-316.467) (-319.018) -- 0:00:51
72500 -- [-319.554] (-321.334) (-316.737) (-317.230) * (-316.039) (-319.304) (-317.229) [-319.175] -- 0:00:51
73000 -- (-316.514) [-317.914] (-316.845) (-316.863) * (-316.211) (-317.708) [-319.659] (-317.616) -- 0:00:50
73500 -- (-318.253) [-319.807] (-316.861) (-317.834) * [-317.248] (-317.952) (-320.938) (-318.247) -- 0:01:03
74000 -- (-322.097) [-319.241] (-317.739) (-315.611) * [-315.671] (-318.108) (-316.250) (-317.961) -- 0:01:02
74500 -- (-319.663) (-317.597) [-316.320] (-318.806) * (-317.285) (-317.479) [-318.922] (-319.047) -- 0:01:02
75000 -- (-316.555) [-315.286] (-317.152) (-315.605) * [-316.127] (-318.803) (-320.173) (-318.258) -- 0:01:01
Average standard deviation of split frequencies: 0.025121
75500 -- (-318.435) (-315.852) [-316.898] (-316.581) * (-316.663) [-316.411] (-318.949) (-316.432) -- 0:01:01
76000 -- (-317.419) (-318.820) (-319.484) [-316.491] * (-321.623) (-318.677) (-316.372) [-321.692] -- 0:01:00
76500 -- [-315.480] (-319.169) (-315.199) (-323.350) * (-317.738) [-317.782] (-317.988) (-315.679) -- 0:01:00
77000 -- (-315.831) (-318.175) [-318.790] (-321.627) * [-318.269] (-318.704) (-318.189) (-317.834) -- 0:00:59
77500 -- (-315.684) (-320.583) [-318.002] (-317.405) * (-316.843) (-316.900) (-317.334) [-316.825] -- 0:00:59
78000 -- [-316.834] (-317.298) (-318.476) (-316.877) * (-317.864) (-316.686) (-316.665) [-317.004] -- 0:00:59
78500 -- [-316.316] (-316.611) (-316.089) (-317.393) * (-316.619) [-315.825] (-322.938) (-319.525) -- 0:00:58
79000 -- (-316.257) (-318.234) [-316.027] (-315.927) * (-317.268) (-315.244) [-315.575] (-319.731) -- 0:00:58
79500 -- (-319.186) [-316.681] (-317.351) (-316.164) * (-316.238) [-316.805] (-318.544) (-317.711) -- 0:00:57
80000 -- (-317.552) (-317.533) [-316.406] (-320.215) * [-317.272] (-317.794) (-318.076) (-327.681) -- 0:00:57
Average standard deviation of split frequencies: 0.029511
80500 -- (-317.531) [-315.861] (-316.301) (-320.167) * (-322.175) (-315.985) [-316.748] (-320.696) -- 0:00:57
81000 -- (-320.600) [-316.561] (-318.554) (-321.355) * (-316.192) (-318.094) [-315.690] (-317.022) -- 0:00:56
81500 -- (-319.338) (-315.641) (-318.992) [-319.200] * (-316.966) (-317.579) [-318.451] (-315.912) -- 0:00:56
82000 -- (-317.377) [-316.926] (-323.048) (-316.781) * (-318.138) (-317.035) (-315.341) [-316.982] -- 0:00:55
82500 -- (-315.714) (-318.830) (-317.580) [-317.816] * (-315.785) (-323.278) (-314.877) [-323.756] -- 0:00:55
83000 -- (-322.280) (-320.254) (-315.074) [-316.607] * (-315.159) (-315.541) [-317.554] (-317.175) -- 0:00:55
83500 -- (-320.060) [-316.423] (-321.049) (-315.564) * (-316.011) [-315.611] (-321.117) (-318.049) -- 0:00:54
84000 -- (-315.909) (-317.146) [-316.476] (-316.076) * (-316.442) [-319.955] (-317.091) (-320.633) -- 0:00:54
84500 -- (-315.716) (-315.860) (-317.875) [-315.577] * (-317.574) (-317.904) (-318.239) [-316.010] -- 0:00:54
85000 -- (-317.095) [-317.084] (-317.204) (-321.174) * (-316.855) [-316.878] (-318.694) (-316.900) -- 0:00:53
Average standard deviation of split frequencies: 0.023421
85500 -- (-316.646) [-317.836] (-315.846) (-319.820) * [-317.954] (-316.376) (-321.240) (-318.470) -- 0:00:53
86000 -- (-318.513) (-318.029) [-317.078] (-315.893) * (-318.003) (-316.335) [-316.179] (-319.486) -- 0:00:53
86500 -- [-322.147] (-321.045) (-318.850) (-318.906) * [-315.968] (-316.319) (-317.227) (-319.961) -- 0:00:52
87000 -- (-316.239) (-318.720) (-316.094) [-317.672] * (-316.071) [-317.322] (-318.209) (-318.612) -- 0:00:52
87500 -- (-318.473) [-316.152] (-315.460) (-318.780) * (-317.216) (-316.936) (-322.136) [-316.759] -- 0:00:52
88000 -- (-318.792) [-317.188] (-315.660) (-318.421) * [-316.210] (-315.654) (-324.120) (-317.829) -- 0:00:51
88500 -- (-320.217) [-318.767] (-316.575) (-315.914) * (-323.712) (-317.667) [-320.283] (-316.551) -- 0:00:51
89000 -- (-318.050) [-319.053] (-323.573) (-316.226) * (-316.234) [-315.709] (-316.126) (-316.980) -- 0:00:51
89500 -- (-320.302) (-316.946) (-320.149) [-316.413] * [-315.903] (-316.127) (-316.528) (-317.761) -- 0:00:50
90000 -- (-315.483) (-316.559) [-317.718] (-317.660) * (-320.408) [-317.865] (-322.497) (-317.105) -- 0:00:50
Average standard deviation of split frequencies: 0.025749
90500 -- (-315.784) (-315.843) (-315.711) [-316.611] * (-318.063) (-319.288) [-315.790] (-318.591) -- 0:01:00
91000 -- [-318.773] (-316.493) (-317.301) (-316.372) * (-318.455) [-315.535] (-318.646) (-321.630) -- 0:00:59
91500 -- (-318.106) (-317.223) (-315.783) [-317.443] * [-315.999] (-319.382) (-320.050) (-316.438) -- 0:00:59
92000 -- (-319.984) (-316.901) (-315.519) [-316.487] * [-319.537] (-318.432) (-316.369) (-318.745) -- 0:00:59
92500 -- (-320.332) (-317.217) [-315.440] (-318.378) * (-316.272) (-319.749) (-316.266) [-316.849] -- 0:00:58
93000 -- (-316.336) (-318.031) [-318.020] (-316.833) * (-317.383) (-316.556) (-317.819) [-315.881] -- 0:00:58
93500 -- (-318.770) (-321.541) [-317.190] (-322.161) * (-320.301) [-317.784] (-316.919) (-316.254) -- 0:00:58
94000 -- [-316.200] (-315.796) (-317.650) (-319.069) * (-317.700) (-318.710) [-317.918] (-316.813) -- 0:00:57
94500 -- (-319.441) (-317.478) [-317.303] (-318.187) * [-316.514] (-324.628) (-315.572) (-316.860) -- 0:00:57
95000 -- (-318.722) [-316.377] (-317.251) (-317.827) * (-318.151) (-317.624) [-318.992] (-321.358) -- 0:00:57
Average standard deviation of split frequencies: 0.027499
95500 -- (-317.986) (-317.295) [-315.923] (-317.809) * [-317.698] (-319.832) (-320.659) (-317.571) -- 0:00:56
96000 -- [-319.987] (-315.976) (-315.689) (-320.466) * (-318.526) (-316.537) [-315.649] (-316.392) -- 0:00:56
96500 -- (-320.054) (-316.891) [-318.719] (-317.967) * (-316.475) (-317.751) [-318.038] (-318.820) -- 0:00:56
97000 -- (-321.563) (-319.334) [-317.440] (-319.399) * [-319.323] (-316.939) (-317.806) (-318.811) -- 0:00:55
97500 -- (-316.811) (-318.960) [-319.014] (-320.232) * (-322.048) [-316.677] (-319.197) (-317.009) -- 0:00:55
98000 -- (-317.492) (-318.783) (-316.319) [-315.456] * [-316.084] (-319.701) (-318.126) (-315.672) -- 0:00:55
98500 -- (-321.038) [-318.523] (-316.420) (-316.895) * (-319.180) [-318.010] (-318.463) (-316.952) -- 0:00:54
99000 -- (-317.633) [-316.640] (-317.146) (-317.426) * (-316.543) (-318.505) (-322.557) [-316.641] -- 0:00:54
99500 -- (-315.376) (-315.521) [-317.504] (-321.681) * (-320.458) [-316.571] (-322.648) (-316.216) -- 0:00:54
100000 -- (-320.842) [-316.770] (-316.043) (-326.605) * (-317.838) (-316.585) (-317.285) [-316.210] -- 0:00:54
Average standard deviation of split frequencies: 0.022113
100500 -- (-316.723) (-320.344) [-317.062] (-324.455) * (-318.522) (-320.851) (-316.553) [-316.111] -- 0:00:53
101000 -- (-317.931) (-319.573) [-316.224] (-324.592) * [-317.040] (-316.962) (-317.722) (-316.321) -- 0:00:53
101500 -- (-322.267) (-315.893) [-316.390] (-316.183) * [-315.339] (-315.791) (-318.921) (-318.509) -- 0:00:53
102000 -- (-320.646) (-315.653) [-321.281] (-318.106) * (-317.352) (-316.899) [-315.378] (-319.123) -- 0:00:52
102500 -- (-321.920) (-317.863) (-318.272) [-320.174] * (-315.912) (-316.642) [-316.147] (-320.420) -- 0:00:52
103000 -- [-315.877] (-316.414) (-320.636) (-316.459) * (-318.730) [-317.561] (-317.362) (-316.784) -- 0:00:52
103500 -- [-317.189] (-316.482) (-316.384) (-316.508) * [-317.457] (-316.230) (-316.765) (-317.090) -- 0:00:51
104000 -- (-315.862) [-318.128] (-319.127) (-316.416) * (-317.272) (-318.281) (-317.233) [-315.388] -- 0:00:51
104500 -- (-315.739) (-319.849) (-317.050) [-315.936] * (-317.644) [-315.570] (-315.557) (-316.063) -- 0:00:51
105000 -- (-317.151) (-318.879) (-316.460) [-316.741] * (-316.394) (-318.081) (-318.506) [-315.685] -- 0:00:51
Average standard deviation of split frequencies: 0.020118
105500 -- (-318.024) (-318.033) (-316.865) [-317.311] * (-316.633) (-315.265) [-315.980] (-316.767) -- 0:00:50
106000 -- (-316.688) [-317.978] (-317.974) (-319.995) * [-316.879] (-315.335) (-315.746) (-317.046) -- 0:00:50
106500 -- (-316.582) (-316.587) [-316.441] (-317.657) * (-318.594) [-317.857] (-319.531) (-316.962) -- 0:00:50
107000 -- [-316.439] (-317.194) (-317.133) (-318.770) * (-317.181) [-318.155] (-319.602) (-316.967) -- 0:00:50
107500 -- (-319.170) [-320.031] (-318.670) (-321.131) * (-317.994) (-317.955) [-316.125] (-317.792) -- 0:00:58
108000 -- (-316.940) (-317.723) (-316.608) [-317.021] * [-318.578] (-319.998) (-316.660) (-315.906) -- 0:00:57
108500 -- [-315.795] (-317.215) (-319.887) (-317.921) * (-316.054) (-319.194) (-323.312) [-317.178] -- 0:00:57
109000 -- (-315.823) (-317.003) (-317.895) [-316.161] * (-319.561) (-318.836) (-316.248) [-315.392] -- 0:00:57
109500 -- (-315.948) [-317.840] (-319.490) (-314.938) * [-317.646] (-316.643) (-321.058) (-318.574) -- 0:00:56
110000 -- (-318.563) (-319.817) (-317.334) [-316.034] * (-317.219) (-315.467) [-321.944] (-316.806) -- 0:00:56
Average standard deviation of split frequencies: 0.019729
110500 -- [-315.323] (-318.473) (-319.124) (-316.761) * (-316.062) [-316.662] (-318.534) (-315.118) -- 0:00:56
111000 -- [-317.906] (-316.056) (-315.623) (-318.699) * (-316.164) (-316.016) [-316.920] (-316.501) -- 0:00:56
111500 -- (-318.923) [-315.920] (-320.138) (-316.507) * [-317.766] (-317.328) (-316.046) (-320.259) -- 0:00:55
112000 -- [-316.387] (-315.557) (-319.301) (-315.774) * (-320.920) (-316.499) [-316.196] (-317.627) -- 0:00:55
112500 -- (-315.964) (-316.044) [-321.923] (-316.395) * (-316.221) (-317.731) [-315.575] (-320.247) -- 0:00:55
113000 -- [-316.345] (-319.055) (-318.798) (-318.554) * [-317.662] (-316.230) (-317.341) (-316.328) -- 0:00:54
113500 -- (-317.268) (-316.508) [-317.332] (-317.530) * [-317.593] (-319.169) (-316.083) (-316.066) -- 0:00:54
114000 -- (-317.700) (-323.294) [-322.024] (-317.812) * (-317.453) [-318.818] (-319.322) (-315.807) -- 0:00:54
114500 -- (-316.534) [-316.195] (-316.386) (-319.293) * [-316.158] (-316.602) (-319.187) (-317.954) -- 0:00:54
115000 -- [-316.528] (-317.142) (-315.374) (-317.398) * (-317.790) [-316.647] (-319.908) (-317.887) -- 0:00:53
Average standard deviation of split frequencies: 0.018407
115500 -- (-316.149) (-316.094) [-317.056] (-318.852) * [-320.182] (-319.271) (-315.140) (-317.452) -- 0:00:53
116000 -- (-318.088) [-318.095] (-318.150) (-316.357) * (-318.102) [-317.326] (-316.479) (-318.231) -- 0:00:53
116500 -- (-315.907) (-315.293) [-317.782] (-318.853) * [-315.631] (-316.079) (-318.132) (-319.497) -- 0:00:53
117000 -- (-317.521) (-315.290) (-320.807) [-317.827] * (-316.132) (-316.236) [-316.433] (-316.222) -- 0:00:52
117500 -- [-318.088] (-319.816) (-316.366) (-317.184) * [-316.131] (-317.727) (-315.212) (-315.891) -- 0:00:52
118000 -- [-322.098] (-316.558) (-316.287) (-317.124) * (-315.817) (-318.280) (-316.310) [-315.731] -- 0:00:52
118500 -- (-315.764) (-317.710) (-318.361) [-316.787] * (-317.072) [-318.159] (-317.019) (-316.547) -- 0:00:52
119000 -- (-316.099) (-317.019) (-316.602) [-315.592] * (-317.147) [-316.349] (-320.831) (-318.578) -- 0:00:51
119500 -- (-317.808) (-317.402) [-319.456] (-317.359) * (-315.894) [-315.623] (-317.527) (-317.105) -- 0:00:51
120000 -- (-317.686) [-318.728] (-316.770) (-320.983) * (-321.262) (-315.061) (-317.634) [-316.572] -- 0:00:51
Average standard deviation of split frequencies: 0.018313
120500 -- (-317.775) (-323.953) [-318.948] (-317.566) * [-315.725] (-319.283) (-317.248) (-317.498) -- 0:00:51
121000 -- (-316.092) (-315.604) [-319.553] (-316.041) * [-319.585] (-317.949) (-317.045) (-319.315) -- 0:00:50
121500 -- (-316.715) (-317.007) [-316.339] (-319.024) * [-315.805] (-317.399) (-317.494) (-316.209) -- 0:00:50
122000 -- (-317.055) (-319.043) [-315.941] (-315.774) * [-317.998] (-318.016) (-318.254) (-317.073) -- 0:00:50
122500 -- [-316.513] (-319.237) (-317.069) (-317.225) * [-318.022] (-323.941) (-317.156) (-317.193) -- 0:00:50
123000 -- (-317.181) (-317.476) (-317.760) [-318.907] * [-315.877] (-316.722) (-315.167) (-318.384) -- 0:00:49
123500 -- (-316.431) [-317.351] (-319.632) (-317.390) * (-317.382) (-316.486) [-318.164] (-321.169) -- 0:00:49
124000 -- [-319.394] (-315.659) (-318.441) (-322.317) * (-315.718) (-316.867) (-315.791) [-319.209] -- 0:00:49
124500 -- (-320.975) (-317.117) [-317.183] (-317.231) * [-315.615] (-319.421) (-319.030) (-320.494) -- 0:00:56
125000 -- [-319.305] (-315.334) (-316.679) (-316.717) * (-316.516) (-320.604) (-323.550) [-317.306] -- 0:00:56
Average standard deviation of split frequencies: 0.017252
125500 -- (-317.385) [-317.481] (-316.435) (-317.910) * (-318.605) [-317.239] (-318.692) (-319.091) -- 0:00:55
126000 -- [-317.812] (-317.036) (-316.063) (-318.266) * [-316.706] (-317.955) (-316.696) (-316.484) -- 0:00:55
126500 -- (-315.805) (-320.673) [-317.942] (-320.535) * [-317.315] (-318.172) (-316.774) (-319.815) -- 0:00:55
127000 -- (-316.223) (-316.687) (-316.412) [-316.083] * [-316.582] (-318.268) (-315.601) (-317.590) -- 0:00:54
127500 -- (-317.094) (-317.491) [-316.097] (-315.566) * (-316.440) (-319.175) [-319.036] (-319.971) -- 0:00:54
128000 -- (-318.322) (-318.495) [-317.022] (-317.795) * (-320.344) [-316.208] (-318.681) (-317.619) -- 0:00:54
128500 -- (-316.415) (-318.034) [-316.398] (-318.103) * (-316.800) (-317.796) [-317.592] (-316.678) -- 0:00:54
129000 -- (-318.580) (-316.676) [-317.237] (-321.264) * (-318.889) (-317.794) [-317.564] (-320.868) -- 0:00:54
129500 -- (-319.030) (-320.351) (-320.241) [-319.701] * [-317.057] (-317.510) (-317.291) (-321.460) -- 0:00:53
130000 -- (-317.183) [-315.051] (-316.822) (-317.219) * (-320.747) (-320.023) [-324.243] (-317.315) -- 0:00:53
Average standard deviation of split frequencies: 0.015433
130500 -- (-319.826) [-318.776] (-318.337) (-319.566) * [-317.393] (-317.222) (-321.256) (-316.318) -- 0:00:53
131000 -- (-318.866) (-321.031) (-316.918) [-319.492] * (-316.068) [-317.382] (-317.071) (-317.683) -- 0:00:53
131500 -- (-315.193) (-319.332) (-318.003) [-315.465] * (-315.745) [-315.260] (-322.442) (-317.967) -- 0:00:52
132000 -- [-316.472] (-315.523) (-318.416) (-317.383) * (-315.440) [-318.261] (-320.488) (-318.245) -- 0:00:52
132500 -- (-316.107) [-315.934] (-319.863) (-317.839) * (-318.189) (-318.222) [-317.148] (-315.228) -- 0:00:52
133000 -- [-316.416] (-318.685) (-325.514) (-315.604) * (-316.937) [-315.129] (-319.282) (-316.647) -- 0:00:52
133500 -- (-316.564) (-316.921) (-317.839) [-317.315] * (-319.061) [-315.755] (-318.080) (-317.138) -- 0:00:51
134000 -- (-317.326) (-317.311) (-319.937) [-320.850] * (-319.369) [-316.392] (-321.327) (-317.000) -- 0:00:51
134500 -- (-322.414) (-319.081) [-317.207] (-318.960) * [-316.614] (-316.085) (-317.857) (-317.139) -- 0:00:51
135000 -- (-316.282) (-316.518) (-323.217) [-318.399] * [-316.313] (-321.489) (-322.499) (-316.193) -- 0:00:51
Average standard deviation of split frequencies: 0.014680
135500 -- [-316.814] (-321.257) (-318.480) (-316.750) * (-317.987) [-319.174] (-321.284) (-318.163) -- 0:00:51
136000 -- (-316.043) [-317.810] (-317.597) (-319.114) * [-316.059] (-318.528) (-316.769) (-320.760) -- 0:00:50
136500 -- [-315.871] (-315.637) (-316.989) (-317.849) * (-320.442) [-314.970] (-318.415) (-318.382) -- 0:00:50
137000 -- (-320.931) [-318.776] (-316.445) (-315.666) * (-324.080) (-315.391) (-315.529) [-318.058] -- 0:00:50
137500 -- (-322.398) (-321.480) [-315.179] (-318.156) * [-316.728] (-317.397) (-315.856) (-317.310) -- 0:00:50
138000 -- (-315.792) (-320.569) (-316.745) [-317.708] * [-317.358] (-316.865) (-319.509) (-316.990) -- 0:00:49
138500 -- (-318.838) (-316.984) [-316.226] (-316.788) * [-318.672] (-315.462) (-318.003) (-318.367) -- 0:00:49
139000 -- [-320.602] (-316.261) (-316.147) (-315.969) * (-315.755) [-316.452] (-319.252) (-321.668) -- 0:00:49
139500 -- (-320.361) [-317.273] (-318.527) (-315.332) * (-316.233) (-317.404) (-316.944) [-320.734] -- 0:00:49
140000 -- (-322.565) (-317.675) [-315.278] (-315.414) * (-316.249) [-316.843] (-315.518) (-320.410) -- 0:00:49
Average standard deviation of split frequencies: 0.016756
140500 -- (-318.684) (-316.542) [-316.327] (-317.610) * [-317.618] (-317.664) (-316.543) (-316.605) -- 0:00:48
141000 -- [-319.087] (-321.322) (-315.392) (-316.527) * (-315.298) [-318.513] (-316.894) (-318.891) -- 0:00:54
141500 -- (-316.942) (-316.187) (-318.451) [-316.694] * [-315.599] (-317.511) (-315.805) (-319.948) -- 0:00:54
142000 -- (-317.371) (-316.395) [-315.934] (-316.466) * (-315.142) [-318.509] (-316.910) (-316.035) -- 0:00:54
142500 -- (-317.365) [-317.155] (-318.065) (-317.461) * [-319.890] (-317.902) (-316.151) (-316.216) -- 0:00:54
143000 -- [-318.571] (-318.417) (-319.752) (-317.848) * (-316.263) (-316.069) [-317.149] (-317.081) -- 0:00:53
143500 -- (-318.998) (-320.623) (-315.683) [-321.044] * (-319.977) (-316.964) (-318.154) [-322.993] -- 0:00:53
144000 -- (-316.030) (-317.046) [-316.476] (-319.725) * (-317.611) [-317.380] (-320.517) (-315.664) -- 0:00:53
144500 -- [-318.228] (-317.098) (-320.386) (-316.275) * (-317.270) (-321.507) (-315.663) [-316.810] -- 0:00:53
145000 -- (-318.379) [-318.795] (-316.662) (-317.177) * (-317.350) [-317.890] (-317.454) (-324.490) -- 0:00:53
Average standard deviation of split frequencies: 0.019373
145500 -- [-316.930] (-317.568) (-315.925) (-316.761) * [-320.250] (-315.694) (-317.611) (-317.202) -- 0:00:52
146000 -- (-318.049) [-315.839] (-318.460) (-315.213) * (-321.381) (-321.112) [-320.088] (-317.387) -- 0:00:52
146500 -- (-317.683) (-316.476) (-317.631) [-318.380] * [-316.834] (-317.137) (-317.739) (-317.864) -- 0:00:52
147000 -- (-318.288) [-318.339] (-315.743) (-320.122) * (-319.099) (-317.033) [-317.223] (-316.177) -- 0:00:52
147500 -- [-322.503] (-318.396) (-317.130) (-316.397) * [-319.172] (-319.619) (-317.205) (-316.967) -- 0:00:52
148000 -- (-315.565) [-315.658] (-316.622) (-319.964) * (-316.874) (-324.438) (-319.559) [-315.548] -- 0:00:51
148500 -- (-318.244) (-317.729) (-317.028) [-315.911] * (-319.149) [-317.535] (-318.936) (-316.432) -- 0:00:51
149000 -- (-315.609) (-315.638) (-315.739) [-316.876] * (-317.588) [-318.790] (-315.490) (-319.724) -- 0:00:51
149500 -- (-318.624) (-320.643) [-315.709] (-315.430) * (-316.516) (-321.015) (-317.872) [-318.515] -- 0:00:51
150000 -- (-315.892) [-316.159] (-316.011) (-316.623) * (-316.801) (-315.869) (-316.590) [-318.839] -- 0:00:51
Average standard deviation of split frequencies: 0.017730
150500 -- (-315.255) [-317.865] (-321.965) (-317.538) * (-317.215) (-320.396) (-318.952) [-316.110] -- 0:00:50
151000 -- [-315.495] (-316.205) (-320.257) (-318.042) * (-317.635) (-322.225) (-318.501) [-319.220] -- 0:00:50
151500 -- (-315.079) (-319.908) [-316.408] (-318.182) * (-327.077) (-316.830) (-315.989) [-316.332] -- 0:00:50
152000 -- [-317.432] (-316.389) (-318.066) (-317.391) * (-329.678) (-316.798) (-318.139) [-318.004] -- 0:00:50
152500 -- [-317.506] (-317.623) (-319.726) (-315.907) * (-327.449) (-316.380) [-314.982] (-317.486) -- 0:00:50
153000 -- (-316.575) (-317.397) [-316.040] (-317.245) * (-326.825) [-317.664] (-317.327) (-316.938) -- 0:00:49
153500 -- (-317.228) (-321.383) (-321.203) [-317.125] * (-319.766) [-316.240] (-322.608) (-315.809) -- 0:00:49
154000 -- (-317.008) (-321.099) (-321.673) [-318.451] * (-324.120) (-316.117) [-317.667] (-317.404) -- 0:00:49
154500 -- [-316.334] (-320.961) (-316.965) (-320.718) * (-319.399) (-317.374) (-315.473) [-321.476] -- 0:00:49
155000 -- [-315.905] (-318.759) (-316.722) (-322.823) * [-317.346] (-315.481) (-318.107) (-317.121) -- 0:00:49
Average standard deviation of split frequencies: 0.017459
155500 -- (-315.877) (-319.358) (-316.675) [-317.779] * (-316.492) (-321.492) [-320.210] (-316.317) -- 0:00:48
156000 -- [-318.154] (-321.388) (-315.329) (-323.506) * (-317.213) (-315.843) [-316.438] (-318.632) -- 0:00:48
156500 -- (-319.005) (-318.906) (-315.393) [-321.789] * (-317.537) [-317.120] (-316.350) (-317.897) -- 0:00:48
157000 -- (-319.141) (-316.261) (-317.672) [-315.584] * (-316.606) [-318.114] (-315.896) (-316.135) -- 0:00:48
157500 -- (-322.977) (-320.652) (-323.001) [-315.451] * (-315.689) (-317.781) [-316.907] (-318.267) -- 0:00:53
158000 -- (-315.209) (-317.845) [-316.741] (-316.551) * (-317.786) (-319.529) (-317.049) [-317.423] -- 0:00:53
158500 -- [-316.746] (-315.642) (-315.588) (-319.637) * (-318.195) (-318.367) [-316.144] (-317.941) -- 0:00:53
159000 -- (-317.271) [-320.040] (-316.713) (-321.650) * (-322.561) [-316.716] (-318.880) (-318.051) -- 0:00:52
159500 -- (-316.317) (-317.893) [-316.981] (-318.985) * (-319.372) [-315.885] (-316.129) (-316.505) -- 0:00:52
160000 -- (-316.599) [-316.316] (-317.882) (-318.047) * (-319.515) [-315.326] (-315.637) (-315.752) -- 0:00:52
Average standard deviation of split frequencies: 0.016137
160500 -- (-315.395) [-315.858] (-318.711) (-317.145) * [-316.347] (-316.694) (-316.740) (-315.409) -- 0:00:52
161000 -- [-318.924] (-317.556) (-316.671) (-315.738) * (-321.647) (-315.448) (-318.598) [-316.800] -- 0:00:52
161500 -- (-319.923) (-315.687) (-318.523) [-319.826] * (-318.408) [-315.678] (-315.473) (-318.177) -- 0:00:51
162000 -- (-318.015) (-318.808) (-315.453) [-316.544] * [-317.511] (-318.096) (-315.086) (-315.777) -- 0:00:51
162500 -- [-317.234] (-316.057) (-315.387) (-317.496) * (-318.231) (-322.684) (-316.527) [-315.944] -- 0:00:51
163000 -- (-319.125) [-320.029] (-314.997) (-315.997) * (-319.689) (-320.697) [-316.321] (-315.811) -- 0:00:51
163500 -- [-316.727] (-318.798) (-317.799) (-323.140) * (-316.204) (-322.027) (-317.752) [-319.877] -- 0:00:51
164000 -- (-317.948) (-318.536) [-317.269] (-320.073) * (-318.163) [-317.969] (-317.162) (-318.703) -- 0:00:50
164500 -- (-317.705) [-316.212] (-316.508) (-316.943) * (-318.626) (-317.271) (-319.040) [-316.507] -- 0:00:50
165000 -- [-318.303] (-318.626) (-317.602) (-321.376) * (-315.388) (-318.136) (-319.335) [-317.524] -- 0:00:50
Average standard deviation of split frequencies: 0.014376
165500 -- [-318.332] (-316.439) (-317.211) (-318.652) * (-318.012) (-318.287) (-317.271) [-319.286] -- 0:00:50
166000 -- (-322.783) (-315.598) (-317.714) [-315.641] * [-316.424] (-318.483) (-316.786) (-319.875) -- 0:00:50
166500 -- (-319.328) (-316.521) [-315.679] (-317.239) * (-318.048) (-315.413) (-315.773) [-316.522] -- 0:00:50
167000 -- [-315.957] (-318.387) (-316.973) (-319.110) * (-319.433) (-316.638) (-317.762) [-317.005] -- 0:00:49
167500 -- (-318.887) [-316.145] (-323.480) (-316.835) * [-316.196] (-319.979) (-315.957) (-318.041) -- 0:00:49
168000 -- [-317.101] (-316.808) (-320.480) (-316.837) * (-318.097) [-316.305] (-316.486) (-315.545) -- 0:00:49
168500 -- (-315.587) (-317.352) [-315.991] (-316.465) * (-319.758) (-317.175) [-315.582] (-315.611) -- 0:00:49
169000 -- (-315.315) (-317.358) (-315.633) [-315.377] * [-318.708] (-318.155) (-316.249) (-319.622) -- 0:00:49
169500 -- (-316.840) (-322.496) (-315.961) [-318.381] * [-317.775] (-315.336) (-315.681) (-317.165) -- 0:00:48
170000 -- [-317.818] (-317.965) (-316.624) (-315.400) * (-317.751) (-315.927) (-315.803) [-318.983] -- 0:00:48
Average standard deviation of split frequencies: 0.016400
170500 -- (-315.214) (-316.854) [-318.375] (-316.752) * (-321.170) (-317.938) [-315.701] (-316.097) -- 0:00:48
171000 -- [-316.036] (-316.201) (-316.282) (-319.088) * [-315.605] (-316.839) (-317.812) (-317.607) -- 0:00:48
171500 -- (-316.044) [-315.564] (-316.638) (-320.577) * (-315.553) [-317.771] (-315.488) (-317.376) -- 0:00:48
172000 -- (-317.179) [-319.251] (-316.378) (-320.015) * [-315.392] (-319.023) (-317.957) (-318.324) -- 0:00:48
172500 -- (-317.491) (-318.022) [-319.760] (-317.986) * (-315.819) (-317.051) [-316.591] (-317.752) -- 0:00:47
173000 -- (-318.465) [-316.606] (-317.934) (-317.459) * (-319.505) (-317.760) (-315.420) [-316.903] -- 0:00:47
173500 -- (-317.281) [-317.069] (-315.805) (-316.603) * (-319.056) (-318.761) [-318.130] (-316.465) -- 0:00:47
174000 -- (-316.741) (-319.382) (-317.337) [-315.688] * (-318.591) (-318.366) (-318.554) [-317.371] -- 0:00:47
174500 -- [-316.613] (-319.117) (-316.158) (-315.789) * (-315.203) [-317.654] (-318.536) (-317.264) -- 0:00:52
175000 -- (-316.262) (-321.671) (-316.505) [-315.869] * (-317.254) [-318.109] (-318.101) (-317.053) -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- [-316.080] (-316.603) (-317.321) (-316.139) * (-315.490) [-316.937] (-318.007) (-316.074) -- 0:00:51
176000 -- (-318.099) (-319.552) [-316.538] (-319.210) * (-316.159) (-318.158) [-317.991] (-316.243) -- 0:00:51
176500 -- (-316.730) (-319.821) [-316.273] (-327.365) * (-318.854) (-320.122) (-319.994) [-316.651] -- 0:00:51
177000 -- (-316.535) (-318.145) [-317.152] (-319.740) * (-316.598) (-318.089) (-320.129) [-316.314] -- 0:00:51
177500 -- (-318.099) (-316.481) [-315.473] (-316.079) * (-319.461) [-317.087] (-321.154) (-318.566) -- 0:00:50
178000 -- (-318.936) [-315.476] (-318.718) (-319.069) * (-316.377) (-320.598) [-318.287] (-320.759) -- 0:00:50
178500 -- (-317.889) (-316.558) (-318.513) [-315.718] * (-315.290) (-320.242) (-318.558) [-318.449] -- 0:00:50
179000 -- (-321.615) [-318.192] (-315.635) (-315.412) * (-317.726) (-317.391) (-317.408) [-316.332] -- 0:00:50
179500 -- [-318.776] (-317.333) (-315.216) (-315.428) * [-318.817] (-319.432) (-315.574) (-317.968) -- 0:00:50
180000 -- [-315.857] (-319.340) (-317.628) (-316.824) * (-325.990) [-318.011] (-319.748) (-319.486) -- 0:00:50
Average standard deviation of split frequencies: 0.017612
180500 -- (-318.023) [-317.356] (-319.258) (-321.488) * [-317.037] (-320.276) (-320.113) (-315.992) -- 0:00:49
181000 -- (-316.317) (-317.938) (-316.420) [-322.179] * (-316.320) (-323.189) [-316.678] (-315.887) -- 0:00:49
181500 -- (-316.846) [-317.049] (-315.747) (-320.233) * (-316.379) (-317.468) [-316.693] (-319.852) -- 0:00:49
182000 -- (-321.787) (-318.878) (-317.615) [-318.120] * (-316.277) (-321.978) [-319.677] (-315.724) -- 0:00:49
182500 -- (-315.841) (-321.114) [-320.491] (-318.171) * (-315.557) (-319.054) (-317.670) [-316.917] -- 0:00:49
183000 -- (-316.895) [-317.241] (-318.838) (-316.771) * (-315.152) (-321.519) [-318.339] (-315.519) -- 0:00:49
183500 -- (-318.611) (-317.688) (-320.117) [-316.574] * (-318.753) (-316.866) [-315.889] (-316.947) -- 0:00:48
184000 -- (-321.421) [-317.620] (-318.150) (-316.268) * (-316.884) (-317.276) (-315.943) [-315.742] -- 0:00:48
184500 -- [-317.651] (-322.186) (-317.739) (-317.019) * (-316.019) (-317.794) (-315.312) [-315.838] -- 0:00:48
185000 -- (-316.139) (-315.543) [-317.540] (-319.813) * (-319.079) (-319.072) [-317.387] (-315.486) -- 0:00:48
Average standard deviation of split frequencies: 0.019232
185500 -- [-315.790] (-318.748) (-315.904) (-317.245) * (-316.257) (-322.329) (-318.212) [-318.741] -- 0:00:48
186000 -- (-317.211) (-318.202) (-317.409) [-317.064] * (-317.197) (-316.675) [-317.447] (-318.547) -- 0:00:48
186500 -- [-316.760] (-319.758) (-319.513) (-318.669) * (-317.161) (-317.507) [-315.327] (-317.729) -- 0:00:47
187000 -- [-316.839] (-317.244) (-316.008) (-316.190) * (-316.755) [-316.189] (-315.782) (-316.118) -- 0:00:47
187500 -- (-316.495) (-317.939) [-317.301] (-319.203) * (-317.962) (-318.108) [-316.941] (-317.137) -- 0:00:47
188000 -- [-320.661] (-315.767) (-318.102) (-319.952) * (-316.787) (-316.710) [-317.570] (-318.585) -- 0:00:47
188500 -- (-316.631) (-321.050) (-320.439) [-318.604] * [-317.648] (-316.398) (-316.657) (-320.609) -- 0:00:47
189000 -- (-316.966) (-320.330) [-316.648] (-319.126) * (-326.155) (-315.598) (-315.734) [-317.184] -- 0:00:47
189500 -- (-317.312) [-316.359] (-316.003) (-316.703) * (-318.241) (-317.688) (-316.646) [-316.344] -- 0:00:47
190000 -- [-317.167] (-318.884) (-317.050) (-323.197) * [-317.388] (-320.777) (-323.653) (-319.623) -- 0:00:46
Average standard deviation of split frequencies: 0.018470
190500 -- (-317.140) (-317.931) [-322.620] (-320.775) * (-317.058) (-315.144) (-317.387) [-316.654] -- 0:00:46
191000 -- (-319.780) (-319.280) [-316.281] (-316.091) * (-317.574) [-316.255] (-316.284) (-316.785) -- 0:00:46
191500 -- [-317.231] (-315.543) (-315.764) (-317.107) * (-316.451) [-316.323] (-316.906) (-317.523) -- 0:00:50
192000 -- (-315.203) (-315.072) [-316.518] (-316.082) * (-319.217) [-315.684] (-316.452) (-315.686) -- 0:00:50
192500 -- [-316.968] (-316.257) (-318.273) (-316.468) * [-320.444] (-318.815) (-318.455) (-319.055) -- 0:00:50
193000 -- [-316.906] (-317.174) (-318.427) (-317.638) * (-316.388) [-318.214] (-317.605) (-317.078) -- 0:00:50
193500 -- [-315.615] (-320.975) (-317.468) (-316.222) * (-322.960) (-318.794) [-316.546] (-316.776) -- 0:00:50
194000 -- [-316.761] (-317.991) (-319.132) (-316.309) * [-319.264] (-316.911) (-321.779) (-317.119) -- 0:00:49
194500 -- (-317.673) [-317.023] (-318.716) (-318.714) * (-317.579) (-320.140) (-316.745) [-315.820] -- 0:00:49
195000 -- [-316.687] (-316.321) (-317.191) (-316.206) * [-319.125] (-315.699) (-315.512) (-318.216) -- 0:00:49
Average standard deviation of split frequencies: 0.017826
195500 -- (-317.130) (-316.939) (-315.952) [-316.292] * [-319.273] (-316.607) (-316.674) (-315.929) -- 0:00:49
196000 -- [-317.015] (-318.275) (-316.869) (-318.097) * (-320.459) [-319.256] (-315.576) (-317.354) -- 0:00:49
196500 -- (-316.194) [-317.365] (-319.108) (-317.493) * [-317.384] (-321.887) (-316.542) (-315.404) -- 0:00:49
197000 -- (-318.263) (-315.880) (-319.448) [-316.225] * (-318.948) (-320.252) [-318.269] (-318.071) -- 0:00:48
197500 -- (-317.755) (-320.374) [-316.222] (-316.024) * [-317.332] (-317.808) (-316.043) (-317.494) -- 0:00:48
198000 -- [-316.345] (-320.513) (-319.160) (-315.513) * (-321.973) (-322.236) (-317.357) [-315.380] -- 0:00:48
198500 -- (-316.485) [-317.875] (-323.146) (-323.135) * (-324.609) [-316.061] (-318.638) (-316.259) -- 0:00:48
199000 -- (-320.414) [-319.076] (-319.711) (-318.092) * (-321.094) (-318.527) (-315.822) [-317.709] -- 0:00:48
199500 -- [-316.316] (-319.759) (-316.493) (-318.293) * [-319.167] (-315.664) (-317.620) (-320.703) -- 0:00:48
200000 -- [-317.036] (-318.072) (-317.872) (-319.533) * (-317.524) (-318.026) (-320.509) [-319.911] -- 0:00:48
Average standard deviation of split frequencies: 0.017826
200500 -- (-318.273) (-315.908) (-318.632) [-316.739] * [-318.741] (-315.949) (-315.506) (-316.893) -- 0:00:47
201000 -- (-316.914) (-316.110) [-316.311] (-318.745) * [-316.022] (-322.162) (-315.881) (-320.248) -- 0:00:47
201500 -- [-315.136] (-319.478) (-316.870) (-318.105) * (-321.459) (-319.221) [-318.603] (-318.687) -- 0:00:47
202000 -- (-316.108) (-316.914) [-317.246] (-319.660) * [-316.727] (-321.092) (-318.624) (-316.430) -- 0:00:47
202500 -- (-315.320) (-321.488) (-318.823) [-316.753] * [-316.704] (-318.581) (-318.093) (-315.150) -- 0:00:47
203000 -- (-317.623) (-326.304) (-316.974) [-318.738] * [-321.137] (-318.040) (-316.764) (-315.287) -- 0:00:47
203500 -- [-317.709] (-319.563) (-317.584) (-319.563) * (-315.542) (-318.190) [-318.185] (-317.540) -- 0:00:46
204000 -- (-318.400) (-318.060) [-319.168] (-318.816) * (-317.515) (-322.742) (-316.415) [-317.069] -- 0:00:46
204500 -- (-317.285) (-318.287) [-321.287] (-316.362) * [-317.485] (-322.064) (-317.194) (-316.462) -- 0:00:46
205000 -- (-317.935) (-319.637) [-318.577] (-315.350) * (-316.056) [-322.638] (-317.262) (-316.918) -- 0:00:46
Average standard deviation of split frequencies: 0.018307
205500 -- (-316.285) (-321.410) [-316.490] (-319.151) * (-317.236) (-323.613) (-318.311) [-317.195] -- 0:00:46
206000 -- (-316.326) [-315.901] (-315.425) (-317.229) * (-317.078) (-318.971) (-318.316) [-315.481] -- 0:00:46
206500 -- [-315.506] (-321.660) (-316.553) (-318.530) * [-316.187] (-316.237) (-316.244) (-315.992) -- 0:00:46
207000 -- [-315.373] (-325.272) (-316.243) (-322.414) * [-315.459] (-317.097) (-315.992) (-319.314) -- 0:00:45
207500 -- (-316.478) (-318.511) (-317.605) [-317.957] * (-316.967) [-315.526] (-315.322) (-315.900) -- 0:00:45
208000 -- (-316.609) (-320.632) [-316.967] (-318.691) * (-316.161) [-315.898] (-315.574) (-317.783) -- 0:00:45
208500 -- (-315.705) [-319.816] (-322.283) (-317.861) * (-319.461) (-318.307) (-315.792) [-317.328] -- 0:00:49
209000 -- (-318.002) (-316.967) [-317.768] (-316.559) * (-316.612) (-317.945) (-315.320) [-315.378] -- 0:00:49
209500 -- (-315.777) (-319.795) [-318.382] (-316.802) * (-318.229) (-320.679) (-319.409) [-317.233] -- 0:00:49
210000 -- (-316.504) (-322.640) [-317.091] (-316.086) * (-320.485) [-315.682] (-318.768) (-318.321) -- 0:00:48
Average standard deviation of split frequencies: 0.018033
210500 -- (-315.857) (-322.082) (-317.959) [-317.107] * (-317.926) (-316.806) (-316.116) [-315.767] -- 0:00:48
211000 -- (-315.695) [-319.968] (-319.453) (-319.653) * (-315.800) [-317.956] (-316.283) (-319.575) -- 0:00:48
211500 -- (-317.776) (-319.246) (-316.685) [-319.779] * (-317.693) (-318.001) [-320.568] (-319.244) -- 0:00:48
212000 -- [-315.548] (-320.829) (-317.873) (-315.174) * (-317.604) [-319.294] (-316.626) (-321.784) -- 0:00:48
212500 -- [-318.022] (-320.573) (-317.239) (-320.829) * [-316.624] (-319.781) (-317.420) (-316.054) -- 0:00:48
213000 -- [-316.318] (-317.258) (-317.753) (-317.156) * (-315.989) (-318.393) [-317.563] (-315.567) -- 0:00:48
213500 -- (-317.670) [-316.785] (-318.019) (-320.895) * (-317.874) [-317.673] (-317.761) (-316.112) -- 0:00:47
214000 -- (-316.835) [-318.270] (-317.219) (-318.141) * (-316.376) [-318.493] (-320.662) (-321.864) -- 0:00:47
214500 -- (-317.811) [-315.347] (-321.136) (-320.526) * (-315.086) [-315.529] (-318.394) (-317.788) -- 0:00:47
215000 -- (-319.640) (-319.009) [-317.490] (-316.330) * (-317.839) (-315.583) (-317.335) [-316.414] -- 0:00:47
Average standard deviation of split frequencies: 0.018263
215500 -- (-316.692) (-319.716) [-316.498] (-317.649) * (-316.771) [-317.129] (-317.424) (-317.247) -- 0:00:47
216000 -- (-319.723) [-317.839] (-316.925) (-315.687) * (-318.486) (-316.071) (-316.667) [-315.763] -- 0:00:47
216500 -- (-318.925) (-319.682) (-319.551) [-316.900] * [-321.523] (-315.637) (-316.874) (-319.718) -- 0:00:47
217000 -- (-316.334) (-316.658) (-317.431) [-317.649] * (-316.771) (-316.597) (-319.094) [-319.004] -- 0:00:46
217500 -- (-315.263) (-319.184) (-317.478) [-317.022] * (-317.792) (-317.999) (-317.879) [-315.795] -- 0:00:46
218000 -- [-316.028] (-316.580) (-316.475) (-317.799) * (-319.474) (-318.155) (-317.849) [-316.566] -- 0:00:46
218500 -- (-317.672) (-315.402) [-315.374] (-318.387) * [-316.064] (-323.003) (-320.157) (-316.827) -- 0:00:46
219000 -- [-317.020] (-317.005) (-320.719) (-318.029) * (-315.084) (-318.937) (-317.458) [-316.669] -- 0:00:46
219500 -- (-316.692) (-319.189) [-319.100] (-317.264) * (-317.270) (-321.724) (-318.677) [-317.216] -- 0:00:46
220000 -- (-317.582) (-319.829) (-318.810) [-315.604] * [-316.036] (-315.989) (-315.788) (-317.508) -- 0:00:46
Average standard deviation of split frequencies: 0.017446
220500 -- (-320.955) (-320.953) (-316.311) [-317.641] * (-327.344) (-319.874) [-316.585] (-315.975) -- 0:00:45
221000 -- (-316.881) [-324.955] (-315.430) (-316.743) * (-327.457) (-316.373) (-318.475) [-316.784] -- 0:00:45
221500 -- [-316.528] (-318.262) (-318.814) (-319.863) * [-316.316] (-316.057) (-317.336) (-322.265) -- 0:00:45
222000 -- (-318.322) (-318.074) [-320.409] (-316.994) * (-317.638) [-316.838] (-319.052) (-319.903) -- 0:00:45
222500 -- (-316.722) (-316.413) (-326.380) [-318.815] * (-315.951) (-320.589) [-317.942] (-315.384) -- 0:00:45
223000 -- (-315.688) (-317.102) [-319.044] (-316.851) * (-321.157) [-315.538] (-318.018) (-316.293) -- 0:00:45
223500 -- (-318.525) [-316.095] (-317.758) (-316.984) * (-316.643) [-320.469] (-318.098) (-316.863) -- 0:00:45
224000 -- (-316.995) (-318.853) [-317.592] (-316.469) * [-316.632] (-316.181) (-316.117) (-315.591) -- 0:00:45
224500 -- (-318.432) [-315.691] (-318.455) (-316.702) * (-315.611) (-317.351) [-317.133] (-316.991) -- 0:00:44
225000 -- (-316.165) (-315.931) [-318.133] (-316.920) * (-315.900) [-317.374] (-319.102) (-320.049) -- 0:00:44
Average standard deviation of split frequencies: 0.017150
225500 -- (-317.615) (-315.779) [-317.865] (-316.016) * (-319.991) (-316.047) (-316.718) [-322.270] -- 0:00:48
226000 -- [-317.438] (-316.486) (-317.153) (-315.907) * (-317.509) (-317.148) (-315.763) [-316.953] -- 0:00:47
226500 -- (-316.391) [-318.375] (-316.947) (-318.188) * (-319.285) (-317.046) [-320.703] (-318.665) -- 0:00:47
227000 -- (-315.119) (-318.255) (-316.512) [-317.838] * (-316.372) (-317.145) [-318.260] (-317.242) -- 0:00:47
227500 -- (-317.952) [-318.243] (-317.759) (-317.055) * (-316.509) (-324.239) (-321.450) [-315.068] -- 0:00:47
228000 -- (-317.362) (-316.403) (-318.712) [-317.509] * (-317.579) (-319.476) (-318.399) [-315.876] -- 0:00:47
228500 -- (-315.747) [-315.571] (-318.066) (-317.887) * [-317.828] (-317.545) (-317.636) (-321.484) -- 0:00:47
229000 -- [-319.646] (-320.113) (-318.655) (-315.683) * (-315.849) (-317.762) (-317.971) [-317.452] -- 0:00:47
229500 -- (-321.517) [-316.951] (-316.641) (-316.760) * [-315.991] (-320.449) (-320.979) (-316.559) -- 0:00:47
230000 -- (-316.945) [-315.640] (-316.133) (-316.228) * (-315.905) (-323.264) [-317.694] (-321.499) -- 0:00:46
Average standard deviation of split frequencies: 0.018501
230500 -- (-317.863) (-320.734) (-320.635) [-315.542] * (-317.466) (-320.790) [-316.522] (-316.067) -- 0:00:46
231000 -- [-316.669] (-318.392) (-318.739) (-316.064) * [-319.045] (-321.217) (-315.710) (-315.876) -- 0:00:46
231500 -- (-318.030) (-317.919) [-318.513] (-317.223) * (-318.560) (-319.148) [-317.229] (-318.051) -- 0:00:46
232000 -- (-317.081) (-316.280) (-316.169) [-316.472] * (-315.199) (-317.220) [-315.472] (-322.634) -- 0:00:46
232500 -- (-315.839) (-315.480) (-318.487) [-316.584] * (-316.281) [-317.573] (-315.422) (-317.758) -- 0:00:46
233000 -- (-315.926) (-315.654) (-319.364) [-320.910] * (-316.964) (-317.356) [-315.988] (-316.677) -- 0:00:46
233500 -- [-316.107] (-315.465) (-317.164) (-318.108) * (-320.043) (-325.517) (-315.503) [-317.330] -- 0:00:45
234000 -- (-315.936) (-316.209) (-318.284) [-318.242] * (-315.935) [-317.906] (-317.585) (-321.063) -- 0:00:45
234500 -- [-318.415] (-316.114) (-316.383) (-320.548) * (-316.832) (-318.189) [-315.835] (-318.812) -- 0:00:45
235000 -- [-316.844] (-317.510) (-316.780) (-317.975) * (-318.123) (-319.042) [-318.564] (-319.670) -- 0:00:45
Average standard deviation of split frequencies: 0.019531
235500 -- (-319.030) [-317.670] (-315.827) (-316.914) * (-321.334) (-316.628) (-318.324) [-315.916] -- 0:00:45
236000 -- (-316.976) (-319.797) (-318.699) [-315.305] * [-316.906] (-316.975) (-320.778) (-316.995) -- 0:00:45
236500 -- (-316.618) (-317.265) (-317.678) [-324.116] * (-320.081) (-316.131) [-318.411] (-316.962) -- 0:00:45
237000 -- (-319.375) [-316.357] (-316.318) (-321.806) * (-318.178) [-315.752] (-316.967) (-318.114) -- 0:00:45
237500 -- [-316.833] (-318.404) (-316.027) (-318.966) * [-317.070] (-319.555) (-316.225) (-319.716) -- 0:00:44
238000 -- (-318.610) (-316.822) (-316.834) [-317.391] * (-315.283) [-315.660] (-317.234) (-316.802) -- 0:00:44
238500 -- (-319.506) (-317.357) [-315.847] (-319.492) * (-318.412) [-316.322] (-316.576) (-316.813) -- 0:00:44
239000 -- (-317.423) (-316.693) [-315.277] (-317.910) * (-317.340) [-318.128] (-315.857) (-318.615) -- 0:00:44
239500 -- (-316.382) (-316.011) [-315.810] (-321.826) * (-316.357) (-317.753) (-315.537) [-320.204] -- 0:00:44
240000 -- (-315.947) (-319.847) [-320.550] (-316.202) * (-318.160) (-316.907) (-316.083) [-319.691] -- 0:00:44
Average standard deviation of split frequencies: 0.018282
240500 -- (-315.472) (-317.855) [-319.041] (-316.050) * (-315.089) (-321.641) (-316.035) [-320.120] -- 0:00:44
241000 -- (-315.881) (-319.926) [-320.317] (-315.187) * (-317.478) [-318.243] (-318.341) (-316.110) -- 0:00:44
241500 -- [-319.395] (-320.352) (-320.121) (-315.434) * (-321.078) (-317.079) [-320.555] (-318.285) -- 0:00:43
242000 -- [-317.877] (-318.843) (-319.191) (-318.481) * [-317.667] (-316.338) (-316.854) (-317.838) -- 0:00:43
242500 -- (-317.226) (-325.389) [-316.620] (-321.743) * [-318.377] (-315.518) (-318.372) (-316.200) -- 0:00:43
243000 -- (-316.483) (-317.282) (-316.182) [-319.397] * (-315.312) [-319.895] (-317.935) (-315.129) -- 0:00:46
243500 -- (-316.258) [-316.367] (-316.441) (-317.914) * (-317.046) (-319.015) (-317.485) [-315.704] -- 0:00:46
244000 -- (-315.459) [-319.877] (-317.532) (-319.609) * (-318.754) (-317.115) [-315.924] (-319.689) -- 0:00:46
244500 -- [-317.078] (-321.945) (-317.252) (-316.885) * (-316.581) [-317.622] (-319.475) (-318.308) -- 0:00:46
245000 -- (-316.767) (-317.137) [-317.603] (-315.142) * [-316.136] (-321.450) (-315.903) (-318.283) -- 0:00:46
Average standard deviation of split frequencies: 0.019667
245500 -- [-319.717] (-319.053) (-316.841) (-317.582) * (-315.677) (-316.990) (-317.030) [-320.111] -- 0:00:46
246000 -- (-315.291) (-317.366) (-315.509) [-316.294] * (-321.622) [-315.147] (-317.921) (-319.293) -- 0:00:45
246500 -- (-321.072) (-316.225) (-316.252) [-316.342] * (-317.887) (-317.628) [-318.455] (-319.413) -- 0:00:45
247000 -- (-319.539) (-317.154) [-315.908] (-316.846) * (-323.415) [-316.097] (-320.644) (-316.797) -- 0:00:45
247500 -- [-320.072] (-316.964) (-315.779) (-318.159) * [-315.438] (-315.297) (-318.848) (-316.671) -- 0:00:45
248000 -- [-317.057] (-318.072) (-318.431) (-319.172) * (-317.898) [-316.633] (-317.586) (-316.826) -- 0:00:45
248500 -- (-317.455) (-320.418) [-320.438] (-317.107) * (-315.322) (-318.867) (-319.024) [-316.565] -- 0:00:45
249000 -- (-316.967) (-317.893) [-318.926] (-317.589) * (-315.797) [-316.526] (-317.363) (-315.880) -- 0:00:45
249500 -- (-317.651) (-316.240) [-315.936] (-315.841) * (-317.760) [-317.679] (-318.425) (-316.091) -- 0:00:45
250000 -- (-316.385) (-324.503) [-317.869] (-316.953) * [-316.767] (-315.780) (-318.630) (-320.235) -- 0:00:45
Average standard deviation of split frequencies: 0.020373
250500 -- (-319.975) [-318.402] (-317.690) (-318.342) * [-319.181] (-316.454) (-315.808) (-318.397) -- 0:00:44
251000 -- (-316.658) (-316.281) (-316.492) [-318.069] * (-315.496) (-318.621) [-318.124] (-315.322) -- 0:00:44
251500 -- (-319.203) (-320.666) [-319.387] (-315.187) * (-317.487) (-324.142) [-318.489] (-316.577) -- 0:00:44
252000 -- (-318.978) [-319.577] (-316.636) (-316.606) * [-317.750] (-321.231) (-316.318) (-317.069) -- 0:00:44
252500 -- (-318.799) [-315.276] (-320.950) (-317.135) * [-316.904] (-319.089) (-316.680) (-316.597) -- 0:00:44
253000 -- (-319.874) (-315.873) (-318.635) [-315.963] * (-320.105) (-320.083) [-315.761] (-315.997) -- 0:00:44
253500 -- (-317.113) (-316.965) (-318.527) [-316.476] * (-318.814) [-315.995] (-318.052) (-316.062) -- 0:00:44
254000 -- (-319.791) (-317.542) [-317.082] (-319.903) * [-318.868] (-316.568) (-315.371) (-317.394) -- 0:00:44
254500 -- [-320.119] (-317.265) (-317.536) (-316.684) * (-317.797) [-315.883] (-320.171) (-317.187) -- 0:00:43
255000 -- (-318.100) (-316.345) (-318.539) [-317.579] * (-316.057) (-321.400) (-322.145) [-315.910] -- 0:00:43
Average standard deviation of split frequencies: 0.018848
255500 -- (-320.981) (-317.206) (-317.639) [-317.019] * [-315.713] (-316.849) (-319.087) (-319.293) -- 0:00:43
256000 -- [-316.113] (-315.755) (-317.079) (-315.398) * (-318.001) (-318.101) (-317.206) [-316.201] -- 0:00:43
256500 -- (-316.243) (-316.872) [-319.410] (-321.129) * (-317.769) (-315.538) [-317.476] (-317.934) -- 0:00:43
257000 -- (-315.838) (-318.125) (-315.760) [-316.688] * (-317.778) (-316.835) (-315.872) [-316.119] -- 0:00:43
257500 -- (-316.212) [-316.703] (-319.776) (-317.645) * (-320.060) [-317.291] (-320.376) (-319.160) -- 0:00:43
258000 -- (-316.996) [-320.701] (-319.080) (-317.937) * (-317.419) (-317.145) [-318.487] (-318.284) -- 0:00:43
258500 -- (-318.927) (-317.178) [-316.065] (-317.756) * (-320.586) (-320.073) (-318.545) [-317.214] -- 0:00:43
259000 -- (-319.084) (-319.126) [-317.126] (-319.345) * (-320.190) [-318.658] (-315.748) (-319.530) -- 0:00:42
259500 -- (-316.434) (-315.364) [-316.331] (-317.243) * (-317.031) (-320.404) [-316.450] (-316.858) -- 0:00:42
260000 -- (-316.465) [-315.722] (-317.013) (-317.236) * (-316.870) (-319.146) (-318.299) [-314.953] -- 0:00:45
Average standard deviation of split frequencies: 0.017553
260500 -- (-318.715) (-316.164) (-317.577) [-317.503] * (-318.128) (-323.612) (-318.248) [-315.803] -- 0:00:45
261000 -- (-317.970) (-319.013) [-317.587] (-317.037) * (-318.232) [-323.411] (-317.977) (-317.734) -- 0:00:45
261500 -- (-318.504) [-317.334] (-319.132) (-324.445) * (-316.478) (-319.919) [-318.601] (-317.700) -- 0:00:45
262000 -- (-316.813) [-316.395] (-317.564) (-315.945) * [-317.120] (-316.472) (-316.807) (-319.550) -- 0:00:45
262500 -- (-317.526) [-317.238] (-317.139) (-318.742) * (-319.905) (-319.748) (-317.201) [-321.536] -- 0:00:44
263000 -- (-317.067) (-316.195) [-317.337] (-319.909) * (-316.716) (-319.631) [-316.130] (-319.727) -- 0:00:44
263500 -- (-319.619) (-316.478) (-316.666) [-316.925] * (-317.823) [-318.263] (-316.683) (-317.690) -- 0:00:44
264000 -- [-315.930] (-317.895) (-320.467) (-317.333) * (-319.549) (-317.363) (-322.657) [-317.913] -- 0:00:44
264500 -- [-316.999] (-315.969) (-317.403) (-315.707) * (-318.332) [-320.231] (-324.171) (-316.659) -- 0:00:44
265000 -- (-316.303) (-317.031) (-316.893) [-316.206] * (-315.781) (-319.159) (-320.298) [-317.549] -- 0:00:44
Average standard deviation of split frequencies: 0.018452
265500 -- (-317.633) (-315.673) [-317.132] (-318.125) * (-316.815) [-315.870] (-315.728) (-316.082) -- 0:00:44
266000 -- (-316.403) (-315.350) (-317.973) [-319.628] * (-316.954) [-319.393] (-317.134) (-317.367) -- 0:00:44
266500 -- (-321.353) (-322.115) [-318.439] (-318.502) * (-318.305) (-320.911) [-316.313] (-317.157) -- 0:00:44
267000 -- (-319.694) [-317.810] (-317.547) (-322.590) * (-318.071) (-318.102) [-317.522] (-317.708) -- 0:00:43
267500 -- [-317.106] (-315.733) (-316.348) (-319.170) * (-321.101) [-317.933] (-316.056) (-318.684) -- 0:00:43
268000 -- [-317.177] (-315.972) (-315.271) (-315.786) * [-317.465] (-317.043) (-318.964) (-315.676) -- 0:00:43
268500 -- (-317.440) (-317.441) [-316.173] (-320.211) * (-320.223) (-315.843) [-317.837] (-317.535) -- 0:00:43
269000 -- [-322.952] (-316.846) (-318.459) (-316.677) * (-320.468) (-315.978) [-317.373] (-316.949) -- 0:00:43
269500 -- [-316.356] (-315.555) (-319.741) (-323.925) * (-322.688) [-315.366] (-318.249) (-316.191) -- 0:00:43
270000 -- (-318.727) (-318.402) [-316.618] (-317.501) * (-319.353) (-320.658) [-317.933] (-321.250) -- 0:00:43
Average standard deviation of split frequencies: 0.018748
270500 -- (-315.595) [-317.152] (-315.154) (-317.884) * (-317.569) (-319.406) [-316.254] (-317.413) -- 0:00:43
271000 -- (-318.462) (-315.976) [-318.123] (-317.186) * (-318.542) [-315.918] (-316.794) (-318.396) -- 0:00:43
271500 -- (-318.141) (-316.737) [-316.941] (-315.684) * (-317.745) (-317.548) (-316.357) [-315.955] -- 0:00:42
272000 -- (-318.924) (-315.793) (-317.993) [-319.642] * (-322.793) [-315.474] (-316.090) (-316.037) -- 0:00:42
272500 -- [-316.542] (-318.849) (-318.369) (-321.822) * (-317.321) [-315.808] (-315.077) (-316.286) -- 0:00:42
273000 -- (-316.049) (-317.280) (-319.813) [-316.761] * (-317.722) [-319.070] (-318.281) (-315.838) -- 0:00:42
273500 -- (-319.519) [-318.568] (-318.589) (-315.730) * (-316.048) (-319.209) (-316.536) [-316.817] -- 0:00:42
274000 -- (-322.548) (-316.104) [-317.269] (-317.525) * (-317.688) (-315.739) [-317.698] (-316.103) -- 0:00:42
274500 -- (-323.064) (-316.598) [-317.323] (-316.666) * (-317.030) (-316.956) (-316.968) [-316.828] -- 0:00:42
275000 -- (-318.336) [-315.745] (-317.224) (-317.679) * (-315.680) (-316.500) [-317.618] (-317.572) -- 0:00:42
Average standard deviation of split frequencies: 0.018788
275500 -- (-317.549) (-317.632) [-316.540] (-318.069) * (-317.664) (-316.215) (-318.396) [-316.529] -- 0:00:42
276000 -- (-317.816) [-318.055] (-316.905) (-317.256) * (-316.348) [-315.056] (-317.631) (-318.362) -- 0:00:41
276500 -- (-321.799) (-315.731) (-319.486) [-318.465] * (-316.664) (-316.973) (-318.401) [-317.191] -- 0:00:41
277000 -- (-317.446) (-321.383) (-316.942) [-316.997] * [-316.940] (-318.816) (-316.326) (-315.782) -- 0:00:44
277500 -- (-318.141) (-318.639) [-320.039] (-317.407) * (-315.691) (-318.477) [-316.113] (-317.259) -- 0:00:44
278000 -- (-317.743) (-317.604) [-315.745] (-316.835) * (-317.105) [-315.830] (-317.442) (-317.962) -- 0:00:44
278500 -- (-318.634) (-320.473) (-315.906) [-317.991] * [-319.735] (-318.296) (-316.166) (-317.661) -- 0:00:44
279000 -- (-316.613) [-316.624] (-320.783) (-317.742) * (-315.755) (-317.253) (-315.656) [-315.610] -- 0:00:43
279500 -- (-319.633) (-315.642) [-318.116] (-315.694) * (-315.362) (-316.760) [-316.323] (-316.058) -- 0:00:43
280000 -- (-322.265) [-317.537] (-321.486) (-318.499) * [-316.786] (-317.512) (-316.553) (-316.322) -- 0:00:43
Average standard deviation of split frequencies: 0.017076
280500 -- (-319.834) (-315.301) (-315.392) [-318.018] * (-319.476) (-316.278) [-318.747] (-315.845) -- 0:00:43
281000 -- [-316.890] (-314.951) (-316.458) (-316.849) * (-317.022) (-316.238) (-323.556) [-317.711] -- 0:00:43
281500 -- (-315.423) (-315.878) [-317.285] (-317.332) * (-318.849) (-315.873) [-317.463] (-315.729) -- 0:00:43
282000 -- (-317.927) (-316.143) (-316.265) [-316.311] * (-317.232) (-317.553) [-316.373] (-317.899) -- 0:00:43
282500 -- [-319.318] (-318.357) (-316.622) (-315.247) * (-315.537) [-319.666] (-318.048) (-318.120) -- 0:00:43
283000 -- (-316.484) (-317.115) (-319.955) [-314.937] * [-315.462] (-316.829) (-316.341) (-316.584) -- 0:00:43
283500 -- (-317.570) [-316.260] (-318.458) (-315.666) * (-317.010) (-316.848) [-317.190] (-319.397) -- 0:00:42
284000 -- [-318.977] (-316.987) (-320.010) (-317.840) * [-323.855] (-317.846) (-316.126) (-316.625) -- 0:00:42
284500 -- (-325.479) (-315.606) (-316.153) [-315.645] * (-328.378) [-317.925] (-319.810) (-316.796) -- 0:00:42
285000 -- [-317.770] (-315.368) (-319.958) (-317.697) * [-318.232] (-317.746) (-317.609) (-316.098) -- 0:00:42
Average standard deviation of split frequencies: 0.017263
285500 -- (-320.275) [-317.242] (-319.160) (-325.272) * (-316.681) [-315.753] (-317.064) (-316.054) -- 0:00:42
286000 -- (-321.374) (-316.909) [-315.383] (-320.265) * (-325.037) [-315.420] (-317.337) (-317.801) -- 0:00:42
286500 -- (-319.517) (-318.663) [-315.632] (-320.221) * (-317.694) (-315.953) (-316.047) [-316.086] -- 0:00:42
287000 -- (-316.423) (-319.094) [-316.330] (-317.800) * (-322.691) (-318.382) (-319.768) [-319.763] -- 0:00:42
287500 -- (-317.914) [-316.839] (-316.425) (-318.177) * [-319.624] (-318.368) (-318.999) (-320.716) -- 0:00:42
288000 -- (-316.675) (-318.673) [-315.279] (-317.242) * (-315.688) (-316.682) (-319.261) [-316.417] -- 0:00:42
288500 -- (-316.792) (-321.532) [-315.866] (-315.652) * (-322.616) (-318.347) (-319.934) [-316.393] -- 0:00:41
289000 -- (-318.654) [-317.641] (-315.454) (-315.973) * (-318.752) (-318.088) [-318.172] (-319.203) -- 0:00:41
289500 -- (-318.460) (-321.297) [-316.773] (-320.658) * (-319.208) (-317.427) (-316.945) [-320.067] -- 0:00:41
290000 -- [-317.494] (-315.451) (-315.530) (-316.666) * (-315.926) (-316.136) (-316.868) [-315.231] -- 0:00:41
Average standard deviation of split frequencies: 0.017119
290500 -- (-315.746) (-318.203) (-317.078) [-315.904] * [-319.061] (-316.296) (-319.388) (-315.358) -- 0:00:41
291000 -- (-317.036) (-322.429) (-317.371) [-316.940] * [-317.357] (-319.912) (-319.009) (-315.455) -- 0:00:41
291500 -- (-319.514) [-316.435] (-315.797) (-315.722) * [-315.557] (-319.051) (-320.421) (-317.067) -- 0:00:41
292000 -- (-316.667) (-315.799) (-316.519) [-316.938] * (-315.820) (-316.034) (-316.234) [-317.404] -- 0:00:41
292500 -- (-316.349) (-320.379) (-317.529) [-316.744] * (-317.088) (-319.803) [-315.524] (-316.708) -- 0:00:41
293000 -- [-316.330] (-316.142) (-319.005) (-317.304) * (-317.766) (-325.374) [-315.808] (-315.865) -- 0:00:41
293500 -- [-316.698] (-317.504) (-318.007) (-319.755) * (-317.203) (-320.216) [-319.357] (-316.785) -- 0:00:40
294000 -- (-315.455) (-317.254) [-317.885] (-318.205) * (-316.229) [-315.728] (-317.491) (-316.378) -- 0:00:40
294500 -- [-318.968] (-317.560) (-317.257) (-316.710) * (-317.301) (-317.939) [-318.457] (-317.192) -- 0:00:43
295000 -- [-318.083] (-316.837) (-316.939) (-318.317) * (-317.259) [-318.345] (-318.645) (-317.254) -- 0:00:43
Average standard deviation of split frequencies: 0.016368
295500 -- [-316.243] (-317.719) (-318.982) (-318.973) * (-317.053) [-323.778] (-315.767) (-315.257) -- 0:00:42
296000 -- (-317.290) [-315.611] (-317.994) (-316.484) * (-315.645) [-318.830] (-319.295) (-318.736) -- 0:00:42
296500 -- (-318.602) [-316.251] (-318.744) (-320.263) * (-316.219) [-316.467] (-317.674) (-316.574) -- 0:00:42
297000 -- (-315.487) (-315.659) (-316.978) [-317.725] * [-315.637] (-318.020) (-316.170) (-316.492) -- 0:00:42
297500 -- (-317.140) [-315.968] (-321.637) (-322.330) * (-317.557) (-315.993) [-317.091] (-317.698) -- 0:00:42
298000 -- (-316.692) (-318.806) (-317.307) [-316.458] * (-315.264) (-317.084) (-322.124) [-318.004] -- 0:00:42
298500 -- (-315.425) (-318.185) [-317.238] (-316.077) * (-315.914) (-315.979) [-315.458] (-315.549) -- 0:00:42
299000 -- [-316.314] (-320.660) (-321.687) (-315.793) * (-315.250) (-318.097) [-319.085] (-316.303) -- 0:00:42
299500 -- [-315.262] (-318.024) (-315.578) (-315.163) * [-315.334] (-317.617) (-320.562) (-318.548) -- 0:00:42
300000 -- (-316.938) (-320.447) [-315.693] (-316.127) * [-315.145] (-319.304) (-316.027) (-318.577) -- 0:00:42
Average standard deviation of split frequencies: 0.016550
300500 -- (-316.229) [-318.011] (-316.404) (-318.809) * (-317.906) (-316.400) [-316.404] (-320.623) -- 0:00:41
301000 -- (-324.096) [-317.639] (-319.873) (-317.377) * (-320.617) (-317.260) [-315.526] (-318.566) -- 0:00:41
301500 -- (-319.280) [-317.529] (-320.257) (-319.242) * [-316.200] (-321.224) (-314.959) (-316.910) -- 0:00:41
302000 -- (-320.263) (-315.799) [-316.959] (-318.142) * (-320.318) (-319.784) (-316.546) [-318.642] -- 0:00:41
302500 -- (-317.084) [-316.764] (-318.875) (-315.394) * (-321.557) [-317.382] (-316.404) (-318.679) -- 0:00:41
303000 -- [-315.958] (-315.872) (-317.143) (-318.121) * (-317.116) [-324.251] (-318.043) (-317.272) -- 0:00:41
303500 -- (-315.940) (-315.339) [-316.126] (-318.793) * (-319.411) (-318.377) (-315.867) [-317.920] -- 0:00:41
304000 -- (-318.113) (-317.480) [-317.283] (-316.693) * (-317.126) (-318.173) (-316.245) [-319.157] -- 0:00:41
304500 -- (-319.408) [-316.668] (-317.642) (-316.327) * [-316.824] (-316.221) (-315.857) (-315.541) -- 0:00:41
305000 -- (-316.961) (-316.869) (-316.288) [-315.394] * (-316.989) (-315.629) [-317.082] (-316.567) -- 0:00:41
Average standard deviation of split frequencies: 0.015568
305500 -- [-319.657] (-317.184) (-321.643) (-318.891) * (-316.363) [-318.805] (-316.871) (-316.063) -- 0:00:40
306000 -- (-317.185) (-315.604) (-317.579) [-316.525] * [-319.274] (-319.474) (-316.145) (-316.437) -- 0:00:40
306500 -- (-317.420) (-315.597) (-315.393) [-315.985] * [-317.651] (-317.690) (-316.679) (-317.733) -- 0:00:40
307000 -- [-317.812] (-315.876) (-318.749) (-315.987) * (-317.688) (-316.640) (-317.376) [-316.609] -- 0:00:40
307500 -- (-316.808) [-316.454] (-316.523) (-316.108) * (-321.075) [-317.745] (-316.465) (-316.113) -- 0:00:40
308000 -- (-318.965) [-318.121] (-317.173) (-315.849) * (-315.665) (-316.671) [-316.002] (-316.848) -- 0:00:40
308500 -- (-318.220) (-317.932) (-319.057) [-320.764] * (-318.203) (-321.425) [-315.730] (-315.960) -- 0:00:40
309000 -- (-316.381) (-317.292) (-317.675) [-317.072] * (-317.888) (-317.294) (-318.165) [-315.108] -- 0:00:40
309500 -- (-319.428) [-316.868] (-316.457) (-318.903) * [-319.228] (-316.687) (-321.273) (-317.833) -- 0:00:40
310000 -- [-318.233] (-315.519) (-315.881) (-316.209) * (-321.321) [-317.053] (-315.346) (-317.697) -- 0:00:40
Average standard deviation of split frequencies: 0.017281
310500 -- (-320.357) (-317.447) [-315.770] (-317.277) * (-316.319) [-316.163] (-315.350) (-319.234) -- 0:00:39
311000 -- (-321.597) (-316.387) [-316.066] (-317.284) * [-320.111] (-323.307) (-321.735) (-315.607) -- 0:00:39
311500 -- [-317.593] (-317.278) (-316.343) (-319.164) * (-320.256) (-320.809) (-318.037) [-316.754] -- 0:00:41
312000 -- [-318.196] (-319.068) (-318.563) (-316.317) * [-320.780] (-318.904) (-318.669) (-320.337) -- 0:00:41
312500 -- (-317.279) (-316.646) (-319.526) [-316.832] * (-316.636) (-321.387) (-315.992) [-316.992] -- 0:00:41
313000 -- (-319.419) (-316.144) [-316.567] (-316.814) * (-316.627) (-317.350) [-316.945] (-316.331) -- 0:00:41
313500 -- [-318.065] (-321.024) (-318.052) (-316.857) * (-319.887) (-316.855) [-318.451] (-317.239) -- 0:00:41
314000 -- (-318.063) [-317.343] (-317.748) (-316.401) * [-318.193] (-321.426) (-318.088) (-318.675) -- 0:00:41
314500 -- (-315.519) (-323.569) [-315.639] (-315.159) * [-319.191] (-318.560) (-316.472) (-324.033) -- 0:00:41
315000 -- [-319.224] (-322.327) (-317.018) (-316.306) * (-320.655) [-319.323] (-315.818) (-316.483) -- 0:00:41
Average standard deviation of split frequencies: 0.017006
315500 -- (-317.674) [-319.160] (-316.448) (-317.298) * [-317.157] (-318.880) (-320.794) (-317.302) -- 0:00:41
316000 -- (-315.880) (-321.045) (-317.431) [-317.354] * [-316.917] (-319.045) (-320.280) (-318.134) -- 0:00:41
316500 -- (-317.374) [-316.238] (-318.878) (-315.744) * (-316.330) (-316.155) (-316.952) [-318.297] -- 0:00:41
317000 -- (-316.237) (-317.703) [-317.167] (-317.525) * (-317.547) (-315.962) [-315.924] (-321.514) -- 0:00:40
317500 -- [-316.516] (-317.667) (-320.268) (-321.136) * (-317.669) (-319.156) [-316.040] (-320.938) -- 0:00:40
318000 -- (-322.214) (-318.002) [-317.537] (-322.032) * (-320.640) (-316.776) (-318.071) [-316.283] -- 0:00:40
318500 -- [-320.298] (-320.756) (-320.437) (-322.697) * (-316.982) (-315.859) (-317.184) [-317.955] -- 0:00:40
319000 -- (-319.088) (-315.983) (-316.477) [-315.605] * [-315.037] (-317.090) (-317.457) (-318.372) -- 0:00:40
319500 -- (-315.564) (-316.882) [-315.908] (-315.102) * [-316.334] (-318.073) (-315.880) (-315.993) -- 0:00:40
320000 -- (-317.083) (-317.076) [-315.566] (-316.734) * (-315.220) (-321.658) (-320.153) [-318.427] -- 0:00:40
Average standard deviation of split frequencies: 0.017022
320500 -- (-316.972) (-318.068) (-317.405) [-316.105] * (-316.386) (-319.676) [-315.866] (-316.562) -- 0:00:40
321000 -- (-318.725) (-317.379) (-315.541) [-316.094] * (-320.576) [-321.955] (-316.327) (-316.939) -- 0:00:40
321500 -- [-316.509] (-318.339) (-319.371) (-317.063) * (-316.750) [-317.684] (-316.267) (-318.081) -- 0:00:40
322000 -- (-318.643) (-321.127) [-317.600] (-317.436) * (-315.975) (-316.442) [-318.086] (-316.871) -- 0:00:40
322500 -- (-318.401) (-320.929) (-317.863) [-320.477] * (-317.430) [-316.506] (-321.882) (-316.598) -- 0:00:39
323000 -- (-320.082) (-318.404) (-320.432) [-316.503] * (-317.376) [-320.560] (-319.820) (-318.181) -- 0:00:39
323500 -- (-318.458) [-316.072] (-320.565) (-315.147) * (-318.230) [-322.123] (-317.530) (-316.014) -- 0:00:39
324000 -- (-322.168) [-318.358] (-319.376) (-319.297) * (-316.137) (-318.633) (-319.794) [-316.583] -- 0:00:39
324500 -- (-319.945) (-316.520) [-320.214] (-319.341) * [-316.448] (-317.485) (-317.861) (-316.333) -- 0:00:39
325000 -- (-321.466) (-324.085) [-318.057] (-315.907) * (-319.056) (-316.572) (-315.999) [-317.387] -- 0:00:39
Average standard deviation of split frequencies: 0.016113
325500 -- (-320.978) [-320.005] (-319.195) (-317.914) * (-319.236) (-318.284) [-317.517] (-319.504) -- 0:00:39
326000 -- (-316.662) (-321.592) [-316.309] (-322.310) * (-317.137) (-315.898) (-315.433) [-319.282] -- 0:00:39
326500 -- (-320.524) (-316.517) [-317.039] (-316.428) * (-318.717) [-315.675] (-316.275) (-318.919) -- 0:00:39
327000 -- (-320.881) (-316.765) [-317.412] (-317.407) * (-318.034) [-316.236] (-318.090) (-315.836) -- 0:00:39
327500 -- (-318.929) (-318.079) [-320.245] (-316.841) * (-318.108) (-315.461) (-319.818) [-317.126] -- 0:00:39
328000 -- (-316.168) [-317.035] (-315.496) (-316.806) * (-319.357) (-315.601) (-317.788) [-317.209] -- 0:00:38
328500 -- (-316.781) [-322.241] (-316.194) (-322.682) * (-320.921) (-318.012) (-318.850) [-317.574] -- 0:00:40
329000 -- [-318.809] (-320.072) (-317.275) (-318.750) * (-320.803) (-321.273) (-322.587) [-316.649] -- 0:00:40
329500 -- (-315.928) (-321.342) (-316.691) [-316.701] * [-315.656] (-315.387) (-320.414) (-320.171) -- 0:00:40
330000 -- (-317.261) (-318.307) (-316.280) [-318.676] * (-317.244) [-316.438] (-317.754) (-318.506) -- 0:00:40
Average standard deviation of split frequencies: 0.016507
330500 -- (-316.625) (-316.800) (-318.877) [-327.534] * (-318.425) [-317.553] (-317.053) (-320.129) -- 0:00:40
331000 -- (-317.544) [-318.769] (-318.131) (-319.215) * (-316.929) (-316.520) (-317.980) [-319.626] -- 0:00:40
331500 -- (-318.667) [-319.761] (-316.645) (-320.996) * (-319.187) (-317.350) (-320.336) [-316.734] -- 0:00:40
332000 -- (-318.551) [-317.448] (-317.760) (-316.113) * (-316.421) (-319.267) (-315.483) [-316.085] -- 0:00:40
332500 -- (-318.030) (-315.549) (-317.257) [-320.380] * (-319.704) [-316.743] (-318.802) (-316.945) -- 0:00:40
333000 -- (-316.481) (-319.356) (-315.426) [-319.377] * (-320.213) (-316.320) (-320.690) [-315.284] -- 0:00:40
333500 -- (-318.030) (-317.544) (-316.101) [-317.890] * (-317.463) [-316.210] (-318.112) (-317.324) -- 0:00:39
334000 -- (-317.395) (-317.371) (-315.223) [-320.907] * (-324.087) (-316.524) (-315.940) [-315.851] -- 0:00:39
334500 -- (-320.108) (-319.466) [-318.775] (-317.066) * (-315.671) [-315.940] (-316.490) (-317.555) -- 0:00:39
335000 -- (-319.377) (-316.608) [-316.616] (-318.358) * [-316.214] (-318.778) (-315.296) (-319.083) -- 0:00:39
Average standard deviation of split frequencies: 0.015433
335500 -- (-319.003) [-316.908] (-317.844) (-317.670) * [-316.835] (-320.410) (-316.450) (-318.477) -- 0:00:39
336000 -- (-317.158) (-318.451) (-320.501) [-315.633] * (-323.674) (-319.193) (-317.137) [-315.586] -- 0:00:39
336500 -- [-316.062] (-316.784) (-318.449) (-317.137) * [-320.259] (-316.773) (-316.054) (-315.939) -- 0:00:39
337000 -- (-316.475) (-319.042) (-316.156) [-318.645] * [-317.796] (-321.695) (-316.459) (-316.866) -- 0:00:39
337500 -- (-320.355) [-316.682] (-316.433) (-316.160) * [-316.524] (-317.829) (-320.231) (-315.856) -- 0:00:39
338000 -- (-319.620) (-316.773) (-316.510) [-318.135] * [-316.406] (-317.898) (-316.222) (-317.990) -- 0:00:39
338500 -- (-319.617) (-316.830) (-315.733) [-316.779] * (-316.399) (-318.968) [-317.538] (-318.140) -- 0:00:39
339000 -- (-318.928) (-317.579) [-315.597] (-316.753) * (-320.206) (-318.512) (-316.264) [-317.426] -- 0:00:38
339500 -- [-317.662] (-317.265) (-316.339) (-319.094) * (-318.368) (-317.500) [-315.548] (-315.561) -- 0:00:38
340000 -- [-319.393] (-315.782) (-316.591) (-317.434) * [-317.822] (-321.396) (-315.376) (-319.488) -- 0:00:38
Average standard deviation of split frequencies: 0.016023
340500 -- (-320.350) (-317.287) [-319.117] (-316.490) * (-317.457) [-316.358] (-317.615) (-319.698) -- 0:00:38
341000 -- (-317.010) (-317.915) (-316.743) [-318.033] * (-318.434) (-317.067) (-316.464) [-316.092] -- 0:00:38
341500 -- (-326.619) (-316.468) [-317.997] (-317.565) * (-317.025) [-318.405] (-318.463) (-320.454) -- 0:00:38
342000 -- (-316.003) (-317.445) [-320.825] (-316.194) * [-315.668] (-319.125) (-316.250) (-317.590) -- 0:00:38
342500 -- (-317.700) (-318.878) (-317.521) [-316.846] * (-324.884) [-315.744] (-316.511) (-316.962) -- 0:00:38
343000 -- (-316.859) [-317.137] (-320.098) (-315.402) * (-318.967) (-316.514) (-316.671) [-318.357] -- 0:00:38
343500 -- (-316.651) (-317.902) [-318.985] (-316.616) * (-316.638) (-319.307) [-315.447] (-320.771) -- 0:00:38
344000 -- (-317.855) (-317.676) (-324.751) [-316.958] * (-319.970) (-319.595) [-316.091] (-319.371) -- 0:00:38
344500 -- (-318.426) [-316.867] (-317.129) (-316.098) * (-317.445) [-320.368] (-318.188) (-316.351) -- 0:00:38
345000 -- [-319.600] (-318.667) (-317.018) (-316.370) * (-319.584) (-316.262) [-315.898] (-320.280) -- 0:00:37
Average standard deviation of split frequencies: 0.016220
345500 -- (-320.415) (-317.275) (-316.207) [-317.272] * (-317.718) [-318.063] (-317.119) (-318.790) -- 0:00:39
346000 -- [-316.265] (-320.067) (-315.013) (-317.272) * (-315.616) (-315.293) (-320.019) [-315.594] -- 0:00:39
346500 -- [-317.345] (-317.835) (-315.304) (-319.297) * (-316.582) (-322.673) (-320.252) [-319.911] -- 0:00:39
347000 -- (-316.882) (-316.588) [-316.267] (-318.147) * (-318.737) (-316.600) [-317.420] (-318.995) -- 0:00:39
347500 -- (-315.444) [-316.550] (-316.362) (-324.415) * [-316.129] (-318.464) (-320.067) (-319.649) -- 0:00:39
348000 -- (-319.173) (-317.705) (-315.335) [-315.737] * (-317.451) (-318.200) [-315.844] (-315.962) -- 0:00:39
348500 -- (-319.940) (-316.730) [-316.450] (-317.453) * (-317.841) [-317.244] (-315.796) (-317.354) -- 0:00:39
349000 -- (-316.571) (-316.923) [-317.479] (-317.648) * (-318.845) (-315.572) (-316.033) [-316.347] -- 0:00:39
349500 -- (-315.752) [-315.615] (-317.533) (-318.352) * (-317.464) (-320.202) (-316.744) [-317.726] -- 0:00:39
350000 -- [-316.416] (-323.531) (-324.427) (-320.289) * (-317.576) (-316.709) [-320.110] (-318.410) -- 0:00:39
Average standard deviation of split frequencies: 0.015353
350500 -- (-319.721) (-315.568) (-316.440) [-318.613] * (-317.756) (-317.572) [-319.289] (-316.203) -- 0:00:38
351000 -- [-317.945] (-317.791) (-315.882) (-318.238) * (-317.701) (-316.485) (-316.523) [-315.579] -- 0:00:38
351500 -- (-315.734) (-321.408) (-319.025) [-319.293] * (-316.978) (-315.129) [-321.743] (-317.133) -- 0:00:38
352000 -- [-316.411] (-324.248) (-317.485) (-318.388) * (-316.124) (-316.180) (-315.857) [-315.811] -- 0:00:38
352500 -- (-316.417) (-317.749) (-315.671) [-318.850] * (-316.880) (-315.897) [-318.662] (-316.678) -- 0:00:38
353000 -- (-319.190) (-317.103) [-317.334] (-321.151) * (-324.877) [-317.540] (-317.957) (-321.221) -- 0:00:38
353500 -- [-315.252] (-317.238) (-320.650) (-318.906) * (-319.011) (-321.133) (-318.898) [-320.853] -- 0:00:38
354000 -- (-316.214) (-316.399) [-317.426] (-317.520) * (-316.525) [-321.469] (-317.752) (-315.665) -- 0:00:38
354500 -- (-318.532) [-317.269] (-319.133) (-317.260) * (-322.746) [-315.491] (-317.223) (-316.365) -- 0:00:38
355000 -- [-317.850] (-316.070) (-316.474) (-316.246) * (-317.467) [-314.973] (-316.371) (-318.876) -- 0:00:38
Average standard deviation of split frequencies: 0.015332
355500 -- (-320.689) (-316.977) [-316.619] (-315.965) * (-315.422) [-318.414] (-318.859) (-319.874) -- 0:00:38
356000 -- (-322.836) [-316.592] (-316.017) (-316.732) * [-315.378] (-317.211) (-315.012) (-318.039) -- 0:00:37
356500 -- (-317.883) (-317.614) [-315.202] (-315.603) * (-315.782) [-319.288] (-316.530) (-319.650) -- 0:00:37
357000 -- (-315.889) [-319.197] (-318.055) (-317.976) * (-318.693) (-318.046) (-317.013) [-317.196] -- 0:00:37
357500 -- (-315.027) (-318.739) [-318.188] (-316.060) * [-315.736] (-318.545) (-315.790) (-316.876) -- 0:00:37
358000 -- [-315.586] (-315.777) (-319.138) (-320.104) * (-317.122) (-318.980) (-315.482) [-315.892] -- 0:00:37
358500 -- (-317.318) [-316.537] (-317.592) (-321.648) * (-315.219) (-317.965) (-317.360) [-315.204] -- 0:00:37
359000 -- (-318.432) (-316.781) (-318.903) [-317.491] * (-316.293) (-317.284) (-319.738) [-315.961] -- 0:00:37
359500 -- (-317.517) (-317.305) [-316.465] (-317.613) * (-317.801) [-317.763] (-317.427) (-316.061) -- 0:00:37
360000 -- (-316.888) (-317.044) [-317.258] (-319.350) * (-316.440) [-318.535] (-318.385) (-318.293) -- 0:00:37
Average standard deviation of split frequencies: 0.014668
360500 -- (-320.128) [-316.810] (-317.165) (-317.511) * [-317.765] (-317.757) (-318.910) (-319.401) -- 0:00:37
361000 -- (-319.990) (-317.588) (-316.027) [-317.203] * (-323.440) (-315.477) (-315.805) [-321.489] -- 0:00:37
361500 -- (-318.956) (-316.909) (-317.037) [-315.759] * [-321.489] (-319.090) (-318.225) (-319.179) -- 0:00:37
362000 -- [-315.588] (-322.352) (-320.096) (-316.822) * (-319.332) [-317.876] (-318.662) (-322.182) -- 0:00:37
362500 -- (-315.195) (-318.517) (-319.456) [-316.668] * (-318.038) (-317.683) (-317.399) [-318.637] -- 0:00:36
363000 -- (-323.507) [-319.680] (-320.222) (-316.686) * (-318.172) (-316.484) [-316.244] (-317.940) -- 0:00:38
363500 -- (-323.172) (-317.525) (-317.624) [-319.408] * [-315.786] (-316.861) (-316.360) (-323.449) -- 0:00:38
364000 -- (-319.285) (-316.601) (-317.439) [-316.991] * (-316.239) (-316.781) [-316.336] (-322.462) -- 0:00:38
364500 -- (-319.452) (-318.813) (-315.811) [-316.409] * (-317.671) [-317.296] (-318.573) (-316.103) -- 0:00:38
365000 -- (-315.561) (-319.714) (-319.752) [-315.189] * (-318.679) [-315.458] (-317.197) (-315.693) -- 0:00:38
Average standard deviation of split frequencies: 0.015027
365500 -- (-316.418) [-321.177] (-319.893) (-318.240) * (-318.283) [-316.908] (-317.780) (-319.325) -- 0:00:38
366000 -- (-320.163) (-317.324) [-316.783] (-319.067) * (-321.152) [-318.724] (-317.374) (-317.852) -- 0:00:38
366500 -- (-317.071) (-316.076) (-317.360) [-318.140] * (-316.977) (-321.340) (-318.246) [-316.837] -- 0:00:38
367000 -- [-323.153] (-320.115) (-320.629) (-316.152) * (-317.942) (-319.101) [-319.677] (-317.994) -- 0:00:37
367500 -- (-321.114) [-319.301] (-319.337) (-320.327) * [-316.659] (-318.242) (-318.665) (-320.655) -- 0:00:37
368000 -- (-315.590) (-317.628) [-316.454] (-316.058) * (-315.719) (-317.724) (-317.306) [-316.547] -- 0:00:37
368500 -- [-317.251] (-319.660) (-316.704) (-315.429) * (-317.117) (-318.306) (-320.155) [-315.582] -- 0:00:37
369000 -- (-314.967) (-317.091) [-316.905] (-317.333) * (-316.441) (-321.830) [-317.493] (-315.285) -- 0:00:37
369500 -- (-316.726) [-317.712] (-317.329) (-319.075) * (-316.744) [-318.037] (-317.277) (-319.557) -- 0:00:37
370000 -- [-316.790] (-315.870) (-318.544) (-319.043) * [-315.594] (-317.002) (-320.057) (-317.180) -- 0:00:37
Average standard deviation of split frequencies: 0.015968
370500 -- (-324.767) [-317.275] (-321.400) (-315.658) * (-316.066) (-318.317) (-320.427) [-317.365] -- 0:00:37
371000 -- [-319.076] (-319.348) (-316.911) (-316.103) * (-315.559) [-317.740] (-320.525) (-323.109) -- 0:00:37
371500 -- (-316.900) [-316.731] (-316.573) (-318.743) * (-316.787) (-318.409) [-318.094] (-320.275) -- 0:00:37
372000 -- (-315.747) [-317.554] (-317.864) (-316.760) * (-316.262) (-318.258) [-316.948] (-318.549) -- 0:00:37
372500 -- [-316.563] (-316.511) (-320.448) (-317.611) * [-315.644] (-316.411) (-319.653) (-321.843) -- 0:00:37
373000 -- (-317.363) (-317.061) [-316.249] (-316.463) * (-316.334) (-316.116) (-318.760) [-316.178] -- 0:00:36
373500 -- [-317.659] (-316.157) (-320.966) (-316.218) * [-316.916] (-316.667) (-316.561) (-315.586) -- 0:00:36
374000 -- (-320.324) (-316.024) (-319.300) [-316.560] * (-319.484) (-316.170) [-315.063] (-321.770) -- 0:00:36
374500 -- (-319.561) (-316.600) (-316.860) [-317.363] * (-320.252) [-319.988] (-315.934) (-319.296) -- 0:00:36
375000 -- (-318.331) [-317.570] (-318.955) (-317.358) * (-319.324) (-324.246) (-315.124) [-316.612] -- 0:00:36
Average standard deviation of split frequencies: 0.015323
375500 -- (-317.040) [-317.872] (-318.185) (-320.002) * (-320.543) (-316.582) [-318.265] (-317.648) -- 0:00:36
376000 -- (-318.987) (-318.794) (-318.945) [-317.225] * (-322.265) [-320.590] (-316.598) (-317.917) -- 0:00:36
376500 -- (-319.644) (-317.677) [-318.726] (-315.188) * (-318.349) (-317.065) (-317.882) [-316.636] -- 0:00:36
377000 -- [-315.905] (-317.151) (-317.083) (-317.632) * (-318.489) (-320.504) [-317.191] (-320.279) -- 0:00:36
377500 -- (-316.269) (-316.335) [-316.164] (-317.191) * (-318.051) (-317.402) [-316.265] (-316.183) -- 0:00:36
378000 -- (-318.594) (-317.510) (-317.223) [-317.466] * (-316.878) (-316.516) [-317.009] (-315.578) -- 0:00:36
378500 -- (-317.269) [-315.754] (-315.247) (-316.219) * [-318.199] (-320.983) (-316.392) (-317.249) -- 0:00:36
379000 -- [-318.057] (-315.954) (-318.040) (-316.059) * (-316.921) (-316.940) [-317.502] (-317.254) -- 0:00:37
379500 -- (-317.786) (-316.429) [-316.068] (-316.922) * [-316.520] (-316.457) (-317.769) (-318.737) -- 0:00:37
380000 -- [-316.385] (-315.430) (-321.287) (-317.953) * (-315.454) (-315.104) [-320.439] (-315.427) -- 0:00:37
Average standard deviation of split frequencies: 0.015867
380500 -- (-317.000) [-318.334] (-317.740) (-316.047) * (-317.833) [-317.487] (-315.653) (-318.451) -- 0:00:37
381000 -- (-316.363) (-318.238) [-315.894] (-316.197) * (-316.331) (-316.452) [-315.833] (-316.056) -- 0:00:37
381500 -- (-315.424) [-316.971] (-319.533) (-318.333) * (-315.244) (-320.406) (-315.476) [-319.356] -- 0:00:37
382000 -- (-315.741) [-319.643] (-318.538) (-315.931) * (-316.906) (-318.909) (-316.703) [-317.398] -- 0:00:37
382500 -- (-315.627) (-318.062) [-317.585] (-320.038) * (-317.923) (-321.113) (-316.317) [-316.188] -- 0:00:37
383000 -- [-317.390] (-318.231) (-320.194) (-318.663) * (-317.714) [-316.409] (-319.911) (-315.904) -- 0:00:37
383500 -- (-317.161) [-320.178] (-318.599) (-316.849) * (-316.010) (-319.327) (-316.765) [-316.625] -- 0:00:36
384000 -- (-317.230) [-315.662] (-317.021) (-316.837) * (-318.894) (-317.755) [-317.484] (-317.155) -- 0:00:36
384500 -- [-317.378] (-317.358) (-320.006) (-317.235) * (-318.172) [-316.517] (-320.310) (-317.533) -- 0:00:36
385000 -- (-318.564) [-316.120] (-321.014) (-315.865) * (-317.393) [-318.961] (-320.247) (-315.793) -- 0:00:36
Average standard deviation of split frequencies: 0.014808
385500 -- (-318.401) [-319.144] (-321.919) (-317.708) * [-315.975] (-315.851) (-315.836) (-317.631) -- 0:00:36
386000 -- (-317.077) (-320.658) [-318.375] (-315.651) * (-315.452) (-317.770) [-318.793] (-320.342) -- 0:00:36
386500 -- [-317.665] (-317.615) (-321.955) (-315.862) * [-317.188] (-315.739) (-316.671) (-317.150) -- 0:00:36
387000 -- (-318.550) [-316.327] (-317.701) (-316.255) * (-317.872) [-315.525] (-319.885) (-319.171) -- 0:00:36
387500 -- (-316.083) (-315.530) [-315.668] (-315.554) * (-317.141) (-316.411) [-321.227] (-320.515) -- 0:00:36
388000 -- (-316.900) (-316.931) (-319.110) [-315.557] * (-316.853) (-318.725) (-317.582) [-319.787] -- 0:00:36
388500 -- (-318.086) [-318.029] (-322.154) (-320.214) * (-318.286) (-318.795) (-320.979) [-319.688] -- 0:00:36
389000 -- (-316.874) (-316.682) (-320.501) [-315.431] * (-317.012) [-315.883] (-317.564) (-318.555) -- 0:00:36
389500 -- (-318.104) (-315.893) [-319.959] (-315.317) * (-316.930) (-317.461) [-316.316] (-316.998) -- 0:00:36
390000 -- (-317.143) [-317.371] (-318.839) (-315.560) * (-320.184) (-317.858) (-315.880) [-315.855] -- 0:00:35
Average standard deviation of split frequencies: 0.015048
390500 -- (-318.942) (-317.632) (-319.813) [-316.978] * [-319.627] (-315.980) (-316.872) (-318.444) -- 0:00:35
391000 -- [-315.341] (-319.674) (-317.194) (-315.995) * (-317.036) [-315.319] (-317.550) (-316.415) -- 0:00:35
391500 -- (-317.301) (-319.042) (-318.020) [-316.109] * (-316.940) [-315.046] (-318.883) (-316.329) -- 0:00:35
392000 -- (-317.348) (-317.058) (-317.782) [-315.974] * (-317.897) (-316.423) (-319.218) [-318.000] -- 0:00:35
392500 -- (-315.834) (-316.269) [-318.405] (-317.255) * (-315.804) (-317.582) (-316.357) [-315.855] -- 0:00:35
393000 -- [-318.764] (-316.710) (-318.102) (-320.936) * (-318.519) [-319.756] (-320.611) (-318.798) -- 0:00:35
393500 -- [-315.806] (-321.010) (-318.517) (-319.333) * (-318.870) (-316.270) (-319.956) [-319.538] -- 0:00:35
394000 -- [-316.400] (-321.418) (-316.457) (-315.441) * [-316.982] (-316.697) (-320.633) (-319.461) -- 0:00:35
394500 -- (-321.846) (-318.615) [-317.852] (-315.978) * (-319.134) [-317.057] (-318.761) (-319.719) -- 0:00:35
395000 -- (-316.296) [-316.831] (-316.712) (-316.150) * (-320.853) [-318.962] (-315.501) (-318.127) -- 0:00:35
Average standard deviation of split frequencies: 0.013913
395500 -- (-316.113) [-316.683] (-316.514) (-317.104) * (-317.466) (-315.986) [-322.308] (-317.724) -- 0:00:35
396000 -- (-315.062) (-315.394) (-316.290) [-316.584] * (-318.078) [-317.157] (-318.988) (-317.322) -- 0:00:36
396500 -- (-314.925) (-317.180) [-315.726] (-317.196) * (-319.608) [-315.104] (-316.327) (-315.505) -- 0:00:36
397000 -- (-315.540) [-318.211] (-315.494) (-316.118) * (-318.929) (-315.793) (-321.644) [-317.493] -- 0:00:36
397500 -- (-317.357) (-319.197) (-317.467) [-316.960] * (-318.578) [-316.855] (-320.765) (-317.063) -- 0:00:36
398000 -- [-316.303] (-316.261) (-316.305) (-317.613) * (-317.509) (-316.766) [-316.760] (-315.330) -- 0:00:36
398500 -- (-317.148) [-316.508] (-317.780) (-318.087) * (-316.160) (-315.967) (-319.022) [-316.504] -- 0:00:36
399000 -- (-316.604) (-317.956) [-316.275] (-316.895) * (-316.201) (-315.791) (-316.956) [-317.854] -- 0:00:36
399500 -- [-316.800] (-322.786) (-315.839) (-317.684) * [-315.952] (-316.226) (-318.813) (-316.412) -- 0:00:36
400000 -- (-316.919) (-319.720) [-321.052] (-318.077) * [-318.031] (-316.511) (-317.756) (-318.201) -- 0:00:36
Average standard deviation of split frequencies: 0.012280
400500 -- (-317.111) [-316.295] (-316.891) (-324.606) * (-317.737) (-319.469) (-322.564) [-319.498] -- 0:00:35
401000 -- (-317.637) (-317.769) (-316.433) [-316.695] * [-315.731] (-318.794) (-318.486) (-317.215) -- 0:00:35
401500 -- (-315.777) (-315.701) [-315.901] (-315.787) * [-316.540] (-316.214) (-317.178) (-318.420) -- 0:00:35
402000 -- (-317.401) [-317.391] (-318.245) (-318.412) * (-316.241) (-317.096) [-317.478] (-318.313) -- 0:00:35
402500 -- [-317.482] (-318.993) (-321.197) (-318.444) * (-316.800) [-317.062] (-317.379) (-316.270) -- 0:00:35
403000 -- (-318.697) (-320.278) (-319.228) [-316.325] * (-321.195) (-319.576) [-319.518] (-317.108) -- 0:00:35
403500 -- (-319.215) (-318.905) (-318.337) [-316.896] * (-317.678) [-318.447] (-324.458) (-319.657) -- 0:00:35
404000 -- (-316.938) [-316.272] (-317.389) (-316.006) * (-316.647) (-316.548) (-316.369) [-318.044] -- 0:00:35
404500 -- [-316.241] (-315.591) (-317.494) (-317.022) * (-321.043) (-317.455) (-316.919) [-320.312] -- 0:00:35
405000 -- [-316.126] (-316.203) (-316.188) (-318.604) * (-316.195) (-315.862) [-317.689] (-316.464) -- 0:00:35
Average standard deviation of split frequencies: 0.011884
405500 -- (-319.368) [-318.101] (-317.289) (-316.491) * (-318.419) (-317.116) (-316.842) [-315.084] -- 0:00:35
406000 -- [-318.271] (-316.418) (-317.702) (-316.537) * (-316.376) (-315.955) (-316.661) [-315.352] -- 0:00:35
406500 -- (-320.262) [-316.009] (-317.359) (-320.505) * (-319.579) (-318.172) (-315.880) [-316.035] -- 0:00:35
407000 -- (-316.632) (-319.245) (-317.007) [-315.300] * (-320.850) [-315.785] (-317.242) (-317.740) -- 0:00:34
407500 -- [-318.126] (-315.795) (-320.679) (-316.663) * [-316.394] (-316.261) (-316.442) (-318.335) -- 0:00:34
408000 -- [-315.243] (-319.033) (-319.702) (-319.184) * (-316.492) (-318.766) (-316.212) [-316.963] -- 0:00:34
408500 -- [-317.846] (-315.730) (-315.991) (-316.916) * (-318.318) [-317.553] (-319.496) (-317.067) -- 0:00:34
409000 -- (-320.704) (-317.745) [-318.123] (-318.206) * [-315.343] (-319.169) (-315.816) (-319.275) -- 0:00:34
409500 -- (-315.972) [-320.449] (-316.150) (-316.618) * (-317.093) (-318.355) (-318.880) [-316.306] -- 0:00:34
410000 -- (-318.300) (-321.611) (-315.298) [-317.006] * (-318.855) [-322.217] (-316.720) (-318.113) -- 0:00:34
Average standard deviation of split frequencies: 0.011479
410500 -- (-322.024) (-318.057) [-315.558] (-316.753) * (-316.512) (-320.689) [-318.667] (-317.908) -- 0:00:34
411000 -- [-316.245] (-318.135) (-317.561) (-318.297) * (-318.903) (-320.959) (-315.661) [-316.670] -- 0:00:34
411500 -- (-316.913) (-315.499) (-319.090) [-319.518] * [-316.206] (-317.858) (-317.293) (-317.516) -- 0:00:34
412000 -- [-317.775] (-320.012) (-317.877) (-319.226) * [-317.030] (-320.213) (-315.641) (-317.948) -- 0:00:34
412500 -- [-316.933] (-319.590) (-315.676) (-318.063) * (-319.484) (-321.015) (-321.429) [-317.160] -- 0:00:34
413000 -- (-316.210) (-323.277) [-316.406] (-315.509) * (-316.749) (-322.184) (-318.718) [-316.814] -- 0:00:35
413500 -- (-317.815) (-323.517) [-316.838] (-319.086) * [-315.402] (-322.122) (-316.975) (-317.024) -- 0:00:35
414000 -- (-319.735) (-317.946) (-319.294) [-315.837] * (-316.799) (-318.882) (-318.005) [-319.387] -- 0:00:35
414500 -- (-318.709) (-318.082) [-318.224] (-315.559) * (-316.927) [-316.399] (-317.659) (-320.137) -- 0:00:35
415000 -- (-321.436) (-316.942) [-316.742] (-317.482) * (-327.722) (-317.729) (-320.424) [-318.618] -- 0:00:35
Average standard deviation of split frequencies: 0.011757
415500 -- [-317.284] (-318.624) (-320.067) (-319.046) * (-315.745) [-316.047] (-318.594) (-318.136) -- 0:00:35
416000 -- (-318.507) (-319.555) (-319.962) [-316.949] * (-318.284) [-315.598] (-316.784) (-322.105) -- 0:00:35
416500 -- (-317.992) (-316.075) [-316.625] (-318.681) * (-315.990) (-317.277) [-317.298] (-319.890) -- 0:00:35
417000 -- [-316.221] (-316.100) (-316.864) (-315.416) * (-316.558) (-319.523) (-320.323) [-317.507] -- 0:00:34
417500 -- (-316.274) (-315.433) (-317.696) [-318.164] * [-318.388] (-324.327) (-318.401) (-316.676) -- 0:00:34
418000 -- (-317.058) (-315.600) (-319.139) [-318.571] * (-315.199) (-319.936) (-318.145) [-318.511] -- 0:00:34
418500 -- [-317.289] (-315.290) (-320.725) (-323.477) * (-316.785) (-320.708) [-320.942] (-317.675) -- 0:00:34
419000 -- [-322.845] (-316.973) (-316.622) (-316.022) * [-319.545] (-319.409) (-319.117) (-316.101) -- 0:00:34
419500 -- (-321.380) [-315.300] (-323.225) (-320.351) * (-318.181) (-320.229) [-315.246] (-319.050) -- 0:00:34
420000 -- (-316.520) (-320.236) (-317.023) [-316.841] * (-318.310) (-317.879) [-318.334] (-316.693) -- 0:00:34
Average standard deviation of split frequencies: 0.011556
420500 -- (-315.175) (-316.817) (-315.725) [-316.935] * (-317.847) (-318.197) [-319.952] (-319.519) -- 0:00:34
421000 -- [-317.253] (-316.423) (-317.437) (-317.343) * (-319.656) (-317.001) [-316.124] (-319.793) -- 0:00:34
421500 -- (-316.586) (-317.670) (-315.944) [-316.216] * [-315.066] (-319.491) (-315.763) (-315.644) -- 0:00:34
422000 -- (-319.752) [-322.806] (-316.999) (-315.869) * (-316.337) [-317.221] (-318.187) (-319.850) -- 0:00:34
422500 -- (-316.484) (-317.741) [-318.219] (-317.813) * [-316.213] (-316.065) (-318.023) (-315.310) -- 0:00:34
423000 -- (-325.713) (-315.226) (-317.168) [-321.029] * (-317.369) [-315.092] (-317.424) (-315.994) -- 0:00:34
423500 -- (-319.172) (-317.725) (-316.367) [-317.471] * (-317.983) (-316.292) (-318.278) [-315.157] -- 0:00:34
424000 -- (-315.821) (-316.354) [-316.650] (-316.490) * (-319.196) [-319.762] (-319.792) (-316.440) -- 0:00:33
424500 -- [-317.287] (-317.387) (-316.179) (-319.568) * (-316.874) (-315.625) [-316.538] (-321.546) -- 0:00:33
425000 -- (-315.748) [-317.957] (-319.521) (-317.907) * [-318.830] (-316.872) (-317.831) (-317.050) -- 0:00:33
Average standard deviation of split frequencies: 0.012103
425500 -- (-317.839) (-320.985) (-321.354) [-318.109] * (-318.432) [-317.050] (-319.295) (-316.780) -- 0:00:33
426000 -- (-318.098) [-316.675] (-318.534) (-321.304) * (-315.558) (-316.683) [-315.789] (-316.430) -- 0:00:33
426500 -- (-316.236) [-316.191] (-316.279) (-317.419) * (-316.830) (-317.850) (-316.840) [-317.632] -- 0:00:33
427000 -- (-315.884) [-316.150] (-318.159) (-316.418) * [-318.990] (-323.860) (-319.590) (-318.842) -- 0:00:33
427500 -- (-318.255) (-317.447) [-317.958] (-316.235) * (-316.400) (-316.620) [-319.883] (-318.869) -- 0:00:33
428000 -- (-316.634) [-316.233] (-321.034) (-318.608) * (-316.308) [-316.602] (-317.569) (-316.992) -- 0:00:33
428500 -- [-316.654] (-317.076) (-315.571) (-317.660) * (-326.637) (-317.686) [-315.429] (-318.944) -- 0:00:33
429000 -- [-316.496] (-316.440) (-321.820) (-317.621) * [-322.045] (-321.390) (-318.618) (-318.218) -- 0:00:33
429500 -- (-318.228) [-319.283] (-318.851) (-316.197) * [-315.870] (-318.281) (-316.305) (-317.592) -- 0:00:33
430000 -- (-317.656) (-318.206) (-317.611) [-316.556] * (-315.662) [-316.463] (-318.315) (-317.851) -- 0:00:33
Average standard deviation of split frequencies: 0.013340
430500 -- (-317.396) (-316.703) (-318.898) [-315.377] * [-317.444] (-318.154) (-315.609) (-317.137) -- 0:00:34
431000 -- (-315.732) (-316.967) [-316.740] (-317.667) * (-317.433) (-319.557) (-316.251) [-321.560] -- 0:00:34
431500 -- (-317.056) (-315.939) [-318.069] (-318.367) * (-317.643) [-318.455] (-317.029) (-316.293) -- 0:00:34
432000 -- [-317.062] (-317.575) (-318.315) (-317.227) * (-325.664) [-317.043] (-316.271) (-316.482) -- 0:00:34
432500 -- [-316.435] (-316.268) (-318.364) (-322.665) * (-318.006) [-317.708] (-315.582) (-316.638) -- 0:00:34
433000 -- (-315.808) [-316.831] (-316.902) (-318.018) * [-316.812] (-317.595) (-316.579) (-316.469) -- 0:00:34
433500 -- [-315.592] (-316.242) (-315.345) (-316.221) * [-315.711] (-315.170) (-321.820) (-320.576) -- 0:00:33
434000 -- (-317.198) (-315.984) (-319.405) [-316.772] * (-316.173) [-316.414] (-315.152) (-317.253) -- 0:00:33
434500 -- (-317.264) (-315.278) (-319.028) [-318.001] * (-314.891) (-318.841) [-316.789] (-320.087) -- 0:00:33
435000 -- (-318.553) (-318.095) (-319.580) [-316.757] * (-316.194) (-316.055) (-318.205) [-316.134] -- 0:00:33
Average standard deviation of split frequencies: 0.012164
435500 -- (-317.549) [-316.104] (-315.574) (-320.462) * [-318.132] (-318.742) (-317.104) (-318.573) -- 0:00:33
436000 -- (-315.595) (-316.702) [-317.907] (-319.488) * (-315.664) (-320.617) (-321.261) [-319.319] -- 0:00:33
436500 -- (-314.934) (-321.131) [-320.602] (-318.668) * (-317.441) (-315.701) (-320.772) [-319.136] -- 0:00:33
437000 -- (-317.625) [-319.448] (-317.952) (-317.512) * (-320.106) (-318.261) [-317.692] (-317.667) -- 0:00:33
437500 -- [-316.754] (-317.145) (-317.303) (-315.774) * (-319.637) (-316.173) (-321.083) [-319.171] -- 0:00:33
438000 -- (-318.045) (-316.489) (-319.620) [-318.922] * (-318.523) [-319.967] (-319.324) (-318.077) -- 0:00:33
438500 -- (-316.741) (-319.205) [-318.150] (-316.097) * [-317.988] (-315.468) (-318.172) (-316.249) -- 0:00:33
439000 -- (-317.102) (-317.914) [-317.562] (-316.943) * (-315.440) [-320.753] (-317.689) (-315.969) -- 0:00:33
439500 -- (-317.759) [-318.220] (-318.127) (-316.396) * (-317.477) (-317.266) (-315.644) [-319.156] -- 0:00:33
440000 -- [-315.937] (-319.047) (-317.583) (-316.570) * (-317.074) (-317.792) [-319.927] (-317.159) -- 0:00:33
Average standard deviation of split frequencies: 0.011634
440500 -- (-319.168) (-315.736) (-317.190) [-318.112] * [-315.578] (-324.133) (-319.679) (-316.694) -- 0:00:33
441000 -- (-319.166) [-316.853] (-317.024) (-317.265) * (-315.586) [-317.155] (-319.879) (-317.595) -- 0:00:32
441500 -- [-315.968] (-318.521) (-317.086) (-316.170) * (-315.535) [-318.442] (-316.784) (-317.403) -- 0:00:32
442000 -- [-318.087] (-320.312) (-316.744) (-318.330) * (-321.107) [-317.054] (-315.317) (-317.604) -- 0:00:32
442500 -- (-317.830) (-319.747) [-318.218] (-317.196) * (-317.866) (-316.421) [-316.519] (-317.306) -- 0:00:32
443000 -- (-316.386) (-318.435) (-320.033) [-317.045] * [-316.733] (-319.084) (-318.412) (-317.019) -- 0:00:32
443500 -- [-315.266] (-317.871) (-319.054) (-318.066) * (-319.484) [-319.054] (-317.673) (-318.324) -- 0:00:32
444000 -- (-316.732) (-315.206) (-317.699) [-317.444] * (-320.031) (-316.976) [-315.482] (-318.198) -- 0:00:32
444500 -- (-316.676) (-315.709) [-318.268] (-316.611) * [-321.674] (-316.113) (-316.889) (-318.658) -- 0:00:32
445000 -- (-319.857) [-318.550] (-318.589) (-315.730) * [-323.066] (-318.031) (-322.334) (-316.487) -- 0:00:32
Average standard deviation of split frequencies: 0.011296
445500 -- (-319.016) (-322.575) (-319.428) [-316.090] * (-317.543) (-317.180) (-317.654) [-317.128] -- 0:00:32
446000 -- (-315.300) (-319.075) (-317.407) [-316.052] * (-315.812) (-319.741) (-316.784) [-315.803] -- 0:00:32
446500 -- [-319.491] (-316.701) (-317.950) (-320.204) * (-315.183) (-318.503) (-319.959) [-319.692] -- 0:00:32
447000 -- (-316.820) (-315.406) (-319.085) [-315.222] * (-320.198) (-316.976) (-321.639) [-316.965] -- 0:00:32
447500 -- (-319.763) (-317.607) (-319.069) [-317.640] * (-316.254) (-320.507) (-316.483) [-318.971] -- 0:00:33
448000 -- (-318.969) (-318.277) (-317.881) [-318.466] * (-317.761) [-316.200] (-320.241) (-316.966) -- 0:00:33
448500 -- (-317.563) [-318.308] (-319.148) (-315.881) * (-316.467) [-317.347] (-318.762) (-316.335) -- 0:00:33
449000 -- (-318.278) (-317.387) [-316.209] (-319.007) * (-317.950) (-316.406) (-325.771) [-318.358] -- 0:00:33
449500 -- (-317.318) (-319.943) [-316.771] (-319.241) * (-316.998) [-315.981] (-316.707) (-316.577) -- 0:00:33
450000 -- (-315.852) (-317.104) (-316.447) [-318.171] * [-318.837] (-319.135) (-320.721) (-317.093) -- 0:00:33
Average standard deviation of split frequencies: 0.010199
450500 -- (-318.218) (-315.781) (-316.564) [-317.015] * (-318.199) (-315.304) (-321.774) [-316.854] -- 0:00:32
451000 -- (-315.725) (-317.071) (-316.180) [-316.800] * (-318.688) [-315.898] (-317.130) (-319.864) -- 0:00:32
451500 -- [-315.495] (-316.081) (-317.610) (-319.002) * (-325.835) (-315.473) (-315.822) [-317.311] -- 0:00:32
452000 -- (-317.617) (-315.559) [-315.897] (-316.470) * (-315.598) [-320.062] (-321.620) (-316.346) -- 0:00:32
452500 -- [-318.213] (-318.379) (-319.392) (-318.334) * (-318.092) [-316.957] (-321.474) (-318.487) -- 0:00:32
453000 -- [-318.153] (-315.067) (-319.158) (-316.569) * (-320.047) (-317.378) [-317.232] (-316.895) -- 0:00:32
453500 -- (-316.450) [-316.769] (-319.099) (-320.664) * (-317.320) [-319.383] (-316.499) (-320.498) -- 0:00:32
454000 -- (-318.554) (-315.972) [-315.461] (-320.317) * (-315.851) [-319.498] (-319.579) (-316.951) -- 0:00:32
454500 -- (-318.345) [-317.441] (-323.634) (-316.422) * (-320.677) (-318.778) [-319.258] (-318.017) -- 0:00:32
455000 -- (-319.868) (-318.059) (-319.528) [-322.697] * [-317.963] (-316.660) (-322.780) (-316.217) -- 0:00:32
Average standard deviation of split frequencies: 0.010661
455500 -- (-318.597) [-316.971] (-318.821) (-325.585) * (-318.990) [-315.943] (-317.512) (-314.931) -- 0:00:32
456000 -- [-317.858] (-318.304) (-316.049) (-316.322) * [-316.074] (-316.936) (-319.733) (-318.133) -- 0:00:32
456500 -- (-316.212) (-318.562) (-316.461) [-316.175] * [-316.616] (-317.460) (-318.197) (-320.146) -- 0:00:32
457000 -- (-316.289) [-319.366] (-317.228) (-315.983) * (-318.335) (-320.142) [-316.996] (-319.070) -- 0:00:32
457500 -- (-318.577) (-321.379) [-316.992] (-319.086) * (-318.495) (-318.008) [-321.211] (-323.227) -- 0:00:32
458000 -- (-319.552) (-318.025) (-319.559) [-319.829] * (-316.557) (-317.244) (-315.873) [-316.447] -- 0:00:31
458500 -- (-316.962) (-320.338) [-316.315] (-318.456) * [-316.487] (-316.741) (-316.955) (-315.775) -- 0:00:31
459000 -- (-318.852) (-319.687) [-316.292] (-318.791) * (-318.507) (-315.398) [-318.415] (-319.472) -- 0:00:31
459500 -- (-315.208) (-317.205) (-320.585) [-317.208] * [-317.433] (-321.101) (-316.117) (-317.295) -- 0:00:31
460000 -- (-316.983) (-317.013) [-317.493] (-318.974) * (-315.956) (-316.749) (-317.350) [-316.356] -- 0:00:31
Average standard deviation of split frequencies: 0.011200
460500 -- (-316.413) (-318.455) [-316.317] (-317.471) * (-315.258) (-319.804) [-319.352] (-316.456) -- 0:00:31
461000 -- [-317.591] (-319.319) (-318.611) (-316.078) * [-316.086] (-321.828) (-319.287) (-316.752) -- 0:00:31
461500 -- [-315.751] (-317.911) (-318.381) (-315.879) * (-317.791) (-318.580) (-320.435) [-316.966] -- 0:00:31
462000 -- [-316.413] (-315.363) (-318.205) (-316.577) * (-319.819) (-319.836) (-317.715) [-317.681] -- 0:00:31
462500 -- [-315.640] (-317.268) (-316.730) (-320.030) * (-316.135) (-317.842) (-317.273) [-318.176] -- 0:00:31
463000 -- (-317.170) (-316.912) [-315.776] (-316.441) * (-317.438) (-318.335) (-319.847) [-318.651] -- 0:00:31
463500 -- [-321.765] (-317.439) (-318.804) (-315.714) * [-320.255] (-315.852) (-316.810) (-316.559) -- 0:00:31
464000 -- [-318.567] (-317.143) (-318.786) (-316.085) * (-317.359) (-318.729) (-323.509) [-316.415] -- 0:00:31
464500 -- (-318.373) (-317.033) [-319.063] (-315.654) * (-316.833) [-319.368] (-320.147) (-316.473) -- 0:00:32
465000 -- (-316.214) (-316.298) [-315.376] (-315.577) * (-315.926) (-315.262) (-320.298) [-315.560] -- 0:00:32
Average standard deviation of split frequencies: 0.010056
465500 -- (-316.125) (-317.368) [-315.590] (-315.672) * [-315.029] (-317.693) (-318.194) (-316.932) -- 0:00:32
466000 -- (-316.739) [-315.871] (-317.202) (-316.403) * [-315.091] (-319.585) (-318.035) (-318.212) -- 0:00:32
466500 -- (-320.551) (-318.299) [-316.985] (-316.134) * [-315.505] (-316.048) (-320.585) (-317.422) -- 0:00:32
467000 -- (-315.698) (-318.398) [-316.264] (-320.324) * (-317.091) (-316.069) [-316.380] (-318.564) -- 0:00:31
467500 -- (-316.526) (-320.096) [-316.900] (-322.176) * (-322.836) (-317.331) [-316.647] (-318.663) -- 0:00:31
468000 -- (-317.745) (-321.423) [-317.510] (-316.127) * (-316.596) (-315.758) (-320.011) [-317.402] -- 0:00:31
468500 -- (-321.700) [-316.130] (-316.813) (-315.922) * [-316.177] (-316.380) (-319.936) (-317.956) -- 0:00:31
469000 -- (-315.946) (-316.022) [-317.784] (-317.097) * (-318.746) (-318.002) [-316.604] (-320.554) -- 0:00:31
469500 -- [-316.332] (-318.353) (-318.382) (-315.778) * [-316.663] (-318.591) (-319.300) (-315.948) -- 0:00:31
470000 -- (-316.284) (-316.158) (-318.472) [-315.913] * (-315.772) [-316.971] (-316.954) (-317.544) -- 0:00:31
Average standard deviation of split frequencies: 0.011462
470500 -- (-316.024) [-316.057] (-316.651) (-317.847) * (-318.140) (-317.231) [-317.048] (-319.525) -- 0:00:31
471000 -- [-317.311] (-315.575) (-320.253) (-316.163) * (-316.197) [-315.952] (-319.450) (-316.472) -- 0:00:31
471500 -- [-317.799] (-316.614) (-317.544) (-316.299) * (-315.905) (-316.214) (-315.887) [-316.963] -- 0:00:31
472000 -- (-319.061) (-315.603) [-318.631] (-317.430) * [-315.628] (-315.942) (-315.644) (-317.072) -- 0:00:31
472500 -- (-318.918) (-319.254) (-317.274) [-319.095] * (-321.600) [-315.851] (-315.436) (-319.086) -- 0:00:31
473000 -- [-318.118] (-322.077) (-315.249) (-318.707) * (-321.821) (-317.915) (-318.168) [-316.637] -- 0:00:31
473500 -- (-319.027) [-322.469] (-315.065) (-319.708) * (-319.795) (-317.147) (-318.207) [-317.270] -- 0:00:31
474000 -- (-318.990) (-324.025) [-317.983] (-315.592) * (-318.724) [-316.729] (-319.026) (-315.657) -- 0:00:31
474500 -- (-321.108) [-316.564] (-320.894) (-315.861) * [-320.017] (-326.091) (-318.162) (-316.717) -- 0:00:31
475000 -- (-318.029) (-320.345) [-316.031] (-315.312) * [-315.848] (-317.976) (-317.877) (-315.386) -- 0:00:30
Average standard deviation of split frequencies: 0.010674
475500 -- [-316.260] (-318.412) (-316.355) (-315.776) * (-316.065) (-317.801) [-318.153] (-315.827) -- 0:00:30
476000 -- (-317.520) (-316.593) (-317.019) [-315.483] * (-318.190) (-315.689) (-318.820) [-316.974] -- 0:00:30
476500 -- (-318.614) (-315.741) (-317.608) [-317.181] * (-321.379) (-321.229) (-316.724) [-317.213] -- 0:00:30
477000 -- (-319.768) (-316.511) (-317.798) [-316.178] * [-319.462] (-320.131) (-317.300) (-316.744) -- 0:00:30
477500 -- [-318.704] (-317.103) (-316.583) (-317.062) * (-321.517) [-318.717] (-318.765) (-316.381) -- 0:00:30
478000 -- (-318.121) [-317.200] (-316.696) (-319.158) * (-318.346) [-320.436] (-322.403) (-316.083) -- 0:00:30
478500 -- (-319.774) (-324.420) [-316.871] (-316.633) * (-317.749) (-320.970) (-322.480) [-315.357] -- 0:00:30
479000 -- (-320.686) (-319.277) [-315.704] (-318.713) * (-318.222) [-317.262] (-319.457) (-317.331) -- 0:00:30
479500 -- [-316.945] (-317.531) (-318.645) (-316.341) * (-321.524) [-317.230] (-318.826) (-316.464) -- 0:00:30
480000 -- (-318.904) [-317.488] (-318.003) (-315.903) * (-317.779) [-316.636] (-317.973) (-322.150) -- 0:00:30
Average standard deviation of split frequencies: 0.010407
480500 -- [-315.449] (-316.500) (-318.095) (-318.328) * (-316.084) (-318.453) [-317.254] (-318.551) -- 0:00:30
481000 -- (-317.798) (-319.519) [-317.311] (-320.845) * (-316.896) (-318.093) (-321.430) [-316.794] -- 0:00:30
481500 -- (-317.787) [-315.977] (-316.472) (-324.938) * (-316.861) [-318.818] (-317.922) (-316.793) -- 0:00:31
482000 -- (-316.615) (-317.934) (-317.264) [-316.910] * (-317.054) (-317.336) [-315.845] (-315.343) -- 0:00:31
482500 -- (-321.444) (-316.102) (-317.901) [-317.520] * (-317.720) (-319.223) (-317.086) [-317.356] -- 0:00:31
483000 -- (-318.653) (-315.955) [-316.146] (-318.146) * [-321.168] (-316.434) (-318.493) (-319.529) -- 0:00:31
483500 -- (-318.119) (-316.770) (-319.966) [-317.078] * (-319.877) (-317.182) [-316.473] (-317.054) -- 0:00:30
484000 -- [-318.187] (-316.556) (-316.797) (-315.407) * (-315.944) [-315.582] (-322.302) (-317.547) -- 0:00:30
484500 -- [-319.151] (-317.014) (-315.823) (-318.724) * (-317.380) (-315.160) [-317.400] (-316.455) -- 0:00:30
485000 -- (-318.057) (-319.445) (-317.899) [-315.491] * (-319.452) [-318.197] (-318.468) (-315.244) -- 0:00:30
Average standard deviation of split frequencies: 0.010508
485500 -- [-316.651] (-316.847) (-321.026) (-315.419) * [-316.312] (-316.408) (-318.635) (-318.783) -- 0:00:30
486000 -- [-316.451] (-319.902) (-317.598) (-315.824) * [-315.399] (-317.196) (-320.584) (-317.739) -- 0:00:30
486500 -- (-318.261) [-318.091] (-317.491) (-317.312) * (-316.792) (-317.000) (-318.686) [-317.545] -- 0:00:30
487000 -- (-319.446) (-316.048) (-321.892) [-315.927] * (-317.203) (-317.671) (-321.468) [-317.327] -- 0:00:30
487500 -- (-317.482) [-317.424] (-317.962) (-319.327) * (-319.169) (-317.836) [-318.219] (-316.519) -- 0:00:30
488000 -- (-315.423) (-317.178) [-317.187] (-315.867) * (-317.501) (-316.363) [-316.634] (-316.832) -- 0:00:30
488500 -- (-317.138) (-318.214) (-319.667) [-318.691] * (-317.469) (-316.005) [-316.305] (-318.736) -- 0:00:30
489000 -- (-315.285) [-316.561] (-315.981) (-318.689) * (-315.839) (-325.108) (-319.370) [-316.290] -- 0:00:30
489500 -- (-317.232) (-316.192) [-315.983] (-317.224) * (-317.609) (-318.755) (-319.414) [-316.747] -- 0:00:30
490000 -- (-317.761) (-318.200) (-317.798) [-315.339] * (-315.914) (-317.146) [-318.072] (-317.269) -- 0:00:30
Average standard deviation of split frequencies: 0.011049
490500 -- (-316.530) (-318.093) (-315.279) [-317.819] * (-316.951) (-317.706) [-316.713] (-324.946) -- 0:00:30
491000 -- (-315.739) (-316.014) (-318.027) [-320.417] * (-315.721) [-316.574] (-316.373) (-318.226) -- 0:00:30
491500 -- (-315.764) (-317.197) [-318.073] (-319.808) * (-317.299) (-320.827) [-315.932] (-318.244) -- 0:00:30
492000 -- [-316.322] (-326.845) (-317.494) (-319.666) * (-316.527) (-319.476) (-315.611) [-316.798] -- 0:00:29
492500 -- (-316.938) (-315.971) (-316.820) [-315.965] * [-318.384] (-319.620) (-318.229) (-315.518) -- 0:00:29
493000 -- (-317.311) (-316.052) [-318.739] (-322.476) * (-316.017) (-318.694) [-316.461] (-316.774) -- 0:00:29
493500 -- (-315.894) (-315.973) (-316.583) [-315.547] * [-318.375] (-320.798) (-316.128) (-318.219) -- 0:00:29
494000 -- [-317.535] (-318.517) (-316.628) (-321.294) * (-318.337) [-315.516] (-317.828) (-318.027) -- 0:00:29
494500 -- (-317.074) [-319.949] (-318.909) (-318.360) * [-317.036] (-316.146) (-316.707) (-316.495) -- 0:00:29
495000 -- [-315.305] (-315.561) (-319.060) (-315.397) * (-315.455) (-319.819) [-315.936] (-315.995) -- 0:00:29
Average standard deviation of split frequencies: 0.011035
495500 -- (-315.790) (-322.592) (-318.688) [-316.193] * (-316.510) (-316.775) (-315.756) [-316.015] -- 0:00:29
496000 -- (-315.802) (-318.892) (-320.626) [-315.180] * (-317.791) (-320.763) (-318.036) [-318.096] -- 0:00:29
496500 -- (-320.229) (-317.346) (-319.575) [-316.290] * (-319.750) (-318.428) (-316.040) [-318.024] -- 0:00:29
497000 -- (-315.970) [-318.927] (-315.930) (-316.853) * (-315.749) (-320.491) (-317.328) [-321.157] -- 0:00:29
497500 -- [-317.381] (-318.073) (-315.362) (-316.947) * (-315.398) (-319.123) [-316.167] (-318.261) -- 0:00:29
498000 -- (-318.317) [-317.946] (-316.414) (-316.864) * (-317.449) (-318.011) [-316.944] (-316.083) -- 0:00:29
498500 -- (-319.145) (-317.271) (-317.766) [-320.210] * (-319.911) (-321.110) [-318.870] (-317.100) -- 0:00:29
499000 -- [-316.131] (-316.575) (-317.799) (-316.370) * [-318.459] (-320.037) (-315.999) (-318.442) -- 0:00:30
499500 -- (-316.352) (-319.422) (-317.425) [-317.279] * (-317.282) (-317.085) (-317.859) [-315.841] -- 0:00:30
500000 -- (-316.085) (-319.671) [-317.860] (-316.020) * (-316.404) (-318.792) [-316.148] (-316.327) -- 0:00:30
Average standard deviation of split frequencies: 0.010191
500500 -- [-316.566] (-319.597) (-318.268) (-315.237) * [-317.232] (-316.717) (-322.079) (-319.194) -- 0:00:29
501000 -- (-315.285) (-317.988) [-318.297] (-318.109) * (-317.131) (-315.567) (-316.252) [-315.720] -- 0:00:29
501500 -- (-319.450) (-317.178) (-320.363) [-315.643] * (-317.796) (-316.334) [-315.361] (-317.058) -- 0:00:29
502000 -- (-315.674) (-318.867) [-316.659] (-318.427) * (-317.082) (-317.511) (-315.430) [-318.338] -- 0:00:29
502500 -- (-318.237) (-315.486) [-315.925] (-317.985) * (-319.801) (-317.045) (-318.712) [-316.292] -- 0:00:29
503000 -- (-315.759) (-317.378) (-315.610) [-319.962] * (-315.653) [-316.670] (-317.757) (-317.838) -- 0:00:29
503500 -- (-316.472) (-316.328) [-323.610] (-316.420) * (-319.081) [-315.627] (-315.887) (-316.437) -- 0:00:29
504000 -- (-316.802) (-321.304) (-324.741) [-316.781] * [-316.706] (-316.656) (-318.605) (-317.274) -- 0:00:29
504500 -- (-316.334) (-316.051) (-317.799) [-319.324] * (-316.625) (-316.234) (-317.264) [-317.054] -- 0:00:29
505000 -- (-316.282) (-315.457) (-316.935) [-317.097] * (-316.528) (-317.363) [-317.313] (-317.662) -- 0:00:29
Average standard deviation of split frequencies: 0.010869
505500 -- (-320.893) (-318.226) (-317.954) [-316.719] * (-317.183) (-319.446) [-315.461] (-316.882) -- 0:00:29
506000 -- (-316.115) [-315.814] (-319.868) (-316.355) * (-317.064) (-317.904) [-315.730] (-318.823) -- 0:00:29
506500 -- (-316.191) (-317.591) (-318.353) [-316.467] * [-315.972] (-319.963) (-317.549) (-320.581) -- 0:00:29
507000 -- (-316.564) [-318.435] (-315.670) (-321.570) * (-315.558) [-322.629] (-321.382) (-316.462) -- 0:00:29
507500 -- (-323.268) (-315.203) [-316.361] (-319.064) * (-316.789) (-322.244) [-316.496] (-317.310) -- 0:00:29
508000 -- (-320.328) [-317.724] (-318.861) (-317.163) * (-316.368) (-320.402) (-318.265) [-319.263] -- 0:00:29
508500 -- [-315.805] (-316.890) (-315.208) (-316.431) * [-315.641] (-318.902) (-318.713) (-317.865) -- 0:00:28
509000 -- [-315.517] (-316.746) (-316.807) (-316.288) * (-315.961) [-315.598] (-318.366) (-316.771) -- 0:00:28
509500 -- (-316.448) (-316.432) [-315.930] (-316.985) * (-316.393) (-315.183) (-316.935) [-316.851] -- 0:00:28
510000 -- [-317.955] (-319.345) (-318.726) (-316.208) * (-315.449) [-316.482] (-316.714) (-314.972) -- 0:00:28
Average standard deviation of split frequencies: 0.009394
510500 -- [-319.014] (-317.866) (-315.812) (-317.196) * (-317.748) [-315.219] (-316.531) (-316.848) -- 0:00:28
511000 -- (-315.959) [-317.359] (-318.838) (-319.474) * (-317.711) (-318.026) (-315.683) [-315.303] -- 0:00:28
511500 -- (-315.599) [-320.193] (-316.908) (-315.572) * (-316.935) (-316.191) (-316.387) [-318.316] -- 0:00:28
512000 -- [-315.856] (-319.944) (-317.260) (-315.177) * (-319.561) [-318.243] (-316.383) (-315.664) -- 0:00:28
512500 -- (-315.833) [-316.464] (-316.372) (-315.901) * [-316.404] (-317.486) (-319.450) (-316.863) -- 0:00:28
513000 -- (-316.762) (-316.471) [-316.060] (-316.269) * (-317.301) [-315.244] (-315.615) (-317.197) -- 0:00:28
513500 -- [-316.455] (-316.895) (-317.535) (-318.646) * (-317.570) (-317.651) (-317.296) [-317.881] -- 0:00:28
514000 -- (-317.854) (-319.347) [-316.537] (-320.866) * (-316.705) (-316.451) [-316.258] (-318.709) -- 0:00:28
514500 -- (-318.745) [-316.365] (-316.179) (-322.858) * [-316.326] (-316.019) (-317.081) (-322.617) -- 0:00:28
515000 -- (-319.187) [-315.735] (-317.610) (-316.877) * (-316.126) (-316.544) (-320.400) [-320.792] -- 0:00:28
Average standard deviation of split frequencies: 0.009650
515500 -- (-317.355) (-318.440) [-316.478] (-317.631) * (-315.633) (-316.753) [-317.388] (-325.631) -- 0:00:29
516000 -- (-319.060) (-318.576) (-320.089) [-315.435] * (-316.434) [-317.666] (-315.347) (-319.457) -- 0:00:29
516500 -- (-318.441) (-320.698) [-317.099] (-315.586) * [-315.219] (-317.116) (-315.577) (-318.729) -- 0:00:29
517000 -- [-315.730] (-318.158) (-316.964) (-317.137) * (-315.657) [-315.896] (-317.781) (-315.765) -- 0:00:28
517500 -- (-321.042) (-316.376) (-316.906) [-316.036] * [-316.548] (-317.002) (-318.585) (-316.092) -- 0:00:28
518000 -- [-316.889] (-317.778) (-316.088) (-317.437) * (-319.030) (-317.207) [-315.359] (-316.329) -- 0:00:28
518500 -- (-317.971) (-316.379) [-316.972] (-315.267) * (-316.969) [-318.715] (-319.744) (-316.670) -- 0:00:28
519000 -- (-318.794) [-317.198] (-324.797) (-316.515) * (-316.208) [-317.173] (-317.153) (-316.995) -- 0:00:28
519500 -- (-316.654) [-317.916] (-316.923) (-321.531) * (-318.552) [-320.250] (-317.056) (-316.510) -- 0:00:28
520000 -- (-316.021) (-316.683) [-319.093] (-316.805) * (-318.695) (-318.944) [-317.346] (-317.573) -- 0:00:28
Average standard deviation of split frequencies: 0.010119
520500 -- [-320.627] (-316.723) (-318.656) (-315.977) * (-317.939) (-320.217) [-318.951] (-318.124) -- 0:00:28
521000 -- (-318.614) (-321.224) [-317.248] (-317.325) * (-316.823) (-317.783) [-318.733] (-317.407) -- 0:00:28
521500 -- (-316.105) (-323.730) (-315.566) [-320.121] * (-317.784) [-317.765] (-316.807) (-316.597) -- 0:00:28
522000 -- (-318.553) [-319.446] (-318.288) (-319.370) * (-317.225) [-315.817] (-315.732) (-315.441) -- 0:00:28
522500 -- (-324.297) (-318.058) (-317.422) [-315.969] * [-316.586] (-316.246) (-316.099) (-318.792) -- 0:00:28
523000 -- [-317.659] (-320.961) (-316.414) (-320.565) * [-315.928] (-316.505) (-316.806) (-317.899) -- 0:00:28
523500 -- (-316.764) (-316.405) (-317.642) [-315.357] * [-316.820] (-316.953) (-315.070) (-317.143) -- 0:00:28
524000 -- (-318.289) [-315.597] (-315.209) (-317.450) * (-320.808) (-317.255) [-316.213] (-316.195) -- 0:00:28
524500 -- (-317.732) (-316.955) [-315.939] (-318.615) * [-320.940] (-316.910) (-317.937) (-317.329) -- 0:00:28
525000 -- [-317.827] (-319.839) (-319.220) (-316.255) * [-315.993] (-316.714) (-316.470) (-317.835) -- 0:00:28
Average standard deviation of split frequencies: 0.010438
525500 -- [-316.750] (-319.089) (-316.050) (-316.871) * (-317.487) (-318.841) [-316.941] (-317.750) -- 0:00:27
526000 -- (-319.239) (-318.530) [-317.500] (-317.866) * [-316.246] (-317.628) (-316.550) (-316.044) -- 0:00:27
526500 -- (-319.447) (-319.131) [-316.151] (-316.531) * [-316.220] (-316.447) (-316.475) (-316.809) -- 0:00:27
527000 -- [-320.178] (-319.884) (-316.346) (-316.568) * (-316.469) (-315.683) [-315.390] (-315.197) -- 0:00:27
527500 -- (-324.205) [-317.435] (-315.704) (-315.967) * (-315.030) (-315.766) [-316.006] (-315.812) -- 0:00:27
528000 -- (-315.095) (-315.940) [-316.749] (-315.679) * (-316.305) [-319.216] (-315.597) (-316.692) -- 0:00:27
528500 -- (-315.368) (-317.059) (-316.989) [-318.666] * [-317.467] (-317.794) (-316.136) (-316.636) -- 0:00:27
529000 -- (-325.473) [-323.255] (-316.463) (-316.937) * (-315.145) (-318.727) (-318.916) [-317.234] -- 0:00:27
529500 -- (-319.062) (-315.536) (-317.409) [-316.284] * [-317.373] (-318.241) (-320.960) (-318.533) -- 0:00:27
530000 -- (-318.107) [-317.684] (-316.692) (-316.312) * (-320.456) (-317.453) (-319.710) [-317.341] -- 0:00:27
Average standard deviation of split frequencies: 0.010451
530500 -- (-318.610) [-320.623] (-316.641) (-316.696) * (-317.297) (-315.217) (-317.250) [-321.687] -- 0:00:27
531000 -- [-317.918] (-322.811) (-315.480) (-316.351) * [-320.001] (-316.411) (-316.510) (-315.856) -- 0:00:27
531500 -- (-318.590) [-318.835] (-317.500) (-319.355) * (-318.115) (-318.121) [-316.524] (-317.916) -- 0:00:27
532000 -- [-317.169] (-318.322) (-318.968) (-317.561) * [-317.236] (-316.317) (-317.601) (-315.832) -- 0:00:27
532500 -- (-320.403) [-315.718] (-322.085) (-316.652) * [-316.108] (-317.035) (-317.275) (-316.029) -- 0:00:28
533000 -- (-319.363) (-316.606) [-322.134] (-317.247) * (-320.084) (-317.499) (-316.370) [-318.528] -- 0:00:28
533500 -- (-320.598) (-317.700) (-323.952) [-317.876] * [-316.609] (-316.154) (-318.718) (-316.228) -- 0:00:27
534000 -- (-317.299) (-316.178) (-321.100) [-317.749] * (-316.763) (-315.914) [-317.506] (-317.238) -- 0:00:27
534500 -- (-316.014) [-315.095] (-317.775) (-316.462) * (-315.881) [-316.046] (-316.768) (-319.495) -- 0:00:27
535000 -- (-317.078) (-316.971) (-321.173) [-317.181] * (-315.900) (-321.749) (-316.016) [-319.044] -- 0:00:27
Average standard deviation of split frequencies: 0.011433
535500 -- [-315.605] (-317.891) (-322.194) (-316.354) * (-316.598) (-321.634) (-317.243) [-319.862] -- 0:00:27
536000 -- (-319.417) [-316.082] (-319.255) (-317.610) * [-319.661] (-319.013) (-316.328) (-318.924) -- 0:00:27
536500 -- (-316.484) (-317.267) [-317.752] (-316.737) * (-317.072) [-315.850] (-316.590) (-319.401) -- 0:00:27
537000 -- (-315.336) [-316.573] (-322.054) (-323.342) * [-318.594] (-315.929) (-319.568) (-318.397) -- 0:00:27
537500 -- [-315.734] (-320.921) (-319.292) (-319.528) * (-318.478) (-317.698) [-316.556] (-319.382) -- 0:00:27
538000 -- (-320.023) (-316.871) (-320.382) [-317.836] * (-317.299) (-320.344) [-316.200] (-318.236) -- 0:00:27
538500 -- (-315.955) [-317.602] (-317.452) (-315.549) * (-316.692) (-317.630) (-316.291) [-315.321] -- 0:00:27
539000 -- (-317.097) (-316.257) [-316.817] (-316.565) * [-319.961] (-316.066) (-315.328) (-315.279) -- 0:00:27
539500 -- (-318.412) (-321.792) (-316.605) [-316.028] * (-315.355) [-315.482] (-319.447) (-317.386) -- 0:00:27
540000 -- (-317.164) (-315.954) [-322.700] (-320.278) * (-316.541) (-322.401) (-318.416) [-320.235] -- 0:00:27
Average standard deviation of split frequencies: 0.011444
540500 -- (-318.520) [-316.738] (-316.794) (-316.495) * (-317.861) [-316.260] (-316.816) (-316.520) -- 0:00:27
541000 -- (-318.883) [-317.142] (-316.061) (-316.736) * (-320.243) (-318.510) (-316.027) [-318.122] -- 0:00:27
541500 -- (-315.367) (-319.391) (-316.314) [-317.652] * (-318.584) (-316.001) (-316.030) [-319.030] -- 0:00:27
542000 -- (-316.215) (-320.156) (-316.807) [-317.458] * (-316.135) (-316.390) [-319.077] (-316.090) -- 0:00:27
542500 -- [-317.572] (-316.552) (-316.936) (-318.052) * (-316.945) [-315.915] (-319.473) (-316.354) -- 0:00:26
543000 -- [-316.995] (-318.475) (-319.342) (-317.906) * (-317.393) [-316.264] (-316.090) (-317.728) -- 0:00:26
543500 -- (-315.443) [-316.375] (-317.251) (-315.740) * (-318.784) (-315.280) [-317.482] (-316.498) -- 0:00:26
544000 -- (-316.364) (-321.368) [-316.937] (-317.273) * [-316.404] (-315.151) (-319.823) (-315.990) -- 0:00:26
544500 -- [-318.140] (-316.383) (-316.171) (-316.201) * (-319.214) [-316.747] (-315.018) (-316.583) -- 0:00:26
545000 -- [-319.083] (-316.088) (-315.239) (-315.772) * (-317.312) (-317.075) [-316.247] (-317.006) -- 0:00:26
Average standard deviation of split frequencies: 0.011871
545500 -- (-320.361) (-315.219) [-316.221] (-317.445) * (-317.913) (-323.803) (-317.263) [-319.103] -- 0:00:26
546000 -- (-316.429) (-316.155) (-315.267) [-317.101] * [-315.767] (-315.788) (-316.501) (-320.418) -- 0:00:26
546500 -- [-318.575] (-321.368) (-317.130) (-321.357) * (-314.953) (-315.837) [-318.172] (-321.167) -- 0:00:26
547000 -- (-317.009) (-315.969) (-320.432) [-315.958] * [-315.144] (-319.239) (-317.545) (-316.412) -- 0:00:26
547500 -- (-317.467) [-315.575] (-316.000) (-315.010) * [-318.772] (-319.313) (-318.016) (-318.953) -- 0:00:26
548000 -- (-316.543) (-315.631) (-318.584) [-317.009] * (-317.955) [-318.278] (-317.462) (-316.200) -- 0:00:26
548500 -- (-315.819) (-315.185) [-315.669] (-316.572) * (-316.760) (-316.857) (-318.651) [-317.624] -- 0:00:26
549000 -- [-317.843] (-316.435) (-319.388) (-316.469) * (-316.359) [-315.695] (-316.518) (-316.785) -- 0:00:26
549500 -- (-317.570) [-316.730] (-317.314) (-317.338) * (-318.188) (-315.610) (-317.591) [-316.247] -- 0:00:27
550000 -- [-316.050] (-316.121) (-316.105) (-316.374) * (-317.760) (-316.805) (-317.844) [-316.809] -- 0:00:27
Average standard deviation of split frequencies: 0.011664
550500 -- [-318.283] (-319.987) (-316.486) (-316.823) * [-317.815] (-316.201) (-318.299) (-318.685) -- 0:00:26
551000 -- (-321.590) (-319.735) [-316.464] (-319.186) * (-318.362) [-317.811] (-318.295) (-320.178) -- 0:00:26
551500 -- [-319.665] (-317.942) (-316.795) (-316.525) * (-315.505) (-316.215) (-316.782) [-316.054] -- 0:00:26
552000 -- (-315.264) [-318.252] (-317.179) (-315.519) * (-316.690) (-317.482) (-317.668) [-315.620] -- 0:00:26
552500 -- [-316.008] (-316.921) (-315.859) (-316.074) * (-316.246) (-321.321) (-317.667) [-316.022] -- 0:00:26
553000 -- [-316.808] (-316.578) (-320.434) (-315.832) * (-317.111) [-316.725] (-319.042) (-317.269) -- 0:00:26
553500 -- (-316.783) (-317.469) (-321.956) [-315.871] * (-316.738) [-315.696] (-318.820) (-318.397) -- 0:00:26
554000 -- (-316.923) (-315.935) (-318.206) [-317.701] * (-315.404) [-318.172] (-318.229) (-317.820) -- 0:00:26
554500 -- (-320.456) (-317.284) [-317.862] (-319.724) * (-317.131) (-318.843) (-316.690) [-317.437] -- 0:00:26
555000 -- (-317.138) [-316.076] (-319.031) (-321.492) * (-316.755) [-316.050] (-319.526) (-319.171) -- 0:00:26
Average standard deviation of split frequencies: 0.011022
555500 -- (-316.997) [-319.218] (-316.737) (-317.696) * (-317.009) (-320.529) (-317.000) [-319.257] -- 0:00:26
556000 -- (-315.796) (-316.776) (-316.380) [-316.586] * (-316.392) (-315.813) [-318.627] (-315.851) -- 0:00:26
556500 -- (-316.484) [-315.841] (-317.516) (-316.633) * (-320.373) (-315.944) [-317.563] (-319.007) -- 0:00:26
557000 -- [-316.386] (-315.870) (-316.436) (-319.059) * (-318.502) [-317.725] (-316.906) (-316.721) -- 0:00:26
557500 -- (-321.109) [-315.344] (-315.902) (-318.576) * (-317.358) [-315.665] (-315.310) (-315.232) -- 0:00:26
558000 -- [-316.477] (-316.049) (-315.683) (-315.949) * [-316.938] (-315.904) (-316.348) (-316.476) -- 0:00:26
558500 -- (-315.862) (-316.692) [-316.480] (-316.970) * (-318.075) (-317.118) (-317.749) [-315.656] -- 0:00:26
559000 -- (-316.634) (-319.128) [-316.306] (-317.774) * (-316.515) (-318.774) (-320.048) [-316.309] -- 0:00:26
559500 -- (-320.360) (-318.943) [-319.012] (-318.188) * (-315.807) (-316.379) (-317.000) [-319.006] -- 0:00:25
560000 -- (-318.579) [-316.753] (-317.898) (-317.160) * (-316.894) [-320.011] (-319.119) (-316.544) -- 0:00:25
Average standard deviation of split frequencies: 0.010825
560500 -- (-317.768) (-315.617) [-316.507] (-317.521) * (-318.103) (-316.663) (-317.502) [-316.826] -- 0:00:25
561000 -- (-317.768) [-315.835] (-318.421) (-320.553) * [-316.678] (-318.523) (-315.994) (-316.101) -- 0:00:25
561500 -- (-318.565) [-316.460] (-316.030) (-317.690) * (-318.874) (-315.574) [-316.492] (-318.721) -- 0:00:25
562000 -- [-318.053] (-318.177) (-316.058) (-316.363) * (-317.382) (-315.955) (-318.225) [-315.647] -- 0:00:25
562500 -- [-316.598] (-318.295) (-315.238) (-317.592) * (-315.870) (-317.002) [-317.807] (-315.999) -- 0:00:25
563000 -- (-316.181) [-318.196] (-316.274) (-317.359) * (-317.536) (-316.599) [-317.349] (-316.089) -- 0:00:25
563500 -- (-317.711) (-321.099) [-315.490] (-320.070) * (-317.164) (-316.060) (-316.788) [-315.768] -- 0:00:25
564000 -- [-316.143] (-321.900) (-315.754) (-319.375) * (-315.247) (-317.066) [-317.064] (-315.432) -- 0:00:25
564500 -- (-317.322) (-319.865) (-321.108) [-315.771] * (-316.463) [-315.637] (-315.519) (-315.714) -- 0:00:25
565000 -- [-317.501] (-320.524) (-317.168) (-316.457) * (-317.276) (-316.267) [-318.763] (-318.571) -- 0:00:25
Average standard deviation of split frequencies: 0.010723
565500 -- (-316.918) (-323.935) (-317.428) [-320.710] * (-318.529) (-317.652) [-320.364] (-315.498) -- 0:00:25
566000 -- (-318.020) (-320.930) [-318.195] (-318.804) * (-315.056) (-319.108) (-316.268) [-317.870] -- 0:00:25
566500 -- (-316.217) (-316.460) (-317.996) [-316.117] * (-315.134) (-317.050) [-318.524] (-317.019) -- 0:00:26
567000 -- (-319.968) [-316.457] (-317.261) (-316.497) * (-315.230) (-316.529) [-319.929] (-318.103) -- 0:00:25
567500 -- (-316.950) (-318.389) (-317.204) [-318.514] * (-320.260) [-316.527] (-320.039) (-316.322) -- 0:00:25
568000 -- (-320.355) [-315.518] (-317.562) (-320.142) * (-317.322) [-316.958] (-315.937) (-315.365) -- 0:00:25
568500 -- (-315.716) (-318.470) [-315.441] (-316.040) * (-318.764) (-316.265) (-317.064) [-316.041] -- 0:00:25
569000 -- (-316.662) (-321.232) (-317.953) [-316.168] * (-319.731) (-317.051) [-316.595] (-317.534) -- 0:00:25
569500 -- (-316.934) (-321.186) [-315.509] (-317.355) * (-315.926) [-319.304] (-317.914) (-316.535) -- 0:00:25
570000 -- (-316.755) (-317.200) [-317.444] (-321.349) * (-317.606) (-320.009) (-319.706) [-316.093] -- 0:00:25
Average standard deviation of split frequencies: 0.010997
570500 -- [-320.328] (-318.159) (-315.499) (-321.015) * (-317.635) [-319.023] (-318.184) (-315.771) -- 0:00:25
571000 -- (-315.876) (-316.384) (-316.009) [-317.634] * (-319.488) (-316.455) [-317.158] (-316.272) -- 0:00:25
571500 -- [-316.234] (-317.765) (-315.526) (-317.388) * [-321.993] (-316.309) (-318.900) (-316.807) -- 0:00:25
572000 -- (-320.991) (-315.695) [-316.288] (-316.729) * (-318.167) (-317.290) [-317.608] (-317.961) -- 0:00:25
572500 -- (-317.735) (-318.937) (-316.194) [-318.947] * (-318.523) (-316.875) [-315.273] (-316.096) -- 0:00:25
573000 -- (-315.893) (-319.115) (-318.641) [-316.388] * (-317.260) (-317.997) (-315.829) [-317.877] -- 0:00:25
573500 -- (-317.371) (-320.902) (-318.803) [-318.073] * [-318.472] (-319.426) (-317.038) (-315.628) -- 0:00:25
574000 -- (-316.490) (-317.685) (-323.025) [-315.942] * (-317.773) (-318.596) (-322.086) [-318.799] -- 0:00:25
574500 -- (-318.353) [-317.309] (-316.429) (-316.875) * (-322.058) [-317.483] (-317.160) (-316.708) -- 0:00:25
575000 -- (-319.602) [-318.054] (-321.840) (-319.358) * (-319.194) (-317.263) [-316.579] (-316.132) -- 0:00:25
Average standard deviation of split frequencies: 0.010895
575500 -- [-315.599] (-320.182) (-315.945) (-317.414) * (-320.711) (-318.591) (-316.046) [-317.834] -- 0:00:25
576000 -- [-315.256] (-317.025) (-316.463) (-320.671) * (-318.177) (-315.882) [-316.209] (-315.811) -- 0:00:25
576500 -- (-315.299) (-316.540) [-317.137] (-316.578) * (-317.124) (-317.313) (-315.950) [-316.184] -- 0:00:24
577000 -- (-315.241) (-323.200) [-316.684] (-316.655) * [-316.194] (-319.122) (-315.784) (-315.851) -- 0:00:24
577500 -- (-317.223) (-316.675) (-315.680) [-315.485] * (-319.581) [-316.872] (-319.686) (-317.984) -- 0:00:24
578000 -- (-319.011) (-320.096) [-317.595] (-315.665) * (-316.081) (-316.528) [-317.124] (-319.052) -- 0:00:24
578500 -- (-319.103) [-316.011] (-317.305) (-316.319) * (-317.496) (-315.948) (-316.513) [-316.284] -- 0:00:24
579000 -- (-316.231) [-315.079] (-317.792) (-315.964) * (-315.772) (-317.814) (-319.593) [-317.111] -- 0:00:24
579500 -- (-316.234) (-317.803) [-316.189] (-317.800) * [-316.253] (-318.826) (-316.274) (-317.824) -- 0:00:24
580000 -- [-316.024] (-318.909) (-316.886) (-321.865) * [-319.347] (-318.268) (-316.428) (-318.587) -- 0:00:24
Average standard deviation of split frequencies: 0.010757
580500 -- (-315.591) (-317.922) [-316.477] (-318.883) * (-317.193) (-317.567) [-317.144] (-317.069) -- 0:00:24
581000 -- [-316.791] (-318.976) (-318.299) (-318.974) * (-317.479) [-318.271] (-315.988) (-318.487) -- 0:00:24
581500 -- [-315.995] (-319.274) (-319.611) (-319.622) * (-317.867) (-315.684) [-318.338] (-316.403) -- 0:00:24
582000 -- (-318.889) (-317.978) [-314.991] (-316.480) * (-318.086) (-316.605) [-320.429] (-316.801) -- 0:00:24
582500 -- (-315.633) (-317.833) [-317.676] (-323.056) * (-322.904) (-320.331) [-319.177] (-317.953) -- 0:00:24
583000 -- [-315.201] (-318.090) (-316.791) (-319.102) * (-322.684) (-318.902) (-319.880) [-317.440] -- 0:00:25
583500 -- (-316.707) [-316.716] (-316.886) (-319.069) * [-319.545] (-315.973) (-317.445) (-315.812) -- 0:00:24
584000 -- (-315.568) [-315.714] (-317.508) (-322.804) * [-316.818] (-317.300) (-319.785) (-315.666) -- 0:00:24
584500 -- (-316.467) (-319.797) (-317.302) [-319.081] * (-319.096) [-318.440] (-320.249) (-319.729) -- 0:00:24
585000 -- (-316.887) (-317.569) [-319.476] (-319.316) * (-315.641) [-316.192] (-322.172) (-318.353) -- 0:00:24
Average standard deviation of split frequencies: 0.011011
585500 -- (-315.893) (-315.602) (-316.645) [-316.872] * (-316.309) [-316.488] (-319.245) (-318.904) -- 0:00:24
586000 -- [-316.700] (-317.066) (-319.549) (-316.967) * (-316.731) [-317.111] (-319.160) (-316.140) -- 0:00:24
586500 -- (-315.902) (-315.442) [-318.419] (-319.904) * (-318.513) [-317.286] (-321.603) (-317.447) -- 0:00:24
587000 -- [-318.116] (-321.168) (-316.726) (-319.359) * (-318.217) [-315.353] (-316.791) (-315.185) -- 0:00:24
587500 -- (-320.246) (-318.124) [-316.250] (-319.392) * (-317.407) (-317.200) [-322.269] (-315.115) -- 0:00:24
588000 -- (-316.853) [-315.737] (-316.090) (-318.861) * (-316.629) (-315.637) (-317.178) [-316.432] -- 0:00:24
588500 -- (-315.051) (-317.927) [-316.718] (-318.620) * (-314.955) [-317.875] (-315.240) (-321.406) -- 0:00:24
589000 -- (-317.814) [-318.331] (-317.494) (-318.776) * (-318.270) (-317.827) [-317.874] (-317.116) -- 0:00:24
589500 -- [-318.618] (-315.635) (-316.612) (-316.830) * (-315.557) [-317.337] (-320.932) (-315.296) -- 0:00:24
590000 -- (-315.560) (-319.590) [-315.162] (-316.536) * (-316.713) (-315.060) [-318.575] (-315.784) -- 0:00:24
Average standard deviation of split frequencies: 0.010724
590500 -- (-316.051) (-317.786) (-317.684) [-316.108] * (-316.175) (-315.069) [-319.005] (-321.002) -- 0:00:24
591000 -- (-317.084) (-315.268) [-317.580] (-319.579) * (-316.901) (-317.795) [-323.148] (-317.601) -- 0:00:24
591500 -- (-316.656) (-317.323) [-316.226] (-318.495) * (-317.932) [-317.580] (-320.520) (-320.985) -- 0:00:24
592000 -- (-318.414) [-315.781] (-318.599) (-316.046) * (-321.284) [-317.618] (-315.993) (-318.315) -- 0:00:24
592500 -- (-322.094) (-316.806) [-319.925] (-315.955) * (-319.644) [-315.506] (-316.244) (-315.699) -- 0:00:24
593000 -- (-321.460) [-317.772] (-318.170) (-316.430) * (-316.007) (-315.432) [-315.550] (-318.187) -- 0:00:24
593500 -- (-317.804) [-316.624] (-318.670) (-317.262) * (-317.213) [-315.450] (-315.126) (-317.911) -- 0:00:23
594000 -- (-317.940) (-317.693) [-316.193] (-319.650) * (-316.492) (-316.818) (-316.519) [-315.956] -- 0:00:23
594500 -- (-315.775) (-319.328) (-316.346) [-318.778] * (-317.574) [-318.083] (-317.237) (-318.542) -- 0:00:23
595000 -- [-316.825] (-316.550) (-316.102) (-324.231) * [-320.417] (-317.616) (-316.095) (-316.448) -- 0:00:23
Average standard deviation of split frequencies: 0.011024
595500 -- (-317.284) [-316.505] (-316.206) (-319.449) * [-318.776] (-317.555) (-318.472) (-317.036) -- 0:00:23
596000 -- (-317.009) (-317.882) [-317.353] (-317.368) * (-316.896) [-318.675] (-317.446) (-316.083) -- 0:00:23
596500 -- (-316.160) (-315.784) [-316.512] (-317.681) * [-316.449] (-319.133) (-317.956) (-316.955) -- 0:00:23
597000 -- (-316.789) (-315.103) [-316.408] (-315.238) * [-315.954] (-316.443) (-318.138) (-315.864) -- 0:00:23
597500 -- (-322.510) (-315.967) [-317.105] (-316.036) * (-317.532) [-318.908] (-316.200) (-317.346) -- 0:00:23
598000 -- (-317.900) [-319.130] (-317.625) (-317.671) * [-316.201] (-317.762) (-317.505) (-316.978) -- 0:00:23
598500 -- (-317.278) (-317.810) (-321.580) [-316.193] * (-320.036) (-319.873) [-315.448] (-317.957) -- 0:00:23
599000 -- (-320.647) (-316.478) [-316.381] (-317.819) * (-324.087) (-320.520) [-320.056] (-316.057) -- 0:00:23
599500 -- (-318.127) (-318.868) [-316.948] (-316.622) * [-322.008] (-318.643) (-316.263) (-316.105) -- 0:00:23
600000 -- [-319.686] (-318.514) (-317.114) (-316.587) * [-319.646] (-316.028) (-321.754) (-318.061) -- 0:00:23
Average standard deviation of split frequencies: 0.010791
600500 -- [-318.024] (-321.269) (-318.347) (-317.546) * [-315.417] (-319.166) (-317.258) (-318.477) -- 0:00:23
601000 -- [-316.096] (-321.389) (-319.306) (-316.286) * (-318.155) [-318.850] (-318.988) (-316.550) -- 0:00:23
601500 -- (-318.849) [-318.012] (-316.640) (-316.093) * (-320.138) [-316.544] (-319.072) (-317.890) -- 0:00:23
602000 -- (-315.363) (-315.376) (-316.295) [-318.170] * (-319.181) [-316.186] (-318.403) (-317.185) -- 0:00:23
602500 -- (-316.849) [-315.886] (-317.612) (-317.458) * (-316.042) (-316.085) [-317.243] (-318.199) -- 0:00:23
603000 -- [-317.054] (-316.256) (-315.415) (-317.228) * (-316.862) (-318.378) [-318.735] (-319.036) -- 0:00:23
603500 -- (-316.816) (-315.791) (-316.282) [-316.113] * (-318.083) [-319.403] (-317.920) (-322.607) -- 0:00:23
604000 -- (-318.059) (-315.955) (-317.521) [-315.074] * [-315.753] (-317.022) (-318.165) (-317.620) -- 0:00:23
604500 -- [-315.580] (-320.487) (-318.189) (-316.369) * (-317.736) (-318.136) (-316.822) [-316.393] -- 0:00:23
605000 -- (-317.328) (-317.670) [-316.330] (-316.667) * [-316.114] (-317.462) (-315.393) (-319.710) -- 0:00:23
Average standard deviation of split frequencies: 0.011523
605500 -- (-316.329) [-316.638] (-317.380) (-316.307) * (-316.129) (-319.579) [-317.198] (-316.175) -- 0:00:23
606000 -- (-315.767) [-315.488] (-315.646) (-320.254) * (-316.944) [-315.606] (-320.547) (-318.289) -- 0:00:23
606500 -- (-317.333) (-315.464) [-315.262] (-316.220) * (-319.306) [-318.371] (-316.379) (-316.656) -- 0:00:23
607000 -- (-316.697) [-314.943] (-317.146) (-318.443) * (-316.830) (-317.718) [-316.851] (-315.741) -- 0:00:23
607500 -- [-318.794] (-316.176) (-317.955) (-317.000) * (-320.988) (-320.158) (-318.795) [-315.282] -- 0:00:23
608000 -- (-323.466) [-315.981] (-315.326) (-316.559) * [-317.729] (-323.442) (-319.854) (-316.982) -- 0:00:23
608500 -- (-316.285) (-315.871) [-315.665] (-317.432) * (-318.304) (-316.434) (-317.540) [-316.791] -- 0:00:23
609000 -- [-315.967] (-316.383) (-315.560) (-320.256) * (-318.056) [-317.339] (-317.468) (-317.997) -- 0:00:23
609500 -- (-316.388) [-315.503] (-316.630) (-320.616) * (-316.643) [-321.121] (-320.496) (-316.803) -- 0:00:23
610000 -- (-316.334) (-316.967) (-317.379) [-318.567] * [-316.866] (-316.547) (-316.853) (-316.151) -- 0:00:23
Average standard deviation of split frequencies: 0.010856
610500 -- (-316.768) (-320.362) (-316.100) [-318.905] * (-315.924) [-317.733] (-319.875) (-315.309) -- 0:00:22
611000 -- [-318.172] (-318.066) (-317.296) (-316.898) * (-315.842) [-315.845] (-316.316) (-316.873) -- 0:00:22
611500 -- (-319.200) [-316.754] (-315.394) (-316.782) * (-315.818) [-318.022] (-316.793) (-320.837) -- 0:00:22
612000 -- (-316.684) [-319.586] (-317.901) (-316.898) * [-318.884] (-318.208) (-317.161) (-316.204) -- 0:00:22
612500 -- (-320.617) (-315.760) [-317.907] (-318.641) * (-318.148) (-316.888) (-317.519) [-315.619] -- 0:00:22
613000 -- (-325.654) (-322.466) (-317.807) [-317.106] * (-323.242) [-319.992] (-317.416) (-318.017) -- 0:00:22
613500 -- (-319.590) (-318.249) [-316.517] (-316.944) * (-316.587) (-319.444) [-316.144] (-317.336) -- 0:00:22
614000 -- (-318.460) (-317.669) [-316.068] (-315.724) * (-316.547) [-315.901] (-316.166) (-315.347) -- 0:00:22
614500 -- (-316.579) (-318.830) [-316.425] (-316.612) * (-316.589) (-320.469) [-316.746] (-317.010) -- 0:00:22
615000 -- (-318.107) (-316.482) [-316.678] (-316.994) * (-317.101) (-316.586) [-317.643] (-318.198) -- 0:00:22
Average standard deviation of split frequencies: 0.011049
615500 -- (-317.945) (-320.260) (-315.569) [-316.278] * [-317.901] (-317.690) (-319.976) (-317.146) -- 0:00:22
616000 -- (-320.226) (-317.786) [-316.022] (-316.369) * (-317.822) [-317.471] (-319.053) (-317.666) -- 0:00:22
616500 -- (-320.784) [-316.279] (-317.147) (-315.781) * (-316.584) (-317.918) (-316.086) [-317.185] -- 0:00:22
617000 -- (-318.486) (-317.916) (-319.562) [-316.236] * (-315.057) (-317.083) [-316.751] (-320.985) -- 0:00:22
617500 -- [-318.062] (-316.542) (-317.346) (-315.292) * (-319.576) [-316.266] (-317.383) (-315.255) -- 0:00:22
618000 -- (-315.816) [-317.084] (-318.904) (-319.867) * (-317.165) (-316.080) [-322.630] (-315.915) -- 0:00:22
618500 -- (-317.776) [-317.549] (-316.680) (-315.709) * (-316.944) [-320.368] (-318.309) (-315.157) -- 0:00:22
619000 -- (-316.174) (-321.260) (-317.984) [-316.087] * (-318.406) [-320.811] (-318.133) (-315.335) -- 0:00:22
619500 -- (-316.698) (-319.166) [-316.240] (-317.235) * (-317.907) (-318.451) (-317.444) [-316.261] -- 0:00:22
620000 -- (-320.233) [-315.942] (-320.263) (-320.871) * (-316.483) (-317.727) [-317.426] (-315.992) -- 0:00:22
Average standard deviation of split frequencies: 0.011298
620500 -- (-318.113) (-315.781) [-316.224] (-317.774) * (-316.034) (-316.518) [-318.631] (-315.409) -- 0:00:22
621000 -- (-315.914) [-318.705] (-316.348) (-315.659) * (-316.867) (-316.466) (-317.953) [-316.083] -- 0:00:22
621500 -- (-316.788) (-318.218) [-319.698] (-316.615) * [-315.816] (-319.071) (-316.729) (-316.398) -- 0:00:22
622000 -- (-316.137) [-319.631] (-316.294) (-319.155) * [-315.056] (-319.731) (-318.456) (-316.033) -- 0:00:22
622500 -- [-316.478] (-316.770) (-315.228) (-317.631) * [-317.625] (-315.482) (-320.690) (-316.703) -- 0:00:22
623000 -- (-316.154) [-317.448] (-320.967) (-317.263) * (-318.265) (-315.969) [-316.986] (-316.731) -- 0:00:22
623500 -- (-318.426) (-317.122) (-315.419) [-318.362] * [-318.074] (-317.218) (-316.097) (-317.870) -- 0:00:22
624000 -- (-320.678) (-316.475) [-315.055] (-316.611) * [-319.564] (-317.862) (-316.275) (-316.138) -- 0:00:22
624500 -- (-318.576) [-317.769] (-317.182) (-316.538) * (-314.967) [-317.807] (-316.137) (-315.419) -- 0:00:22
625000 -- (-316.024) (-318.245) [-316.570] (-318.055) * [-318.538] (-318.378) (-316.196) (-317.099) -- 0:00:22
Average standard deviation of split frequencies: 0.011437
625500 -- (-317.751) [-317.143] (-319.802) (-317.316) * (-316.951) [-319.601] (-315.877) (-317.189) -- 0:00:22
626000 -- (-320.107) [-319.129] (-318.447) (-317.286) * (-316.816) (-320.677) [-316.704] (-318.364) -- 0:00:22
626500 -- (-318.824) [-316.583] (-316.634) (-317.897) * (-320.045) (-320.478) (-317.554) [-318.719] -- 0:00:22
627000 -- (-315.809) (-319.433) (-316.046) [-316.486] * (-317.658) (-317.378) (-317.286) [-315.824] -- 0:00:22
627500 -- (-321.453) [-316.578] (-319.417) (-320.081) * [-315.438] (-316.630) (-315.999) (-317.096) -- 0:00:21
628000 -- [-318.017] (-316.805) (-320.329) (-316.673) * (-322.092) [-317.017] (-318.307) (-316.801) -- 0:00:21
628500 -- (-319.132) (-317.074) [-317.704] (-315.963) * (-317.118) (-318.698) [-316.331] (-318.744) -- 0:00:21
629000 -- (-320.481) (-317.897) [-316.266] (-318.186) * (-317.891) (-317.497) (-315.907) [-317.893] -- 0:00:21
629500 -- (-319.593) [-316.452] (-316.833) (-318.417) * [-315.919] (-319.032) (-316.865) (-316.314) -- 0:00:21
630000 -- (-318.315) [-315.778] (-316.642) (-316.359) * [-316.052] (-317.215) (-315.992) (-316.703) -- 0:00:21
Average standard deviation of split frequencies: 0.011025
630500 -- (-318.782) [-319.873] (-318.920) (-316.919) * (-315.913) [-319.516] (-320.290) (-315.426) -- 0:00:21
631000 -- (-316.635) (-319.999) (-315.288) [-318.036] * (-316.727) [-318.715] (-320.468) (-317.141) -- 0:00:21
631500 -- (-317.504) (-317.406) (-316.346) [-317.828] * (-318.614) (-317.245) (-318.098) [-316.621] -- 0:00:21
632000 -- [-317.840] (-323.829) (-317.132) (-321.948) * [-317.203] (-317.492) (-316.643) (-315.390) -- 0:00:21
632500 -- (-318.642) [-320.682] (-318.541) (-318.474) * (-316.215) (-320.592) [-316.040] (-318.409) -- 0:00:21
633000 -- (-318.918) (-320.911) [-318.070] (-316.255) * (-315.358) [-317.122] (-316.317) (-315.762) -- 0:00:21
633500 -- (-316.561) (-316.358) (-318.511) [-317.912] * [-315.916] (-315.042) (-315.278) (-318.133) -- 0:00:21
634000 -- (-315.286) [-316.555] (-315.723) (-318.523) * (-316.089) (-317.214) [-319.389] (-323.859) -- 0:00:21
634500 -- (-321.184) (-319.043) (-316.885) [-317.521] * [-316.750] (-315.438) (-318.036) (-316.824) -- 0:00:21
635000 -- [-320.362] (-322.135) (-321.162) (-316.646) * (-318.714) (-314.919) (-316.802) [-317.624] -- 0:00:21
Average standard deviation of split frequencies: 0.011072
635500 -- [-316.260] (-317.508) (-318.119) (-317.055) * (-320.008) [-316.967] (-317.256) (-318.341) -- 0:00:21
636000 -- (-318.575) (-316.326) (-315.568) [-317.023] * (-317.925) (-316.966) [-316.835] (-316.324) -- 0:00:21
636500 -- (-315.700) (-316.947) (-317.555) [-315.660] * (-316.781) (-316.342) (-317.109) [-316.910] -- 0:00:21
637000 -- (-316.989) (-317.766) [-318.222] (-318.989) * (-318.526) [-315.801] (-316.358) (-319.624) -- 0:00:21
637500 -- [-319.230] (-315.348) (-323.538) (-316.512) * (-316.236) [-315.425] (-316.148) (-319.646) -- 0:00:21
638000 -- (-316.172) [-314.935] (-318.556) (-316.841) * (-317.679) [-315.589] (-317.971) (-317.461) -- 0:00:21
638500 -- (-317.455) (-315.061) [-316.771] (-318.042) * (-319.676) (-317.920) (-316.595) [-317.898] -- 0:00:21
639000 -- [-316.374] (-317.008) (-318.333) (-316.995) * (-317.432) (-318.937) (-319.923) [-316.234] -- 0:00:21
639500 -- (-317.653) (-315.575) (-320.363) [-317.309] * [-315.692] (-316.258) (-317.462) (-318.132) -- 0:00:21
640000 -- (-317.952) [-319.388] (-320.367) (-318.125) * (-317.807) (-319.313) (-315.018) [-315.504] -- 0:00:21
Average standard deviation of split frequencies: 0.011589
640500 -- (-317.614) [-318.687] (-318.905) (-321.231) * (-317.138) (-317.611) (-318.566) [-315.744] -- 0:00:21
641000 -- (-320.352) [-317.341] (-315.951) (-321.961) * (-315.654) (-318.171) [-316.840] (-318.259) -- 0:00:21
641500 -- [-317.777] (-323.772) (-316.944) (-315.876) * (-317.790) (-316.779) (-319.284) [-315.316] -- 0:00:21
642000 -- (-316.808) (-319.083) (-321.111) [-318.169] * (-320.548) (-315.130) (-316.033) [-320.185] -- 0:00:21
642500 -- (-317.887) (-318.436) (-318.120) [-317.456] * (-322.638) (-317.894) [-318.319] (-321.225) -- 0:00:21
643000 -- (-316.328) (-316.951) [-319.486] (-317.231) * (-321.190) (-316.127) (-317.598) [-321.052] -- 0:00:21
643500 -- (-317.967) (-315.968) [-317.950] (-319.249) * (-318.495) [-316.294] (-316.447) (-316.249) -- 0:00:21
644000 -- (-316.188) [-316.013] (-325.074) (-319.836) * [-316.424] (-316.666) (-318.118) (-316.536) -- 0:00:21
644500 -- (-317.171) (-320.257) (-317.764) [-317.403] * (-319.802) (-316.663) (-317.625) [-315.333] -- 0:00:20
645000 -- (-316.686) (-323.832) [-318.936] (-318.770) * (-317.238) (-317.760) (-320.223) [-318.266] -- 0:00:20
Average standard deviation of split frequencies: 0.011402
645500 -- (-318.973) (-319.066) (-318.527) [-316.582] * (-316.237) (-317.347) [-316.765] (-315.695) -- 0:00:20
646000 -- (-321.321) [-317.372] (-317.136) (-318.485) * [-316.461] (-317.299) (-319.357) (-316.909) -- 0:00:20
646500 -- (-318.065) [-316.010] (-319.000) (-316.884) * [-315.744] (-318.333) (-315.288) (-316.918) -- 0:00:20
647000 -- (-319.019) (-319.432) (-316.171) [-317.550] * [-315.534] (-317.934) (-320.282) (-316.971) -- 0:00:20
647500 -- [-319.168] (-315.618) (-317.475) (-317.174) * (-315.545) (-319.564) (-317.859) [-315.313] -- 0:00:20
648000 -- (-320.903) (-317.015) [-319.086] (-316.701) * (-319.353) [-316.832] (-322.477) (-317.165) -- 0:00:20
648500 -- (-315.015) (-316.276) (-317.760) [-318.351] * (-315.806) (-316.613) (-320.222) [-316.215] -- 0:00:20
649000 -- [-318.577] (-319.634) (-324.654) (-315.580) * [-316.378] (-318.397) (-315.789) (-316.716) -- 0:00:20
649500 -- (-315.680) [-317.736] (-320.710) (-315.462) * (-320.806) (-317.744) (-315.472) [-317.082] -- 0:00:20
650000 -- [-315.404] (-319.240) (-319.121) (-316.230) * (-318.993) (-317.013) (-316.227) [-316.986] -- 0:00:20
Average standard deviation of split frequencies: 0.011049
650500 -- (-316.524) (-318.506) (-318.877) [-317.200] * (-317.659) [-316.486] (-320.959) (-320.539) -- 0:00:20
651000 -- [-322.125] (-317.863) (-320.020) (-317.299) * (-319.216) [-317.393] (-318.917) (-316.449) -- 0:00:20
651500 -- (-317.563) [-316.173] (-318.289) (-317.443) * (-317.877) [-317.667] (-318.657) (-318.566) -- 0:00:20
652000 -- [-318.111] (-316.318) (-317.859) (-319.172) * (-319.394) [-319.825] (-322.575) (-318.252) -- 0:00:20
652500 -- [-318.089] (-317.141) (-319.865) (-317.075) * (-320.266) (-317.940) [-321.529] (-315.758) -- 0:00:20
653000 -- (-316.602) (-315.664) [-317.743] (-320.119) * (-319.151) (-317.061) [-315.909] (-316.482) -- 0:00:20
653500 -- (-320.089) (-316.048) (-315.456) [-318.441] * (-318.250) (-320.002) [-318.631] (-315.650) -- 0:00:20
654000 -- [-317.636] (-316.744) (-315.282) (-315.246) * (-317.934) (-318.627) [-318.349] (-317.666) -- 0:00:20
654500 -- (-317.820) (-318.779) (-318.537) [-319.810] * (-318.367) (-316.751) (-320.600) [-316.941] -- 0:00:20
655000 -- (-316.886) [-320.853] (-315.909) (-322.328) * (-316.819) (-317.104) (-315.975) [-316.330] -- 0:00:20
Average standard deviation of split frequencies: 0.010510
655500 -- [-316.023] (-318.810) (-315.948) (-323.698) * [-316.597] (-319.294) (-315.869) (-316.422) -- 0:00:20
656000 -- [-315.794] (-318.585) (-319.702) (-322.581) * [-316.755] (-317.186) (-318.276) (-317.458) -- 0:00:20
656500 -- (-320.665) [-317.022] (-317.886) (-320.194) * (-315.353) (-319.448) (-317.576) [-316.244] -- 0:00:20
657000 -- (-317.590) (-317.159) [-319.370] (-317.404) * [-316.572] (-317.725) (-315.744) (-317.643) -- 0:00:20
657500 -- (-318.420) (-316.471) (-319.757) [-316.854] * [-316.565] (-321.702) (-315.532) (-317.136) -- 0:00:20
658000 -- (-317.651) (-316.974) (-319.958) [-319.886] * (-318.727) [-317.725] (-315.666) (-318.424) -- 0:00:20
658500 -- [-320.277] (-322.640) (-318.971) (-316.777) * (-315.364) (-316.987) [-317.313] (-316.596) -- 0:00:20
659000 -- (-315.853) (-320.039) (-318.152) [-316.975] * [-315.458] (-316.739) (-320.164) (-320.774) -- 0:00:20
659500 -- [-315.523] (-320.658) (-318.721) (-319.291) * [-322.967] (-316.501) (-318.746) (-318.735) -- 0:00:20
660000 -- (-316.845) [-322.732] (-316.642) (-317.988) * [-319.009] (-321.472) (-315.989) (-316.400) -- 0:00:20
Average standard deviation of split frequencies: 0.010703
660500 -- [-315.790] (-315.939) (-315.937) (-315.831) * (-318.977) (-316.036) [-317.484] (-316.768) -- 0:00:20
661000 -- (-320.289) [-318.160] (-317.026) (-316.814) * (-317.196) (-319.428) [-317.280] (-316.394) -- 0:00:20
661500 -- (-315.436) (-316.335) (-318.238) [-316.417] * (-317.723) (-315.425) (-315.586) [-316.258] -- 0:00:19
662000 -- [-315.391] (-319.662) (-317.855) (-322.767) * (-319.144) (-316.804) (-317.690) [-317.464] -- 0:00:19
662500 -- (-315.818) (-317.549) [-315.891] (-317.783) * (-318.846) (-316.819) [-317.396] (-315.914) -- 0:00:19
663000 -- [-316.940] (-317.561) (-320.096) (-316.558) * [-317.876] (-319.802) (-320.312) (-319.245) -- 0:00:19
663500 -- (-315.334) [-318.980] (-321.227) (-318.828) * (-319.361) [-316.945] (-319.663) (-316.689) -- 0:00:19
664000 -- (-318.483) (-316.932) [-317.592] (-323.469) * [-315.678] (-316.579) (-315.896) (-315.362) -- 0:00:19
664500 -- (-316.698) (-324.126) (-321.826) [-326.727] * [-316.358] (-317.028) (-319.504) (-315.471) -- 0:00:19
665000 -- [-318.103] (-315.632) (-324.734) (-318.652) * [-317.413] (-317.455) (-315.568) (-315.400) -- 0:00:19
Average standard deviation of split frequencies: 0.010883
665500 -- (-317.599) (-318.196) (-320.758) [-318.662] * [-318.120] (-318.456) (-317.193) (-315.659) -- 0:00:19
666000 -- (-322.820) (-320.131) [-316.719] (-318.674) * (-318.831) (-319.762) (-317.924) [-315.953] -- 0:00:19
666500 -- (-316.458) [-315.269] (-317.794) (-320.190) * (-319.777) (-316.497) (-316.243) [-319.291] -- 0:00:19
667000 -- (-322.625) (-316.509) (-318.738) [-318.656] * [-315.784] (-320.079) (-320.645) (-317.332) -- 0:00:19
667500 -- (-319.450) (-316.271) [-316.239] (-320.626) * (-315.696) (-316.582) [-317.421] (-317.136) -- 0:00:19
668000 -- (-318.174) [-319.713] (-316.938) (-316.978) * (-317.143) [-316.092] (-317.397) (-317.905) -- 0:00:19
668500 -- (-316.885) [-318.080] (-315.488) (-318.231) * (-318.106) [-316.837] (-317.162) (-317.932) -- 0:00:19
669000 -- (-318.243) (-320.329) [-316.487] (-317.493) * (-318.425) (-322.474) (-319.533) [-317.119] -- 0:00:19
669500 -- (-317.418) (-316.985) [-316.216] (-317.601) * (-321.460) [-316.747] (-316.007) (-318.445) -- 0:00:19
670000 -- (-319.843) (-317.798) [-319.489] (-318.860) * [-318.321] (-317.675) (-315.548) (-317.419) -- 0:00:19
Average standard deviation of split frequencies: 0.010368
670500 -- (-316.167) (-317.700) [-316.048] (-315.993) * (-316.601) (-316.977) [-315.366] (-327.038) -- 0:00:19
671000 -- (-315.675) [-318.111] (-318.008) (-315.678) * (-316.583) [-318.270] (-317.918) (-323.931) -- 0:00:19
671500 -- (-317.051) [-317.673] (-318.803) (-317.662) * (-317.577) (-318.057) (-315.367) [-316.781] -- 0:00:19
672000 -- (-318.110) [-315.132] (-319.572) (-319.181) * [-318.162] (-315.720) (-317.779) (-320.483) -- 0:00:19
672500 -- [-316.946] (-317.589) (-318.254) (-318.719) * (-315.915) [-317.419] (-320.661) (-319.360) -- 0:00:19
673000 -- (-319.241) [-319.958] (-317.638) (-321.652) * [-316.817] (-318.085) (-318.286) (-315.384) -- 0:00:19
673500 -- (-321.566) (-323.579) (-318.477) [-316.178] * (-318.397) [-317.029] (-319.131) (-315.923) -- 0:00:19
674000 -- (-319.513) (-318.564) (-316.732) [-317.496] * [-316.269] (-320.564) (-316.977) (-315.758) -- 0:00:19
674500 -- (-321.396) (-319.852) (-317.327) [-317.481] * (-320.158) (-315.937) (-317.767) [-317.058] -- 0:00:19
675000 -- (-320.157) (-321.985) (-316.536) [-317.048] * (-318.849) (-315.326) (-320.553) [-317.010] -- 0:00:19
Average standard deviation of split frequencies: 0.010329
675500 -- (-320.212) (-317.179) (-316.014) [-317.346] * [-316.870] (-316.567) (-316.283) (-316.888) -- 0:00:19
676000 -- (-318.702) (-317.501) (-317.208) [-318.801] * [-318.334] (-320.615) (-321.197) (-316.142) -- 0:00:19
676500 -- (-316.617) (-316.145) [-318.348] (-316.078) * [-315.468] (-317.587) (-319.220) (-316.718) -- 0:00:19
677000 -- (-317.113) (-322.600) [-315.142] (-324.256) * [-318.154] (-316.854) (-321.713) (-319.517) -- 0:00:19
677500 -- (-315.555) (-315.865) (-316.135) [-315.915] * (-317.908) [-315.912] (-317.408) (-316.921) -- 0:00:19
678000 -- [-318.976] (-316.790) (-317.480) (-315.466) * (-317.225) (-315.531) (-316.218) [-319.909] -- 0:00:18
678500 -- [-317.587] (-318.205) (-315.888) (-317.049) * [-316.700] (-315.672) (-320.589) (-316.832) -- 0:00:18
679000 -- [-317.961] (-317.908) (-319.841) (-316.373) * (-315.352) (-316.454) (-322.080) [-316.573] -- 0:00:18
679500 -- (-321.853) (-316.484) (-317.263) [-315.362] * (-316.724) [-317.045] (-325.083) (-317.958) -- 0:00:18
680000 -- (-323.535) (-317.381) (-318.810) [-316.138] * (-318.979) [-316.435] (-316.894) (-318.327) -- 0:00:18
Average standard deviation of split frequencies: 0.010475
680500 -- (-318.968) (-316.087) [-316.948] (-319.191) * [-317.303] (-318.306) (-318.364) (-315.301) -- 0:00:18
681000 -- (-323.166) [-317.503] (-319.032) (-316.985) * [-321.519] (-316.843) (-319.324) (-315.611) -- 0:00:18
681500 -- (-326.432) (-317.150) (-317.853) [-316.513] * [-316.461] (-316.331) (-317.091) (-317.693) -- 0:00:18
682000 -- (-317.431) (-318.269) (-317.989) [-319.346] * [-318.106] (-319.053) (-318.264) (-317.975) -- 0:00:18
682500 -- (-316.252) (-317.448) (-315.551) [-320.585] * (-318.480) (-315.955) [-317.287] (-316.743) -- 0:00:18
683000 -- (-318.263) [-317.855] (-315.814) (-320.079) * (-316.219) [-316.670] (-317.583) (-317.370) -- 0:00:18
683500 -- (-316.796) (-315.922) [-321.394] (-319.340) * [-317.011] (-316.953) (-316.743) (-317.897) -- 0:00:18
684000 -- [-316.231] (-320.711) (-315.886) (-316.031) * [-317.588] (-316.428) (-315.978) (-317.060) -- 0:00:18
684500 -- (-318.485) (-320.267) (-317.626) [-320.801] * (-321.346) (-320.051) [-316.699] (-318.347) -- 0:00:18
685000 -- (-317.092) (-320.022) [-317.043] (-317.646) * (-319.414) (-323.182) [-315.196] (-317.580) -- 0:00:18
Average standard deviation of split frequencies: 0.010093
685500 -- (-317.114) (-317.568) (-319.366) [-318.655] * [-319.483] (-318.659) (-317.572) (-317.750) -- 0:00:18
686000 -- [-317.985] (-317.431) (-316.846) (-317.380) * (-315.796) [-320.805] (-315.991) (-319.801) -- 0:00:18
686500 -- (-316.467) [-319.526] (-318.834) (-317.104) * (-320.682) [-318.579] (-316.652) (-318.287) -- 0:00:18
687000 -- (-317.243) (-320.648) [-315.744] (-315.552) * (-316.561) (-318.140) (-315.853) [-316.199] -- 0:00:18
687500 -- (-315.196) (-318.942) (-317.216) [-318.177] * (-316.259) (-316.224) [-317.126] (-315.384) -- 0:00:18
688000 -- [-317.242] (-319.940) (-316.779) (-318.446) * (-316.650) [-316.251] (-317.818) (-316.557) -- 0:00:18
688500 -- (-316.626) [-316.571] (-317.045) (-317.944) * (-315.339) (-321.579) (-317.287) [-315.882] -- 0:00:18
689000 -- (-315.733) [-319.244] (-315.215) (-316.663) * (-317.640) (-320.314) [-317.467] (-317.570) -- 0:00:18
689500 -- (-320.705) [-316.112] (-317.407) (-315.721) * [-318.439] (-318.602) (-316.965) (-316.780) -- 0:00:18
690000 -- [-316.709] (-320.836) (-315.655) (-316.996) * (-319.904) (-323.216) (-320.018) [-320.128] -- 0:00:18
Average standard deviation of split frequencies: 0.010025
690500 -- (-315.209) (-318.659) [-316.973] (-316.776) * (-319.388) (-322.296) (-318.620) [-328.684] -- 0:00:18
691000 -- (-316.051) [-315.929] (-323.172) (-317.215) * (-318.426) (-316.234) [-318.935] (-326.720) -- 0:00:18
691500 -- (-316.485) (-316.907) (-317.002) [-321.314] * (-319.068) [-315.552] (-319.713) (-317.041) -- 0:00:18
692000 -- (-315.950) (-316.542) (-318.799) [-317.151] * (-317.191) (-317.399) (-315.305) [-319.770] -- 0:00:18
692500 -- (-317.816) (-316.045) (-318.886) [-316.241] * (-318.726) [-316.851] (-315.688) (-318.563) -- 0:00:18
693000 -- [-317.937] (-320.576) (-316.741) (-319.436) * (-317.231) (-318.427) [-315.733] (-316.049) -- 0:00:18
693500 -- (-323.157) (-315.880) (-317.881) [-318.433] * (-315.666) [-315.044] (-316.429) (-317.344) -- 0:00:18
694000 -- (-315.960) (-317.582) (-317.298) [-315.621] * [-315.328] (-318.612) (-317.452) (-317.652) -- 0:00:18
694500 -- (-319.517) (-321.745) [-315.879] (-318.156) * (-315.538) (-317.453) [-317.109] (-316.595) -- 0:00:18
695000 -- (-317.794) [-316.456] (-315.780) (-318.553) * [-315.997] (-317.241) (-317.740) (-319.609) -- 0:00:17
Average standard deviation of split frequencies: 0.010117
695500 -- (-316.211) [-317.428] (-317.445) (-316.965) * [-317.807] (-320.967) (-320.564) (-320.524) -- 0:00:17
696000 -- (-315.458) [-316.977] (-317.022) (-317.013) * [-319.399] (-319.665) (-317.794) (-315.427) -- 0:00:17
696500 -- [-319.174] (-324.077) (-318.776) (-316.971) * (-316.844) (-319.027) [-317.203] (-316.238) -- 0:00:17
697000 -- (-316.612) [-316.275] (-318.138) (-317.467) * (-315.746) (-318.395) [-316.480] (-321.169) -- 0:00:17
697500 -- (-319.556) (-318.282) [-318.224] (-317.010) * (-317.461) [-318.621] (-316.545) (-320.419) -- 0:00:17
698000 -- (-317.740) (-316.715) [-315.320] (-316.531) * (-318.086) (-319.528) [-316.307] (-320.184) -- 0:00:17
698500 -- [-318.854] (-319.071) (-316.156) (-318.719) * [-320.149] (-319.640) (-320.469) (-316.927) -- 0:00:17
699000 -- (-317.260) (-317.779) [-316.655] (-315.435) * (-316.168) [-320.514] (-315.164) (-317.159) -- 0:00:17
699500 -- (-320.375) (-316.815) [-320.739] (-319.366) * (-315.687) [-318.510] (-315.130) (-315.630) -- 0:00:17
700000 -- (-316.854) (-321.343) [-318.903] (-318.265) * (-316.761) (-317.377) [-318.589] (-315.635) -- 0:00:17
Average standard deviation of split frequencies: 0.009798
700500 -- (-318.225) [-316.557] (-315.893) (-317.256) * [-316.095] (-316.595) (-318.446) (-318.850) -- 0:00:17
701000 -- (-319.517) [-317.021] (-315.656) (-316.758) * (-317.236) (-319.502) [-316.693] (-317.325) -- 0:00:17
701500 -- (-316.272) (-315.582) [-316.004] (-316.441) * (-315.415) [-316.919] (-320.021) (-315.558) -- 0:00:17
702000 -- (-316.090) (-315.505) [-318.756] (-315.430) * [-317.799] (-316.680) (-316.557) (-319.374) -- 0:00:17
702500 -- (-319.756) [-315.351] (-317.899) (-317.455) * (-316.494) [-319.113] (-317.496) (-316.656) -- 0:00:17
703000 -- (-317.103) (-316.292) (-323.007) [-316.553] * [-316.114] (-318.635) (-319.628) (-320.254) -- 0:00:17
703500 -- (-318.015) (-318.796) (-323.009) [-315.691] * (-317.145) [-316.767] (-320.731) (-316.564) -- 0:00:17
704000 -- (-317.625) [-320.436] (-318.529) (-316.835) * (-317.330) [-316.500] (-317.049) (-316.715) -- 0:00:17
704500 -- [-316.611] (-315.759) (-316.891) (-316.575) * (-316.230) (-315.590) (-315.943) [-319.400] -- 0:00:17
705000 -- (-316.504) (-316.614) (-316.641) [-314.997] * [-316.690] (-320.421) (-319.988) (-317.376) -- 0:00:17
Average standard deviation of split frequencies: 0.009932
705500 -- (-317.543) [-315.752] (-322.259) (-317.783) * (-319.097) (-323.955) [-316.444] (-315.936) -- 0:00:17
706000 -- [-318.179] (-318.305) (-318.212) (-315.732) * (-317.902) (-317.085) (-321.397) [-319.289] -- 0:00:17
706500 -- (-315.907) [-317.269] (-317.023) (-315.862) * (-317.132) (-316.669) (-319.765) [-317.021] -- 0:00:17
707000 -- (-319.784) (-316.814) (-319.910) [-316.985] * (-318.517) (-317.140) (-321.224) [-319.955] -- 0:00:17
707500 -- (-316.022) [-316.502] (-319.955) (-315.776) * (-316.175) (-317.693) [-315.212] (-320.831) -- 0:00:17
708000 -- (-317.744) (-320.558) [-316.134] (-316.537) * (-319.340) (-315.968) [-315.608] (-318.341) -- 0:00:17
708500 -- (-317.133) (-316.713) [-316.830] (-315.166) * (-317.820) [-317.074] (-315.843) (-315.711) -- 0:00:17
709000 -- (-316.905) (-316.875) (-317.136) [-317.997] * (-318.217) (-317.196) (-315.208) [-316.355] -- 0:00:17
709500 -- (-317.050) (-319.489) [-317.916] (-318.076) * [-316.627] (-318.351) (-317.441) (-317.157) -- 0:00:17
710000 -- [-324.368] (-318.698) (-317.455) (-318.249) * (-318.531) (-316.975) (-317.191) [-317.137] -- 0:00:17
Average standard deviation of split frequencies: 0.009452
710500 -- (-319.283) (-315.149) [-320.652] (-317.544) * (-320.172) [-317.528] (-315.461) (-321.037) -- 0:00:17
711000 -- (-318.473) (-315.563) [-315.452] (-317.916) * (-316.689) (-317.001) (-316.301) [-316.550] -- 0:00:17
711500 -- (-319.921) [-315.995] (-316.504) (-316.072) * (-317.874) [-316.187] (-317.805) (-316.531) -- 0:00:17
712000 -- (-317.439) (-315.785) [-315.386] (-316.971) * (-316.456) (-323.370) [-316.613] (-320.087) -- 0:00:16
712500 -- [-315.506] (-319.546) (-316.274) (-317.963) * (-316.759) (-315.804) [-316.639] (-318.384) -- 0:00:16
713000 -- (-315.339) (-319.486) [-315.892] (-316.873) * (-319.656) (-315.533) [-316.020] (-316.256) -- 0:00:16
713500 -- (-318.335) [-317.466] (-316.925) (-319.689) * (-318.424) [-315.283] (-319.224) (-317.078) -- 0:00:16
714000 -- (-317.244) (-320.558) (-315.938) [-315.862] * [-317.326] (-316.113) (-317.200) (-316.199) -- 0:00:16
714500 -- [-316.540] (-320.049) (-316.093) (-316.921) * (-319.445) [-319.443] (-319.561) (-318.808) -- 0:00:16
715000 -- [-316.527] (-318.156) (-317.460) (-321.214) * [-316.321] (-317.269) (-316.936) (-315.779) -- 0:00:16
Average standard deviation of split frequencies: 0.009835
715500 -- [-317.119] (-319.312) (-315.893) (-320.873) * (-317.058) (-316.998) (-321.069) [-316.166] -- 0:00:16
716000 -- [-318.550] (-317.707) (-322.926) (-316.776) * (-317.380) [-315.774] (-320.262) (-315.631) -- 0:00:16
716500 -- [-316.582] (-318.782) (-317.814) (-317.581) * [-315.137] (-315.961) (-319.787) (-318.116) -- 0:00:16
717000 -- [-317.375] (-323.814) (-317.280) (-316.602) * (-318.089) (-318.524) [-318.340] (-319.949) -- 0:00:16
717500 -- (-321.192) (-320.372) (-322.938) [-317.487] * (-317.438) (-315.765) (-318.305) [-320.015] -- 0:00:16
718000 -- [-318.044] (-321.627) (-317.910) (-316.610) * (-319.123) (-316.358) (-320.011) [-318.029] -- 0:00:16
718500 -- (-317.308) (-320.507) (-320.592) [-317.075] * (-319.876) (-315.473) (-319.185) [-320.507] -- 0:00:16
719000 -- (-321.297) (-320.194) [-318.184] (-315.757) * (-317.249) (-317.163) (-316.408) [-317.594] -- 0:00:16
719500 -- (-317.056) [-315.543] (-318.696) (-315.908) * [-315.358] (-318.599) (-318.480) (-318.166) -- 0:00:16
720000 -- [-317.820] (-315.897) (-317.866) (-317.559) * (-317.180) (-316.975) [-316.386] (-321.095) -- 0:00:16
Average standard deviation of split frequencies: 0.009853
720500 -- (-317.286) (-316.641) [-320.076] (-316.824) * (-316.435) [-315.930] (-316.008) (-318.676) -- 0:00:16
721000 -- [-315.666] (-315.982) (-317.068) (-316.481) * (-319.248) [-315.170] (-317.295) (-317.165) -- 0:00:16
721500 -- (-316.623) (-316.261) [-321.317] (-317.873) * [-316.863] (-316.903) (-317.229) (-318.310) -- 0:00:16
722000 -- [-316.023] (-321.030) (-319.521) (-316.300) * (-316.749) (-319.240) (-317.851) [-318.223] -- 0:00:16
722500 -- (-319.068) (-325.214) [-315.782] (-315.841) * (-316.775) (-316.922) [-315.146] (-315.810) -- 0:00:16
723000 -- (-318.279) [-318.890] (-321.159) (-315.742) * (-315.492) (-318.173) [-316.506] (-316.047) -- 0:00:16
723500 -- [-316.948] (-317.751) (-323.053) (-317.128) * [-320.852] (-316.069) (-316.659) (-318.133) -- 0:00:16
724000 -- (-318.333) (-315.988) [-320.391] (-317.859) * (-318.315) (-317.873) [-316.079] (-315.319) -- 0:00:16
724500 -- (-317.225) (-319.500) [-315.280] (-319.407) * (-315.520) (-316.522) (-316.045) [-319.670] -- 0:00:16
725000 -- [-318.057] (-317.363) (-317.820) (-319.383) * (-316.550) [-315.856] (-319.291) (-316.984) -- 0:00:16
Average standard deviation of split frequencies: 0.009293
725500 -- [-315.797] (-317.241) (-317.110) (-317.101) * (-318.172) (-318.966) (-324.940) [-316.368] -- 0:00:16
726000 -- (-317.185) (-318.058) (-321.191) [-316.797] * (-316.946) (-317.937) (-315.617) [-316.942] -- 0:00:16
726500 -- (-317.180) [-316.473] (-316.762) (-315.869) * [-316.598] (-316.003) (-317.110) (-317.888) -- 0:00:16
727000 -- (-317.184) [-315.395] (-319.083) (-322.492) * [-317.122] (-318.071) (-317.961) (-317.762) -- 0:00:16
727500 -- (-321.870) (-315.911) [-316.112] (-320.541) * (-317.538) [-318.281] (-315.877) (-316.375) -- 0:00:16
728000 -- [-317.931] (-315.942) (-320.642) (-317.144) * (-316.554) (-317.588) (-317.873) [-316.106] -- 0:00:16
728500 -- (-321.381) (-316.836) (-315.592) [-317.107] * [-317.019] (-321.168) (-316.735) (-317.154) -- 0:00:16
729000 -- (-318.516) (-316.962) [-317.834] (-320.725) * [-317.274] (-321.688) (-316.137) (-316.361) -- 0:00:15
729500 -- (-317.412) (-315.847) (-318.236) [-320.361] * [-317.339] (-318.512) (-316.375) (-316.807) -- 0:00:15
730000 -- [-316.455] (-323.053) (-318.697) (-318.331) * (-318.112) (-317.769) (-319.198) [-315.798] -- 0:00:15
Average standard deviation of split frequencies: 0.009234
730500 -- [-315.766] (-317.929) (-319.862) (-316.974) * [-316.962] (-317.603) (-316.262) (-316.176) -- 0:00:15
731000 -- [-318.031] (-316.961) (-316.289) (-316.576) * (-316.871) (-315.889) (-315.713) [-320.076] -- 0:00:15
731500 -- (-316.707) [-317.781] (-317.837) (-320.411) * (-318.125) [-320.039] (-318.630) (-318.926) -- 0:00:15
732000 -- (-316.606) (-318.395) [-317.248] (-315.830) * (-318.214) (-319.356) [-318.450] (-320.014) -- 0:00:15
732500 -- (-318.868) [-315.585] (-316.786) (-317.330) * (-319.711) (-315.931) [-316.585] (-320.953) -- 0:00:15
733000 -- (-318.932) [-321.294] (-318.521) (-317.176) * (-316.219) [-316.468] (-315.534) (-319.785) -- 0:00:15
733500 -- (-316.783) [-319.766] (-321.185) (-316.248) * [-316.293] (-318.150) (-318.847) (-317.550) -- 0:00:15
734000 -- (-321.360) [-317.023] (-319.626) (-317.816) * [-318.565] (-317.560) (-325.345) (-317.881) -- 0:00:15
734500 -- (-321.446) (-316.857) [-318.080] (-323.718) * [-318.360] (-317.249) (-317.558) (-315.279) -- 0:00:15
735000 -- (-320.566) (-320.063) [-315.449] (-315.892) * (-320.728) (-317.127) [-316.934] (-318.629) -- 0:00:15
Average standard deviation of split frequencies: 0.009087
735500 -- (-316.825) [-316.107] (-318.544) (-316.958) * (-315.834) (-318.137) (-316.940) [-317.318] -- 0:00:15
736000 -- (-316.135) (-317.916) [-316.865] (-318.199) * (-315.981) [-318.768] (-316.351) (-317.011) -- 0:00:15
736500 -- (-318.254) (-319.253) (-318.561) [-316.383] * (-316.177) (-316.275) (-319.152) [-317.562] -- 0:00:15
737000 -- (-317.035) (-324.327) (-315.965) [-317.185] * [-316.321] (-316.189) (-319.011) (-317.453) -- 0:00:15
737500 -- (-319.990) (-320.006) (-319.279) [-317.274] * (-316.362) (-319.107) (-321.781) [-316.912] -- 0:00:15
738000 -- (-318.737) [-316.473] (-319.165) (-317.961) * (-321.352) (-318.356) (-317.135) [-316.079] -- 0:00:15
738500 -- (-315.805) (-316.274) [-316.294] (-317.854) * (-318.820) [-319.235] (-319.357) (-320.371) -- 0:00:15
739000 -- (-316.303) (-318.414) [-318.316] (-317.640) * (-322.440) [-315.722] (-324.058) (-316.371) -- 0:00:15
739500 -- (-318.058) (-316.505) (-316.777) [-317.022] * [-315.431] (-319.264) (-324.902) (-317.420) -- 0:00:15
740000 -- (-316.980) [-316.721] (-318.460) (-317.962) * (-317.883) (-319.025) (-323.213) [-324.035] -- 0:00:15
Average standard deviation of split frequencies: 0.008632
740500 -- (-322.288) [-319.736] (-319.382) (-317.974) * (-320.463) (-321.702) [-317.911] (-318.771) -- 0:00:15
741000 -- (-318.602) (-321.289) (-318.200) [-318.426] * [-319.631] (-317.000) (-316.264) (-315.435) -- 0:00:15
741500 -- (-318.929) (-328.430) [-316.022] (-318.531) * [-316.066] (-316.745) (-317.684) (-315.551) -- 0:00:15
742000 -- (-321.950) (-327.656) [-316.034] (-317.999) * (-317.198) (-318.337) (-317.257) [-315.339] -- 0:00:15
742500 -- [-323.011] (-320.636) (-315.347) (-319.182) * (-317.662) [-317.723] (-318.571) (-315.551) -- 0:00:15
743000 -- (-320.896) (-319.628) (-314.949) [-316.335] * (-318.587) (-316.276) [-317.163] (-316.814) -- 0:00:15
743500 -- [-315.768] (-317.210) (-317.075) (-315.623) * (-318.000) (-317.056) [-316.782] (-318.987) -- 0:00:15
744000 -- (-319.463) (-315.586) (-321.843) [-315.315] * [-316.088] (-316.945) (-316.858) (-315.451) -- 0:00:15
744500 -- (-323.978) (-315.007) (-322.051) [-316.264] * (-317.323) (-317.063) (-315.724) [-316.973] -- 0:00:15
745000 -- [-320.358] (-316.917) (-316.985) (-315.981) * (-320.444) (-318.038) [-315.530] (-318.051) -- 0:00:15
Average standard deviation of split frequencies: 0.008689
745500 -- (-317.435) [-317.365] (-320.254) (-316.460) * [-315.696] (-318.370) (-315.677) (-319.842) -- 0:00:15
746000 -- (-318.201) [-317.378] (-319.177) (-316.547) * [-318.466] (-318.682) (-315.876) (-320.168) -- 0:00:14
746500 -- (-317.243) (-320.717) (-318.386) [-315.699] * (-319.245) [-315.948] (-318.248) (-316.875) -- 0:00:14
747000 -- (-315.892) [-322.222] (-317.685) (-317.196) * [-317.527] (-317.139) (-316.367) (-319.679) -- 0:00:14
747500 -- (-319.055) (-318.116) [-315.614] (-316.247) * (-317.693) (-316.293) (-319.023) [-316.106] -- 0:00:14
748000 -- (-316.564) (-318.014) (-319.195) [-316.485] * (-323.622) (-316.366) (-317.249) [-318.168] -- 0:00:14
748500 -- [-317.840] (-319.438) (-322.509) (-315.718) * [-319.159] (-319.454) (-315.156) (-318.246) -- 0:00:14
749000 -- (-315.957) (-316.481) (-317.245) [-317.441] * [-322.985] (-319.251) (-317.958) (-318.258) -- 0:00:14
749500 -- (-316.053) [-316.494] (-316.189) (-316.309) * [-317.689] (-316.979) (-315.596) (-317.278) -- 0:00:14
750000 -- (-316.207) (-316.802) [-318.281] (-319.266) * (-318.515) (-317.506) [-316.291] (-316.521) -- 0:00:14
Average standard deviation of split frequencies: 0.008164
750500 -- (-316.328) [-319.179] (-318.676) (-321.014) * (-318.241) (-316.500) (-316.262) [-316.626] -- 0:00:14
751000 -- [-316.251] (-316.969) (-319.117) (-318.992) * (-316.692) (-316.402) (-320.450) [-316.673] -- 0:00:14
751500 -- (-318.697) (-317.594) [-321.293] (-316.628) * (-317.973) [-321.258] (-318.445) (-316.158) -- 0:00:14
752000 -- (-316.370) (-318.979) [-320.362] (-317.930) * [-319.782] (-319.864) (-317.300) (-316.471) -- 0:00:14
752500 -- (-317.498) (-319.740) [-316.294] (-316.166) * (-318.198) (-321.960) (-319.018) [-318.108] -- 0:00:14
753000 -- (-321.389) (-318.048) [-317.881] (-318.517) * [-320.152] (-320.163) (-318.240) (-316.242) -- 0:00:14
753500 -- (-319.027) [-317.157] (-316.368) (-316.917) * [-317.836] (-319.211) (-318.672) (-315.862) -- 0:00:14
754000 -- (-316.312) (-321.023) (-318.339) [-316.121] * (-317.161) (-317.403) [-318.376] (-320.859) -- 0:00:14
754500 -- (-320.127) (-316.770) (-316.653) [-322.784] * (-318.303) (-317.656) [-316.602] (-316.496) -- 0:00:14
755000 -- (-321.936) (-317.330) (-316.209) [-316.698] * [-317.092] (-316.431) (-316.159) (-316.351) -- 0:00:14
Average standard deviation of split frequencies: 0.008067
755500 -- (-316.748) (-316.941) (-319.774) [-317.120] * (-317.881) (-317.619) [-316.857] (-316.072) -- 0:00:14
756000 -- (-321.585) (-316.652) (-316.451) [-317.252] * (-319.043) (-317.491) (-316.763) [-316.955] -- 0:00:14
756500 -- (-319.300) (-317.034) [-316.262] (-315.998) * [-316.788] (-317.059) (-315.790) (-318.861) -- 0:00:14
757000 -- (-326.139) (-315.826) [-317.711] (-318.242) * [-317.982] (-316.349) (-316.760) (-319.202) -- 0:00:14
757500 -- [-318.427] (-322.104) (-318.421) (-318.286) * (-315.933) [-318.535] (-316.090) (-317.808) -- 0:00:14
758000 -- [-317.555] (-316.348) (-322.121) (-315.483) * [-318.164] (-321.898) (-317.068) (-318.084) -- 0:00:14
758500 -- (-316.120) (-321.082) [-319.563] (-317.903) * [-317.789] (-318.756) (-316.231) (-319.144) -- 0:00:14
759000 -- (-317.285) (-317.307) [-316.042] (-315.947) * (-323.846) [-315.712] (-316.810) (-320.336) -- 0:00:14
759500 -- [-318.662] (-318.409) (-316.348) (-315.158) * (-315.804) (-317.430) [-318.605] (-319.311) -- 0:00:14
760000 -- (-320.365) [-318.825] (-318.719) (-319.381) * (-316.264) [-315.801] (-317.290) (-315.850) -- 0:00:14
Average standard deviation of split frequencies: 0.007630
760500 -- (-318.110) (-316.376) (-318.227) [-316.333] * [-319.979] (-316.844) (-317.149) (-317.025) -- 0:00:14
761000 -- [-320.489] (-318.987) (-316.759) (-317.005) * (-318.710) [-316.002] (-317.060) (-317.888) -- 0:00:14
761500 -- [-316.020] (-317.937) (-316.921) (-316.255) * (-318.585) (-316.250) [-315.768] (-317.546) -- 0:00:14
762000 -- (-315.933) (-316.245) (-317.830) [-317.103] * [-318.874] (-317.216) (-316.303) (-319.070) -- 0:00:14
762500 -- (-315.863) (-316.695) [-320.287] (-319.179) * [-315.614] (-317.014) (-316.327) (-315.571) -- 0:00:14
763000 -- (-316.028) (-321.520) (-318.658) [-319.467] * (-315.871) [-317.382] (-317.106) (-316.187) -- 0:00:13
763500 -- (-319.281) [-315.971] (-318.852) (-318.463) * [-316.456] (-317.493) (-316.436) (-320.469) -- 0:00:13
764000 -- [-316.936] (-317.508) (-317.788) (-317.046) * (-318.260) [-319.154] (-317.517) (-320.032) -- 0:00:13
764500 -- (-317.359) (-325.605) (-317.855) [-315.455] * [-318.990] (-315.723) (-317.246) (-320.660) -- 0:00:13
765000 -- (-317.365) (-316.414) (-316.057) [-316.197] * [-316.244] (-317.169) (-316.064) (-323.827) -- 0:00:13
Average standard deviation of split frequencies: 0.007577
765500 -- (-315.790) (-323.067) [-316.856] (-315.543) * (-315.663) (-318.115) (-315.590) [-318.747] -- 0:00:13
766000 -- [-317.649] (-318.508) (-317.744) (-316.512) * (-317.891) [-318.622] (-315.547) (-318.351) -- 0:00:13
766500 -- (-317.112) (-319.681) [-316.989] (-316.303) * [-316.979] (-320.141) (-316.119) (-321.216) -- 0:00:13
767000 -- (-318.350) (-317.249) (-317.817) [-316.695] * (-318.361) (-319.753) (-318.803) [-316.203] -- 0:00:13
767500 -- (-318.720) (-319.107) (-318.778) [-317.822] * [-315.776] (-321.538) (-316.927) (-317.141) -- 0:00:13
768000 -- [-317.825] (-322.118) (-319.174) (-317.093) * (-319.374) (-316.958) [-317.762] (-317.134) -- 0:00:13
768500 -- (-320.015) [-317.298] (-318.092) (-318.804) * (-315.674) (-315.976) (-316.638) [-316.379] -- 0:00:13
769000 -- (-318.647) (-319.829) [-316.786] (-315.411) * (-316.382) [-318.255] (-317.695) (-316.028) -- 0:00:13
769500 -- [-316.523] (-317.425) (-317.524) (-317.867) * (-317.194) (-318.894) (-316.702) [-318.978] -- 0:00:13
770000 -- [-318.314] (-320.947) (-316.807) (-318.517) * (-320.414) [-317.789] (-315.833) (-316.625) -- 0:00:13
Average standard deviation of split frequencies: 0.007226
770500 -- (-317.585) [-317.355] (-315.346) (-318.070) * (-317.172) (-319.158) (-316.997) [-317.088] -- 0:00:13
771000 -- (-316.950) (-315.237) [-315.100] (-317.568) * (-322.454) (-317.833) [-318.840] (-316.569) -- 0:00:13
771500 -- [-317.475] (-322.448) (-321.143) (-318.212) * [-315.442] (-318.739) (-316.072) (-325.855) -- 0:00:13
772000 -- [-316.781] (-318.916) (-319.014) (-316.430) * (-316.286) (-318.069) [-316.271] (-317.981) -- 0:00:13
772500 -- (-315.154) [-316.391] (-316.326) (-317.382) * (-316.001) (-324.275) (-316.830) [-322.324] -- 0:00:13
773000 -- (-316.555) (-316.681) [-315.250] (-317.383) * (-316.500) (-320.495) [-317.382] (-318.532) -- 0:00:13
773500 -- (-316.226) [-317.241] (-315.173) (-315.222) * (-320.353) [-318.706] (-317.329) (-317.178) -- 0:00:13
774000 -- [-316.800] (-317.211) (-316.290) (-315.546) * (-322.582) (-320.772) (-315.523) [-316.300] -- 0:00:13
774500 -- (-316.863) [-316.407] (-318.970) (-315.048) * (-315.816) (-317.168) [-315.635] (-324.660) -- 0:00:13
775000 -- (-315.241) [-315.955] (-318.985) (-316.442) * [-315.492] (-316.179) (-316.281) (-315.556) -- 0:00:13
Average standard deviation of split frequencies: 0.007783
775500 -- (-315.561) (-316.985) (-316.263) [-315.517] * [-315.996] (-316.604) (-315.284) (-316.677) -- 0:00:13
776000 -- [-317.998] (-317.190) (-315.489) (-316.141) * (-315.783) (-319.420) [-317.131] (-319.014) -- 0:00:13
776500 -- (-318.787) [-316.456] (-318.456) (-316.531) * (-319.264) (-317.198) (-317.077) [-319.133] -- 0:00:13
777000 -- [-316.301] (-317.253) (-317.810) (-316.341) * (-316.852) (-317.686) [-316.387] (-316.685) -- 0:00:13
777500 -- (-318.904) (-317.702) (-316.623) [-316.471] * (-317.559) (-319.246) (-316.790) [-318.892] -- 0:00:13
778000 -- (-316.576) (-317.341) (-319.260) [-316.042] * (-319.721) [-317.588] (-316.972) (-317.234) -- 0:00:13
778500 -- (-315.291) (-315.368) [-320.999] (-318.207) * (-320.811) (-317.762) [-316.766] (-319.218) -- 0:00:13
779000 -- [-315.758] (-315.584) (-317.559) (-320.950) * (-317.854) (-318.735) (-316.846) [-317.926] -- 0:00:13
779500 -- [-316.961] (-317.547) (-315.135) (-320.249) * [-316.493] (-315.684) (-317.006) (-316.578) -- 0:00:13
780000 -- (-317.250) [-319.694] (-315.296) (-318.604) * [-315.582] (-317.256) (-316.955) (-316.091) -- 0:00:12
Average standard deviation of split frequencies: 0.007850
780500 -- (-319.004) (-318.638) [-317.111] (-316.430) * (-316.668) (-318.074) [-318.812] (-316.830) -- 0:00:12
781000 -- (-316.802) [-316.028] (-320.802) (-318.012) * (-316.342) (-317.726) [-317.031] (-315.253) -- 0:00:12
781500 -- (-317.179) [-321.711] (-320.237) (-318.669) * [-317.893] (-316.671) (-317.887) (-317.072) -- 0:00:12
782000 -- [-315.056] (-318.021) (-316.650) (-318.217) * (-316.099) (-316.172) (-316.445) [-316.737] -- 0:00:12
782500 -- (-318.107) (-317.982) [-316.462] (-319.218) * [-316.695] (-317.112) (-318.257) (-325.592) -- 0:00:12
783000 -- (-315.483) (-319.048) (-316.225) [-316.719] * (-316.330) (-320.804) (-316.853) [-316.035] -- 0:00:12
783500 -- (-315.686) (-315.353) (-317.854) [-319.453] * [-316.707] (-319.820) (-318.773) (-319.109) -- 0:00:12
784000 -- (-315.936) (-318.745) [-317.210] (-318.017) * [-316.612] (-318.671) (-317.288) (-316.288) -- 0:00:12
784500 -- [-316.431] (-315.229) (-318.549) (-317.865) * (-315.690) (-317.222) [-316.994] (-317.457) -- 0:00:12
785000 -- (-316.849) (-320.101) [-316.826] (-316.862) * [-316.632] (-317.237) (-316.060) (-316.735) -- 0:00:12
Average standard deviation of split frequencies: 0.008397
785500 -- (-319.110) (-317.452) [-315.786] (-317.992) * (-316.519) (-319.763) [-315.441] (-318.954) -- 0:00:12
786000 -- (-318.031) (-317.524) [-317.002] (-320.171) * (-317.634) (-319.727) [-317.452] (-317.518) -- 0:00:12
786500 -- (-315.876) (-317.595) [-317.802] (-316.796) * (-322.336) [-316.708] (-317.200) (-318.087) -- 0:00:12
787000 -- [-316.529] (-317.280) (-317.802) (-317.599) * (-316.925) (-315.532) [-317.932] (-316.164) -- 0:00:12
787500 -- (-317.110) [-315.719] (-316.623) (-316.365) * (-318.025) (-317.280) [-318.675] (-316.212) -- 0:00:12
788000 -- [-315.820] (-315.741) (-316.798) (-316.934) * (-317.471) (-315.794) [-318.488] (-318.505) -- 0:00:12
788500 -- (-316.171) [-315.174] (-317.482) (-317.034) * (-317.248) (-317.932) (-316.490) [-316.691] -- 0:00:12
789000 -- (-318.956) (-321.982) (-317.417) [-319.828] * (-316.308) (-317.791) (-316.987) [-319.275] -- 0:00:12
789500 -- (-319.438) [-318.490] (-318.237) (-316.561) * [-317.761] (-315.598) (-316.500) (-318.190) -- 0:00:12
790000 -- (-316.415) [-315.904] (-320.965) (-316.638) * (-316.629) (-315.439) (-315.713) [-317.607] -- 0:00:12
Average standard deviation of split frequencies: 0.008384
790500 -- (-317.776) (-315.587) (-316.406) [-317.732] * (-319.006) (-317.178) (-316.382) [-319.795] -- 0:00:12
791000 -- (-315.910) [-315.850] (-320.111) (-316.317) * (-323.730) [-317.085] (-316.319) (-317.343) -- 0:00:12
791500 -- (-317.480) (-316.550) (-322.775) [-317.528] * (-317.096) (-317.672) (-316.045) [-318.019] -- 0:00:12
792000 -- [-318.445] (-316.301) (-315.797) (-318.997) * (-318.553) (-318.614) (-316.687) [-318.596] -- 0:00:12
792500 -- (-320.708) (-316.109) (-316.359) [-317.563] * (-318.770) [-322.484] (-319.788) (-316.364) -- 0:00:12
793000 -- (-315.973) [-317.175] (-318.671) (-322.953) * (-315.812) (-319.247) [-319.018] (-319.019) -- 0:00:12
793500 -- [-315.695] (-315.627) (-316.110) (-316.081) * (-320.973) (-316.401) [-317.876] (-316.866) -- 0:00:12
794000 -- [-317.269] (-317.154) (-317.203) (-318.230) * (-320.120) (-322.221) [-323.329] (-319.994) -- 0:00:12
794500 -- (-316.453) [-316.846] (-315.580) (-314.888) * (-319.054) (-316.101) [-315.638] (-321.037) -- 0:00:12
795000 -- (-316.187) (-317.936) (-318.775) [-315.899] * (-319.103) (-321.458) [-317.045] (-318.895) -- 0:00:12
Average standard deviation of split frequencies: 0.008365
795500 -- (-320.030) [-318.944] (-318.696) (-316.828) * (-319.381) [-319.756] (-317.818) (-315.679) -- 0:00:12
796000 -- [-315.765] (-319.592) (-318.746) (-317.261) * (-320.156) (-319.654) (-317.193) [-315.670] -- 0:00:12
796500 -- (-317.785) [-318.562] (-319.196) (-317.788) * (-319.711) [-316.349] (-319.730) (-317.653) -- 0:00:12
797000 -- [-317.779] (-320.933) (-317.898) (-319.438) * [-315.364] (-319.825) (-316.592) (-316.969) -- 0:00:11
797500 -- (-318.534) (-321.437) [-316.289] (-319.510) * [-314.975] (-316.805) (-317.703) (-318.730) -- 0:00:11
798000 -- (-316.907) (-319.056) [-316.833] (-318.516) * (-316.740) (-316.634) [-315.366] (-316.812) -- 0:00:11
798500 -- (-315.728) (-323.171) (-317.950) [-319.639] * (-317.764) [-317.245] (-318.233) (-316.937) -- 0:00:11
799000 -- (-318.051) [-317.646] (-315.993) (-319.797) * (-318.248) (-315.283) (-320.540) [-318.437] -- 0:00:11
799500 -- [-317.988] (-319.549) (-317.134) (-319.488) * (-316.424) [-316.699] (-318.901) (-317.463) -- 0:00:11
800000 -- (-317.807) [-321.217] (-317.519) (-315.699) * (-315.803) (-316.198) [-316.762] (-317.435) -- 0:00:11
Average standard deviation of split frequencies: 0.008353
800500 -- [-317.735] (-318.894) (-321.143) (-322.482) * [-317.938] (-318.540) (-319.357) (-316.795) -- 0:00:11
801000 -- [-315.639] (-319.174) (-316.306) (-316.926) * [-318.121] (-316.656) (-320.704) (-315.191) -- 0:00:11
801500 -- [-316.481] (-315.022) (-320.430) (-315.020) * (-316.352) (-316.547) [-315.568] (-317.335) -- 0:00:11
802000 -- (-316.373) (-316.419) [-319.388] (-316.265) * [-319.584] (-320.022) (-315.808) (-318.788) -- 0:00:11
802500 -- (-319.241) (-318.143) (-316.803) [-315.937] * (-318.514) (-315.973) [-317.378] (-315.894) -- 0:00:11
803000 -- (-318.721) (-315.906) [-318.869] (-319.636) * [-315.470] (-316.676) (-316.768) (-315.759) -- 0:00:11
803500 -- [-317.276] (-318.721) (-318.250) (-318.805) * (-317.326) [-317.199] (-318.200) (-318.229) -- 0:00:11
804000 -- (-318.469) (-316.617) (-321.073) [-316.174] * (-316.845) (-321.103) (-321.132) [-317.332] -- 0:00:11
804500 -- (-317.141) [-316.656] (-319.976) (-318.311) * (-319.399) (-318.561) [-317.771] (-315.353) -- 0:00:11
805000 -- (-316.087) (-316.582) (-316.253) [-316.305] * (-316.832) (-320.683) [-317.615] (-316.719) -- 0:00:11
Average standard deviation of split frequencies: 0.008444
805500 -- [-317.393] (-317.577) (-315.929) (-320.850) * (-316.126) (-316.312) [-317.744] (-317.150) -- 0:00:11
806000 -- [-320.242] (-318.458) (-320.656) (-318.644) * (-319.964) (-316.875) [-316.942] (-316.298) -- 0:00:11
806500 -- (-315.376) (-320.386) (-317.326) [-316.038] * (-320.751) [-317.536] (-317.929) (-316.609) -- 0:00:11
807000 -- (-317.574) (-318.094) [-316.771] (-320.112) * (-316.320) (-319.525) [-316.476] (-316.270) -- 0:00:11
807500 -- (-320.551) [-318.249] (-319.612) (-315.954) * (-319.107) [-316.045] (-318.838) (-322.448) -- 0:00:11
808000 -- (-317.722) (-318.183) (-319.202) [-319.180] * (-317.667) [-316.452] (-317.164) (-317.381) -- 0:00:11
808500 -- (-317.148) [-316.293] (-317.669) (-317.376) * (-320.133) (-317.464) (-316.200) [-314.959] -- 0:00:11
809000 -- (-316.439) [-321.679] (-316.617) (-318.056) * (-315.673) [-317.914] (-317.666) (-316.233) -- 0:00:11
809500 -- (-315.461) (-318.797) [-318.879] (-317.329) * [-316.905] (-316.773) (-318.931) (-316.696) -- 0:00:11
810000 -- [-316.945] (-317.329) (-315.755) (-316.152) * (-316.475) (-316.914) [-322.835] (-315.986) -- 0:00:11
Average standard deviation of split frequencies: 0.008468
810500 -- (-318.132) [-318.091] (-318.798) (-316.761) * (-316.850) (-318.761) [-321.108] (-319.302) -- 0:00:11
811000 -- (-315.886) (-317.091) (-318.831) [-318.306] * (-318.199) (-316.673) [-318.709] (-319.329) -- 0:00:11
811500 -- (-317.257) [-318.403] (-315.965) (-316.740) * [-316.272] (-316.733) (-317.515) (-316.436) -- 0:00:11
812000 -- (-316.916) [-317.183] (-316.433) (-317.626) * [-316.012] (-316.994) (-324.855) (-317.991) -- 0:00:11
812500 -- (-315.444) (-315.185) (-315.184) [-316.704] * [-317.361] (-317.865) (-317.324) (-316.127) -- 0:00:11
813000 -- [-316.036] (-321.154) (-316.042) (-323.132) * (-316.356) [-318.454] (-317.815) (-318.107) -- 0:00:11
813500 -- [-315.336] (-316.954) (-318.761) (-316.596) * [-318.866] (-316.364) (-316.880) (-315.945) -- 0:00:11
814000 -- [-315.918] (-317.514) (-319.581) (-317.511) * (-316.359) (-317.360) (-318.271) [-316.070] -- 0:00:10
814500 -- (-316.032) [-318.026] (-321.102) (-315.537) * (-316.815) [-317.739] (-316.738) (-316.175) -- 0:00:10
815000 -- (-319.150) (-318.231) (-316.560) [-315.378] * (-317.450) (-315.932) (-315.389) [-318.777] -- 0:00:10
Average standard deviation of split frequencies: 0.008954
815500 -- [-315.816] (-320.778) (-319.013) (-315.634) * [-317.517] (-321.291) (-318.275) (-317.630) -- 0:00:10
816000 -- (-318.962) (-317.123) [-315.905] (-319.329) * (-318.890) (-319.856) [-320.061] (-317.910) -- 0:00:10
816500 -- (-317.010) (-316.731) (-320.620) [-320.611] * (-317.972) (-322.150) [-315.576] (-320.147) -- 0:00:10
817000 -- (-318.467) (-317.844) (-318.698) [-319.320] * [-317.713] (-318.813) (-317.387) (-319.967) -- 0:00:10
817500 -- [-322.566] (-323.601) (-317.008) (-315.788) * (-317.166) (-320.376) (-316.596) [-318.667] -- 0:00:10
818000 -- (-317.608) (-318.275) (-316.217) [-316.812] * (-319.468) [-319.370] (-317.686) (-320.279) -- 0:00:10
818500 -- (-321.925) (-317.227) [-316.275] (-317.935) * [-317.028] (-318.235) (-316.837) (-316.367) -- 0:00:10
819000 -- (-316.410) [-319.705] (-321.065) (-316.789) * (-317.832) [-319.893] (-319.260) (-316.208) -- 0:00:10
819500 -- [-318.842] (-316.116) (-321.411) (-319.862) * (-315.537) (-318.474) (-318.718) [-317.439] -- 0:00:10
820000 -- (-320.420) [-315.613] (-318.898) (-315.986) * (-315.645) [-316.616] (-319.705) (-315.421) -- 0:00:10
Average standard deviation of split frequencies: 0.009262
820500 -- (-318.522) [-317.622] (-319.253) (-318.351) * (-316.106) [-316.440] (-318.169) (-317.258) -- 0:00:10
821000 -- (-318.384) (-322.085) [-318.563] (-317.827) * (-315.983) (-317.104) (-315.749) [-315.358] -- 0:00:10
821500 -- (-316.788) (-317.952) (-315.430) [-318.934] * [-315.142] (-318.190) (-321.047) (-317.725) -- 0:00:10
822000 -- [-316.631] (-316.443) (-316.030) (-315.053) * (-316.362) [-317.092] (-318.723) (-317.936) -- 0:00:10
822500 -- [-316.894] (-317.370) (-317.058) (-318.508) * (-319.741) (-316.462) (-317.517) [-317.733] -- 0:00:10
823000 -- [-316.917] (-317.591) (-317.018) (-319.927) * (-319.712) (-318.968) (-318.844) [-318.077] -- 0:00:10
823500 -- (-317.838) (-317.859) (-316.475) [-317.048] * (-319.374) [-318.609] (-317.214) (-319.518) -- 0:00:10
824000 -- (-315.933) (-321.351) [-315.852] (-319.651) * [-318.209] (-317.685) (-317.245) (-322.603) -- 0:00:10
824500 -- (-319.520) (-316.207) [-315.646] (-319.678) * (-318.351) [-315.629] (-317.802) (-317.558) -- 0:00:10
825000 -- [-316.998] (-315.953) (-317.227) (-318.567) * [-317.274] (-315.658) (-320.405) (-315.810) -- 0:00:10
Average standard deviation of split frequencies: 0.009467
825500 -- (-319.055) (-315.878) [-317.065] (-317.363) * (-315.953) (-316.885) [-317.348] (-318.055) -- 0:00:10
826000 -- [-315.830] (-320.955) (-317.260) (-317.622) * (-315.281) (-316.077) [-315.676] (-317.840) -- 0:00:10
826500 -- (-316.492) [-316.162] (-316.213) (-317.325) * (-315.639) [-317.685] (-315.294) (-316.585) -- 0:00:10
827000 -- [-315.751] (-317.700) (-321.428) (-319.090) * (-318.136) [-317.899] (-316.560) (-317.535) -- 0:00:10
827500 -- (-317.880) (-316.822) (-317.950) [-315.147] * [-315.886] (-319.974) (-318.867) (-318.391) -- 0:00:10
828000 -- (-317.585) (-316.469) [-316.939] (-316.812) * (-316.154) (-316.814) (-318.342) [-316.959] -- 0:00:10
828500 -- [-317.049] (-321.054) (-316.735) (-319.692) * (-320.535) (-323.678) [-315.510] (-318.854) -- 0:00:10
829000 -- (-316.697) (-315.477) [-316.241] (-317.169) * (-320.741) (-318.544) [-315.410] (-315.602) -- 0:00:10
829500 -- (-316.301) [-316.802] (-318.906) (-318.541) * (-316.014) (-318.065) (-316.134) [-316.300] -- 0:00:10
830000 -- (-317.700) (-316.220) (-318.151) [-319.226] * (-317.473) (-319.608) [-315.505] (-316.372) -- 0:00:10
Average standard deviation of split frequencies: 0.009380
830500 -- (-317.727) (-317.856) [-315.669] (-318.352) * [-318.052] (-322.334) (-317.211) (-319.544) -- 0:00:10
831000 -- (-316.724) (-320.186) [-315.108] (-316.402) * [-316.048] (-317.443) (-316.021) (-318.552) -- 0:00:09
831500 -- (-317.378) (-316.873) (-317.727) [-319.432] * (-317.208) (-317.200) [-315.896] (-315.503) -- 0:00:09
832000 -- (-318.804) (-319.892) [-316.181] (-319.663) * (-315.682) [-316.974] (-316.414) (-317.952) -- 0:00:09
832500 -- (-318.736) (-317.502) [-316.831] (-316.616) * [-315.800] (-316.802) (-319.955) (-316.090) -- 0:00:09
833000 -- (-319.362) (-319.363) (-318.277) [-315.376] * [-315.840] (-317.916) (-315.482) (-320.825) -- 0:00:09
833500 -- (-322.923) (-323.186) [-315.892] (-318.146) * (-318.730) [-320.248] (-320.384) (-320.547) -- 0:00:09
834000 -- (-315.318) (-319.193) (-317.634) [-321.558] * (-320.402) [-317.248] (-315.947) (-317.792) -- 0:00:09
834500 -- (-315.959) (-321.394) (-318.437) [-319.800] * (-316.017) [-317.033] (-316.310) (-318.241) -- 0:00:09
835000 -- [-315.922] (-315.893) (-320.651) (-317.826) * (-316.774) (-317.937) [-318.830] (-319.139) -- 0:00:09
Average standard deviation of split frequencies: 0.009553
835500 -- (-317.572) (-317.985) (-318.169) [-316.249] * (-315.523) (-316.688) [-315.422] (-318.791) -- 0:00:09
836000 -- (-316.085) (-318.540) [-318.498] (-318.280) * (-320.286) (-317.750) (-318.018) [-318.976] -- 0:00:09
836500 -- (-319.656) (-318.747) (-316.314) [-321.405] * (-318.859) (-318.397) [-317.026] (-315.201) -- 0:00:09
837000 -- (-317.954) [-316.616] (-318.105) (-316.100) * [-318.884] (-317.096) (-316.538) (-315.305) -- 0:00:09
837500 -- (-316.808) (-316.385) [-316.064] (-315.518) * (-321.129) [-316.293] (-318.641) (-317.242) -- 0:00:09
838000 -- [-316.233] (-319.716) (-317.241) (-316.806) * (-321.052) (-315.052) [-321.050] (-321.441) -- 0:00:09
838500 -- (-319.297) (-320.894) [-315.872] (-317.036) * (-317.717) (-320.846) (-318.516) [-316.483] -- 0:00:09
839000 -- [-315.466] (-322.346) (-318.178) (-319.604) * (-315.870) (-316.271) [-318.615] (-316.817) -- 0:00:09
839500 -- (-317.614) (-316.893) [-316.902] (-318.736) * (-315.246) (-319.422) (-318.319) [-318.621] -- 0:00:09
840000 -- (-317.236) [-317.854] (-315.299) (-318.632) * (-315.571) (-319.061) (-319.869) [-316.944] -- 0:00:09
Average standard deviation of split frequencies: 0.009137
840500 -- [-316.443] (-317.143) (-315.710) (-316.786) * (-316.097) (-316.523) (-317.417) [-316.295] -- 0:00:09
841000 -- (-319.015) [-316.178] (-317.476) (-316.091) * (-315.697) (-320.099) [-319.391] (-315.418) -- 0:00:09
841500 -- (-323.933) (-319.327) (-316.391) [-315.972] * (-319.937) (-319.195) [-319.542] (-316.812) -- 0:00:09
842000 -- (-315.873) (-320.642) [-316.801] (-317.584) * (-316.486) [-316.489] (-320.868) (-317.215) -- 0:00:09
842500 -- (-319.389) [-316.299] (-315.811) (-316.705) * (-316.524) [-318.656] (-318.619) (-316.375) -- 0:00:09
843000 -- (-318.320) [-317.478] (-316.030) (-322.979) * (-318.873) (-317.580) [-316.740] (-315.434) -- 0:00:09
843500 -- (-317.784) (-316.888) [-316.652] (-319.917) * (-317.070) (-315.714) (-319.078) [-317.231] -- 0:00:09
844000 -- (-315.579) (-316.306) (-319.166) [-317.996] * (-315.949) [-315.474] (-319.028) (-320.600) -- 0:00:09
844500 -- (-317.222) (-318.796) [-317.035] (-316.586) * (-316.505) (-317.601) [-316.211] (-316.730) -- 0:00:09
845000 -- [-317.931] (-323.532) (-316.597) (-326.315) * (-316.674) (-320.068) (-317.382) [-321.777] -- 0:00:09
Average standard deviation of split frequencies: 0.008915
845500 -- (-317.377) (-326.617) (-315.914) [-318.249] * [-315.588] (-319.335) (-317.135) (-317.350) -- 0:00:09
846000 -- (-316.644) (-319.580) (-317.695) [-315.677] * [-315.584] (-316.851) (-317.794) (-320.793) -- 0:00:09
846500 -- (-317.263) [-316.101] (-316.771) (-315.492) * (-315.397) (-315.477) (-317.678) [-315.861] -- 0:00:09
847000 -- (-317.954) (-316.418) [-317.667] (-317.878) * (-315.292) [-316.259] (-317.224) (-317.362) -- 0:00:09
847500 -- (-316.893) (-323.183) (-322.038) [-316.504] * (-319.169) (-318.051) [-316.990] (-316.277) -- 0:00:08
848000 -- (-317.087) (-323.906) (-316.426) [-319.223] * [-315.390] (-317.065) (-316.223) (-317.586) -- 0:00:08
848500 -- (-316.178) [-319.942] (-315.037) (-316.346) * [-315.088] (-317.677) (-317.372) (-316.830) -- 0:00:08
849000 -- (-316.817) (-318.296) (-317.972) [-316.206] * (-317.487) (-317.813) (-318.699) [-319.277] -- 0:00:08
849500 -- (-316.959) (-319.095) (-319.671) [-316.249] * (-319.240) [-315.723] (-320.068) (-319.040) -- 0:00:08
850000 -- [-316.260] (-316.791) (-319.813) (-318.731) * (-318.328) (-316.091) (-316.156) [-316.784] -- 0:00:08
Average standard deviation of split frequencies: 0.008899
850500 -- (-318.748) (-319.878) [-315.718] (-318.486) * (-316.613) [-318.047] (-316.512) (-316.655) -- 0:00:08
851000 -- (-317.803) [-316.816] (-315.673) (-319.013) * (-318.280) (-316.572) [-315.323] (-318.261) -- 0:00:08
851500 -- [-318.713] (-318.041) (-316.426) (-315.848) * (-319.339) (-316.561) [-316.712] (-318.063) -- 0:00:08
852000 -- (-317.567) (-322.470) [-316.544] (-315.765) * (-317.804) (-316.486) [-318.486] (-317.606) -- 0:00:08
852500 -- [-316.910] (-319.222) (-315.648) (-320.324) * (-316.279) (-319.816) [-316.506] (-316.168) -- 0:00:08
853000 -- (-318.743) (-318.519) [-317.001] (-318.007) * (-318.549) (-319.772) (-315.820) [-315.900] -- 0:00:08
853500 -- [-315.992] (-318.343) (-320.847) (-324.519) * (-318.639) [-317.605] (-316.317) (-315.539) -- 0:00:08
854000 -- [-316.959] (-318.979) (-316.368) (-317.441) * (-319.174) (-317.426) (-317.648) [-315.062] -- 0:00:08
854500 -- (-317.005) [-315.793] (-317.527) (-317.176) * [-318.509] (-317.778) (-316.125) (-316.125) -- 0:00:08
855000 -- [-315.963] (-317.732) (-317.517) (-316.801) * [-315.309] (-315.523) (-317.083) (-316.938) -- 0:00:08
Average standard deviation of split frequencies: 0.009121
855500 -- (-315.611) (-318.579) (-319.562) [-315.331] * [-315.258] (-320.991) (-318.528) (-322.127) -- 0:00:08
856000 -- (-315.686) [-316.635] (-318.089) (-315.457) * [-315.223] (-316.602) (-321.511) (-318.240) -- 0:00:08
856500 -- (-317.138) (-322.807) (-315.719) [-317.444] * [-316.225] (-320.564) (-316.498) (-316.954) -- 0:00:08
857000 -- [-316.193] (-326.533) (-315.810) (-318.514) * (-318.164) [-315.946] (-318.920) (-317.924) -- 0:00:08
857500 -- (-316.291) (-316.844) [-315.762] (-317.253) * [-315.777] (-317.360) (-323.971) (-315.971) -- 0:00:08
858000 -- (-317.494) (-316.659) (-320.565) [-316.499] * [-317.323] (-318.463) (-322.730) (-320.348) -- 0:00:08
858500 -- (-316.731) [-315.930] (-319.205) (-317.562) * (-317.096) (-317.641) [-318.371] (-318.185) -- 0:00:08
859000 -- [-316.950] (-316.301) (-319.132) (-316.947) * [-316.548] (-321.107) (-319.602) (-316.627) -- 0:00:08
859500 -- [-316.590] (-317.502) (-316.212) (-318.949) * [-317.925] (-319.706) (-315.805) (-318.629) -- 0:00:08
860000 -- (-321.222) (-317.832) (-317.710) [-317.616] * [-317.553] (-315.693) (-318.384) (-317.015) -- 0:00:08
Average standard deviation of split frequencies: 0.009517
860500 -- (-317.838) (-316.095) (-317.012) [-315.813] * (-318.013) [-316.477] (-317.432) (-316.383) -- 0:00:08
861000 -- (-317.731) (-323.271) [-318.452] (-315.829) * (-316.519) (-316.730) (-316.636) [-318.898] -- 0:00:08
861500 -- (-322.147) (-315.625) (-324.875) [-317.743] * [-319.590] (-317.619) (-315.453) (-319.541) -- 0:00:08
862000 -- (-323.416) [-316.676] (-320.733) (-316.760) * (-315.713) (-315.597) (-319.331) [-316.979] -- 0:00:08
862500 -- (-318.128) [-318.676] (-319.723) (-317.858) * (-318.650) [-316.724] (-316.705) (-321.122) -- 0:00:08
863000 -- (-315.990) [-316.721] (-318.752) (-318.518) * (-318.928) (-316.428) [-318.635] (-316.106) -- 0:00:08
863500 -- [-317.781] (-317.170) (-319.732) (-316.962) * [-316.727] (-315.810) (-316.037) (-316.576) -- 0:00:08
864000 -- (-317.331) (-317.040) (-317.725) [-316.137] * (-318.032) (-316.262) [-315.272] (-316.613) -- 0:00:08
864500 -- (-315.767) (-316.433) (-317.343) [-315.493] * (-317.004) [-318.370] (-316.315) (-318.381) -- 0:00:07
865000 -- (-315.982) (-316.096) (-320.123) [-319.456] * (-318.816) [-316.201] (-317.271) (-318.072) -- 0:00:07
Average standard deviation of split frequencies: 0.009730
865500 -- (-316.467) (-316.320) (-317.367) [-321.250] * (-316.049) [-317.013] (-317.304) (-317.600) -- 0:00:07
866000 -- (-318.979) (-317.571) (-320.029) [-317.205] * (-322.233) [-315.965] (-318.519) (-317.400) -- 0:00:07
866500 -- [-318.436] (-317.557) (-319.321) (-315.938) * (-315.880) [-319.083] (-318.893) (-321.479) -- 0:00:07
867000 -- (-317.576) (-316.260) [-317.172] (-320.673) * [-315.455] (-322.319) (-318.408) (-319.724) -- 0:00:07
867500 -- (-319.249) (-318.357) [-315.877] (-320.613) * (-315.043) (-317.731) (-319.822) [-316.921] -- 0:00:07
868000 -- (-318.438) (-316.763) (-317.952) [-317.359] * (-315.479) [-321.316] (-318.134) (-315.928) -- 0:00:07
868500 -- [-317.187] (-317.029) (-317.148) (-319.611) * (-317.462) (-321.581) [-315.336] (-316.772) -- 0:00:07
869000 -- (-318.746) (-317.480) [-319.008] (-315.781) * (-316.247) (-316.677) (-320.677) [-316.130] -- 0:00:07
869500 -- (-318.601) [-317.291] (-316.738) (-318.141) * (-320.832) (-315.974) [-316.095] (-316.503) -- 0:00:07
870000 -- (-316.341) (-318.761) (-317.148) [-319.763] * (-319.782) (-317.302) (-315.886) [-315.859] -- 0:00:07
Average standard deviation of split frequencies: 0.009962
870500 -- (-316.563) [-316.747] (-316.942) (-317.386) * (-323.106) (-318.033) [-315.381] (-315.451) -- 0:00:07
871000 -- [-315.236] (-322.917) (-317.451) (-317.025) * (-318.880) [-316.086] (-317.730) (-318.341) -- 0:00:07
871500 -- [-318.080] (-321.738) (-317.500) (-320.507) * (-317.196) (-315.360) (-324.489) [-318.070] -- 0:00:07
872000 -- (-315.400) [-317.061] (-315.548) (-318.610) * (-318.854) (-318.721) (-318.074) [-316.887] -- 0:00:07
872500 -- (-316.737) [-316.571] (-317.735) (-317.286) * (-316.823) (-315.740) [-317.522] (-319.068) -- 0:00:07
873000 -- (-315.574) (-319.422) [-316.625] (-316.316) * (-318.466) (-318.062) [-317.469] (-317.796) -- 0:00:07
873500 -- [-316.052] (-319.208) (-321.377) (-323.685) * (-319.526) [-316.912] (-317.307) (-318.004) -- 0:00:07
874000 -- (-318.676) (-317.660) [-319.341] (-320.742) * (-315.527) (-317.827) [-318.656] (-315.762) -- 0:00:07
874500 -- [-315.394] (-317.762) (-317.046) (-319.743) * (-317.294) (-318.485) (-320.780) [-316.161] -- 0:00:07
875000 -- (-319.806) (-319.224) [-317.334] (-316.280) * (-316.027) [-317.138] (-315.948) (-316.226) -- 0:00:07
Average standard deviation of split frequencies: 0.009686
875500 -- (-315.971) [-316.557] (-318.510) (-318.746) * (-317.591) (-319.138) (-316.060) [-320.560] -- 0:00:07
876000 -- [-316.268] (-315.276) (-316.793) (-317.872) * (-316.507) [-318.252] (-320.185) (-315.867) -- 0:00:07
876500 -- (-321.803) (-318.276) [-316.476] (-317.271) * (-316.749) [-320.891] (-319.471) (-316.080) -- 0:00:07
877000 -- (-318.240) (-320.916) [-316.657] (-316.352) * [-316.391] (-319.567) (-317.777) (-317.841) -- 0:00:07
877500 -- (-317.055) (-318.958) [-316.813] (-316.384) * [-315.086] (-317.821) (-321.060) (-316.388) -- 0:00:07
878000 -- (-318.747) (-319.266) (-318.900) [-319.676] * [-315.721] (-316.905) (-317.905) (-316.222) -- 0:00:07
878500 -- (-316.580) (-316.171) (-318.508) [-317.793] * (-315.172) (-318.538) [-320.081] (-318.229) -- 0:00:07
879000 -- (-315.851) (-317.273) (-317.715) [-319.361] * (-315.522) (-317.065) (-315.628) [-315.286] -- 0:00:07
879500 -- (-317.056) (-316.032) (-315.643) [-316.481] * [-318.070] (-317.379) (-315.682) (-316.694) -- 0:00:07
880000 -- (-317.554) [-316.880] (-322.413) (-317.817) * (-320.349) (-318.419) (-321.417) [-316.959] -- 0:00:07
Average standard deviation of split frequencies: 0.009921
880500 -- (-320.403) [-318.319] (-316.849) (-315.961) * (-315.670) (-316.512) [-317.171] (-324.590) -- 0:00:07
881000 -- (-318.136) (-320.871) [-316.698] (-315.014) * (-324.033) [-318.402] (-316.428) (-317.613) -- 0:00:07
881500 -- (-319.027) [-316.083] (-318.215) (-314.997) * (-316.064) [-318.581] (-317.050) (-315.856) -- 0:00:06
882000 -- (-320.016) (-316.736) (-317.818) [-316.130] * (-318.119) [-316.851] (-319.210) (-316.522) -- 0:00:06
882500 -- [-322.107] (-315.496) (-319.413) (-315.744) * [-319.413] (-316.779) (-316.087) (-316.161) -- 0:00:06
883000 -- [-319.857] (-316.596) (-317.223) (-315.842) * [-318.134] (-317.812) (-319.172) (-315.752) -- 0:00:06
883500 -- (-320.388) (-316.854) [-315.989] (-317.653) * (-316.421) (-316.463) (-318.360) [-317.805] -- 0:00:06
884000 -- (-324.581) [-318.310] (-316.257) (-316.238) * [-315.247] (-317.660) (-319.587) (-319.010) -- 0:00:06
884500 -- [-318.961] (-316.995) (-317.359) (-315.243) * [-316.676] (-315.734) (-316.183) (-317.751) -- 0:00:06
885000 -- [-316.615] (-315.949) (-318.253) (-318.082) * (-315.597) (-319.655) (-317.273) [-321.628] -- 0:00:06
Average standard deviation of split frequencies: 0.010109
885500 -- (-317.459) (-322.020) [-318.806] (-315.939) * [-317.491] (-315.671) (-322.990) (-319.846) -- 0:00:06
886000 -- (-318.643) [-317.013] (-317.003) (-316.313) * (-316.328) (-317.863) (-319.456) [-316.036] -- 0:00:06
886500 -- (-319.555) [-316.210] (-320.898) (-318.763) * [-318.904] (-317.693) (-315.773) (-315.534) -- 0:00:06
887000 -- [-321.454] (-320.262) (-321.703) (-316.178) * (-318.387) (-317.664) (-315.931) [-317.196] -- 0:00:06
887500 -- (-316.776) (-319.597) (-317.946) [-316.970] * [-315.911] (-316.053) (-316.475) (-315.229) -- 0:00:06
888000 -- (-316.305) [-318.280] (-317.327) (-318.338) * (-316.681) (-321.735) [-319.471] (-315.559) -- 0:00:06
888500 -- [-317.720] (-317.694) (-318.089) (-317.609) * (-318.339) (-320.155) (-316.891) [-319.276] -- 0:00:06
889000 -- (-318.468) [-315.876] (-316.321) (-315.697) * (-319.432) (-317.408) (-322.156) [-316.015] -- 0:00:06
889500 -- (-316.983) (-320.478) [-317.725] (-316.642) * (-317.625) [-319.063] (-317.922) (-317.637) -- 0:00:06
890000 -- [-317.691] (-317.373) (-316.959) (-316.120) * (-317.563) (-317.329) (-316.908) [-316.335] -- 0:00:06
Average standard deviation of split frequencies: 0.009703
890500 -- [-317.813] (-316.486) (-315.678) (-317.259) * (-318.730) [-315.927] (-316.572) (-315.738) -- 0:00:06
891000 -- (-320.605) (-316.243) [-315.677] (-315.071) * [-317.865] (-318.309) (-316.757) (-322.688) -- 0:00:06
891500 -- (-316.666) (-315.834) (-317.571) [-317.335] * [-317.935] (-315.669) (-320.794) (-316.202) -- 0:00:06
892000 -- [-318.149] (-317.140) (-319.928) (-318.526) * (-316.494) (-316.602) [-315.657] (-317.350) -- 0:00:06
892500 -- (-316.009) (-317.036) (-317.518) [-317.829] * [-315.924] (-316.967) (-316.389) (-319.294) -- 0:00:06
893000 -- (-318.195) (-315.307) (-317.431) [-315.216] * [-315.375] (-315.955) (-317.573) (-315.693) -- 0:00:06
893500 -- (-318.746) (-316.779) (-317.236) [-316.290] * (-320.147) (-317.547) (-320.370) [-316.285] -- 0:00:06
894000 -- (-322.429) (-316.633) [-316.770] (-316.571) * (-328.701) [-317.725] (-318.340) (-319.343) -- 0:00:06
894500 -- (-321.575) [-318.838] (-320.688) (-317.797) * (-317.337) (-316.591) (-316.548) [-317.188] -- 0:00:06
895000 -- [-316.259] (-323.186) (-315.905) (-317.662) * (-317.674) [-316.569] (-316.796) (-315.806) -- 0:00:06
Average standard deviation of split frequencies: 0.009996
895500 -- (-316.021) [-319.277] (-317.497) (-316.685) * [-315.906] (-318.229) (-318.043) (-316.410) -- 0:00:06
896000 -- (-316.772) (-315.401) (-315.656) [-317.426] * [-315.488] (-318.267) (-316.963) (-316.375) -- 0:00:06
896500 -- [-317.033] (-318.147) (-316.702) (-316.986) * [-316.554] (-315.778) (-319.305) (-318.395) -- 0:00:06
897000 -- (-317.334) (-317.250) [-317.316] (-318.031) * (-319.559) (-317.854) [-316.833] (-315.268) -- 0:00:06
897500 -- (-317.095) [-315.778] (-318.946) (-319.062) * [-319.890] (-318.377) (-315.876) (-321.053) -- 0:00:06
898000 -- (-318.178) (-320.714) [-318.409] (-316.365) * (-318.145) [-317.922] (-316.564) (-316.359) -- 0:00:06
898500 -- (-315.954) [-318.471] (-316.304) (-319.683) * (-318.457) [-320.130] (-316.818) (-318.141) -- 0:00:05
899000 -- (-316.568) (-317.863) (-317.243) [-318.383] * (-319.157) (-315.717) [-317.954] (-317.591) -- 0:00:05
899500 -- (-318.290) (-317.510) (-316.445) [-317.890] * (-316.417) [-316.661] (-320.770) (-318.537) -- 0:00:05
900000 -- (-319.206) (-316.865) [-317.893] (-316.282) * (-318.695) (-319.345) (-317.284) [-315.419] -- 0:00:05
Average standard deviation of split frequencies: 0.010014
900500 -- (-316.838) (-316.535) [-318.775] (-315.800) * (-318.588) (-317.414) (-318.067) [-316.545] -- 0:00:05
901000 -- (-317.776) [-320.881] (-317.110) (-320.197) * [-317.340] (-319.358) (-317.860) (-317.612) -- 0:00:05
901500 -- (-315.366) (-318.961) [-317.727] (-319.416) * (-319.868) (-317.170) [-317.915] (-316.163) -- 0:00:05
902000 -- (-320.204) (-318.553) (-318.698) [-314.998] * (-316.452) (-318.141) (-317.144) [-317.416] -- 0:00:05
902500 -- (-317.659) (-320.269) (-315.886) [-316.969] * (-317.804) (-317.901) [-316.453] (-317.195) -- 0:00:05
903000 -- (-316.470) (-322.246) [-318.248] (-316.203) * (-316.466) (-319.744) (-315.094) [-316.175] -- 0:00:05
903500 -- (-316.283) [-317.006] (-321.525) (-318.487) * [-316.691] (-316.324) (-314.962) (-316.132) -- 0:00:05
904000 -- (-317.467) (-318.455) [-316.392] (-321.331) * [-318.334] (-316.952) (-318.032) (-321.505) -- 0:00:05
904500 -- (-316.749) (-317.604) [-317.762] (-318.669) * (-320.544) [-316.824] (-316.145) (-317.778) -- 0:00:05
905000 -- [-316.668] (-320.231) (-320.173) (-317.479) * (-315.389) [-316.174] (-316.521) (-317.326) -- 0:00:05
Average standard deviation of split frequencies: 0.010372
905500 -- (-317.026) [-318.197] (-316.349) (-320.403) * (-315.954) [-318.711] (-316.022) (-319.328) -- 0:00:05
906000 -- (-316.105) (-315.328) [-315.430] (-316.025) * (-315.254) [-316.278] (-315.485) (-317.359) -- 0:00:05
906500 -- [-317.659] (-320.231) (-316.611) (-319.175) * (-318.998) (-321.101) (-321.288) [-316.494] -- 0:00:05
907000 -- (-316.229) (-318.148) [-315.989] (-317.562) * (-320.302) (-320.679) (-316.665) [-317.825] -- 0:00:05
907500 -- (-317.027) [-316.798] (-322.484) (-316.604) * [-315.156] (-316.790) (-319.350) (-316.229) -- 0:00:05
908000 -- (-316.669) (-317.266) (-319.101) [-316.089] * (-321.107) (-316.825) [-321.158] (-316.421) -- 0:00:05
908500 -- (-318.449) [-316.455] (-317.178) (-318.954) * (-318.056) [-317.038] (-317.319) (-321.527) -- 0:00:05
909000 -- (-315.754) (-316.613) [-319.397] (-317.883) * [-320.921] (-318.082) (-318.197) (-316.257) -- 0:00:05
909500 -- (-316.113) (-315.348) [-316.403] (-322.930) * (-317.014) [-315.502] (-318.763) (-315.896) -- 0:00:05
910000 -- [-316.783] (-317.317) (-316.895) (-316.351) * (-318.550) (-317.411) [-316.080] (-317.021) -- 0:00:05
Average standard deviation of split frequencies: 0.010491
910500 -- (-316.217) (-317.231) (-319.343) [-317.984] * [-318.318] (-317.541) (-317.406) (-319.138) -- 0:00:05
911000 -- (-315.671) (-322.001) [-318.243] (-319.509) * (-317.251) [-321.049] (-317.243) (-321.560) -- 0:00:05
911500 -- (-316.324) (-315.093) (-316.555) [-315.217] * (-318.954) (-321.554) (-323.712) [-316.678] -- 0:00:05
912000 -- (-315.226) (-322.730) (-315.504) [-315.639] * (-316.287) (-318.074) [-319.083] (-317.834) -- 0:00:05
912500 -- [-315.730] (-323.488) (-317.068) (-318.513) * [-318.204] (-318.457) (-317.198) (-317.996) -- 0:00:05
913000 -- [-315.670] (-321.568) (-317.347) (-315.367) * (-317.266) [-317.211] (-316.094) (-317.096) -- 0:00:05
913500 -- (-317.484) (-318.866) [-316.468] (-318.876) * (-319.008) (-323.310) (-316.045) [-315.367] -- 0:00:05
914000 -- (-315.776) (-317.279) (-317.114) [-316.924] * (-320.172) (-316.315) (-317.085) [-316.520] -- 0:00:05
914500 -- (-318.747) (-318.198) [-319.235] (-318.582) * (-316.531) (-317.324) (-317.392) [-316.110] -- 0:00:05
915000 -- (-316.019) (-321.675) [-316.587] (-322.920) * (-315.546) [-318.818] (-316.018) (-322.561) -- 0:00:05
Average standard deviation of split frequencies: 0.010430
915500 -- (-319.102) (-315.449) (-322.810) [-319.180] * (-315.564) [-316.488] (-318.479) (-317.745) -- 0:00:04
916000 -- (-320.134) (-315.803) [-320.187] (-319.337) * (-317.338) [-317.950] (-316.005) (-317.522) -- 0:00:04
916500 -- (-315.478) [-315.301] (-320.581) (-317.274) * (-319.611) [-317.602] (-318.341) (-316.932) -- 0:00:04
917000 -- (-316.190) [-316.307] (-316.267) (-316.536) * (-317.155) (-315.620) (-322.567) [-317.100] -- 0:00:04
917500 -- (-316.542) (-319.407) (-318.656) [-316.677] * (-315.420) [-320.009] (-316.095) (-319.827) -- 0:00:04
918000 -- (-318.037) (-317.290) (-315.487) [-316.683] * (-315.483) (-318.367) [-316.554] (-318.466) -- 0:00:04
918500 -- (-323.593) (-319.705) [-314.970] (-315.904) * (-318.268) [-316.911] (-315.795) (-316.935) -- 0:00:04
919000 -- (-318.464) [-319.645] (-315.374) (-316.183) * (-319.556) (-315.317) [-316.450] (-319.035) -- 0:00:04
919500 -- (-318.482) [-315.968] (-318.634) (-317.221) * [-319.531] (-315.610) (-316.644) (-319.176) -- 0:00:04
920000 -- (-318.393) (-321.008) (-321.488) [-316.963] * (-316.167) (-317.084) (-318.176) [-319.785] -- 0:00:04
Average standard deviation of split frequencies: 0.010616
920500 -- [-318.628] (-316.847) (-317.064) (-316.408) * (-319.920) (-316.155) [-318.510] (-316.822) -- 0:00:04
921000 -- (-317.371) (-316.614) (-317.950) [-316.819] * (-315.617) [-317.938] (-321.364) (-317.606) -- 0:00:04
921500 -- (-316.379) [-319.053] (-317.184) (-315.842) * (-319.358) (-317.316) (-318.204) [-315.767] -- 0:00:04
922000 -- (-316.544) [-317.035] (-316.263) (-319.841) * (-317.554) [-319.044] (-318.060) (-315.544) -- 0:00:04
922500 -- [-322.369] (-317.808) (-319.974) (-319.793) * (-318.843) [-320.219] (-321.453) (-315.814) -- 0:00:04
923000 -- [-319.213] (-316.433) (-315.252) (-317.918) * (-317.295) [-315.465] (-317.567) (-321.247) -- 0:00:04
923500 -- (-318.942) (-318.516) [-318.458] (-318.223) * (-317.319) (-318.213) [-318.243] (-319.625) -- 0:00:04
924000 -- (-318.082) (-316.190) [-316.288] (-319.428) * (-319.414) (-320.279) (-317.410) [-318.813] -- 0:00:04
924500 -- (-317.840) (-319.753) (-318.311) [-315.237] * [-320.709] (-318.629) (-317.104) (-316.364) -- 0:00:04
925000 -- (-316.224) (-315.352) (-316.608) [-317.921] * (-318.486) [-320.028] (-319.696) (-320.768) -- 0:00:04
Average standard deviation of split frequencies: 0.010826
925500 -- (-316.828) (-316.633) (-317.265) [-319.437] * (-319.177) [-317.557] (-316.877) (-319.038) -- 0:00:04
926000 -- (-316.888) (-315.719) [-317.906] (-315.737) * (-318.110) [-321.783] (-315.290) (-316.608) -- 0:00:04
926500 -- (-317.868) (-321.319) (-318.380) [-317.315] * [-315.347] (-316.564) (-315.803) (-318.270) -- 0:00:04
927000 -- (-316.898) (-321.631) [-316.074] (-317.369) * (-319.803) (-316.249) (-315.233) [-318.955] -- 0:00:04
927500 -- [-317.727] (-320.951) (-317.872) (-317.689) * [-315.793] (-317.302) (-316.128) (-321.752) -- 0:00:04
928000 -- (-317.588) (-318.716) (-316.437) [-317.544] * (-315.860) (-318.130) [-316.323] (-319.035) -- 0:00:04
928500 -- (-319.888) (-315.997) [-317.183] (-315.924) * [-319.013] (-316.817) (-318.353) (-321.809) -- 0:00:04
929000 -- (-319.635) (-319.663) [-317.808] (-316.571) * (-316.579) [-318.829] (-316.560) (-318.538) -- 0:00:04
929500 -- [-317.977] (-317.624) (-316.241) (-315.528) * (-316.679) (-318.394) [-316.555] (-315.774) -- 0:00:04
930000 -- (-316.110) (-316.733) (-317.282) [-315.331] * [-316.937] (-319.705) (-317.220) (-316.923) -- 0:00:04
Average standard deviation of split frequencies: 0.010637
930500 -- [-316.570] (-315.408) (-315.600) (-316.303) * (-315.978) (-318.010) (-316.437) [-317.839] -- 0:00:04
931000 -- (-316.286) (-318.736) [-315.498] (-317.222) * (-318.855) (-317.300) (-318.439) [-316.633] -- 0:00:04
931500 -- (-316.780) (-319.685) (-317.261) [-318.308] * [-316.092] (-318.436) (-316.746) (-319.066) -- 0:00:04
932000 -- (-317.691) [-317.324] (-317.023) (-318.332) * (-315.794) (-315.793) (-315.700) [-316.764] -- 0:00:04
932500 -- [-315.840] (-317.487) (-316.374) (-317.164) * (-318.588) (-317.642) [-317.675] (-317.224) -- 0:00:03
933000 -- (-319.752) (-322.779) [-318.056] (-316.565) * (-318.849) [-319.143] (-316.268) (-316.074) -- 0:00:03
933500 -- (-316.607) (-317.301) (-322.821) [-318.169] * [-317.040] (-321.122) (-316.856) (-315.815) -- 0:00:03
934000 -- (-319.595) [-320.374] (-322.213) (-316.492) * (-317.470) [-317.715] (-318.108) (-317.457) -- 0:00:03
934500 -- [-316.679] (-320.174) (-317.539) (-317.237) * (-315.113) [-317.634] (-317.818) (-318.405) -- 0:00:03
935000 -- (-317.344) (-315.381) (-320.868) [-317.127] * (-317.150) (-316.199) (-322.681) [-315.444] -- 0:00:03
Average standard deviation of split frequencies: 0.010610
935500 -- (-323.548) (-317.245) [-316.292] (-316.174) * (-317.781) (-316.845) (-317.432) [-316.966] -- 0:00:03
936000 -- [-319.386] (-316.690) (-321.260) (-321.732) * [-316.036] (-316.664) (-318.762) (-317.192) -- 0:00:03
936500 -- (-316.215) [-317.024] (-318.333) (-318.497) * [-315.009] (-316.234) (-319.625) (-318.496) -- 0:00:03
937000 -- [-315.576] (-315.807) (-315.711) (-317.778) * [-315.123] (-317.720) (-316.692) (-316.187) -- 0:00:03
937500 -- (-315.582) [-317.516] (-317.045) (-317.104) * (-317.293) (-317.720) [-318.081] (-318.910) -- 0:00:03
938000 -- (-317.304) (-316.742) [-319.967] (-320.029) * (-316.767) (-321.115) [-319.371] (-316.463) -- 0:00:03
938500 -- (-317.018) [-315.759] (-317.777) (-320.183) * (-317.824) (-317.168) (-319.900) [-317.425] -- 0:00:03
939000 -- (-321.734) [-316.154] (-319.317) (-320.333) * [-316.282] (-316.020) (-322.222) (-320.333) -- 0:00:03
939500 -- (-320.068) [-319.235] (-318.384) (-316.960) * (-316.237) [-315.738] (-318.456) (-318.684) -- 0:00:03
940000 -- (-315.568) [-315.559] (-317.472) (-316.526) * [-316.814] (-315.886) (-315.613) (-315.958) -- 0:00:03
Average standard deviation of split frequencies: 0.010591
940500 -- (-316.809) (-317.305) (-317.207) [-316.652] * [-319.511] (-318.377) (-317.065) (-319.740) -- 0:00:03
941000 -- (-319.481) [-318.524] (-319.197) (-318.769) * (-317.317) [-317.563] (-318.144) (-317.812) -- 0:00:03
941500 -- (-318.201) (-316.020) [-317.485] (-316.349) * (-318.701) [-317.887] (-316.005) (-319.039) -- 0:00:03
942000 -- (-321.438) (-318.258) (-316.677) [-315.463] * (-319.173) [-315.195] (-316.700) (-317.560) -- 0:00:03
942500 -- (-316.192) (-316.381) (-316.111) [-316.133] * [-317.625] (-315.586) (-316.448) (-316.702) -- 0:00:03
943000 -- (-318.741) (-316.560) [-316.121] (-317.775) * (-318.368) (-315.440) [-318.483] (-316.249) -- 0:00:03
943500 -- [-317.473] (-315.442) (-316.210) (-317.582) * (-319.241) (-316.406) (-316.938) [-315.554] -- 0:00:03
944000 -- (-320.167) (-318.608) (-317.153) [-317.911] * [-315.408] (-316.118) (-317.057) (-316.643) -- 0:00:03
944500 -- (-317.000) [-317.061] (-317.542) (-316.727) * [-316.888] (-316.445) (-317.309) (-324.857) -- 0:00:03
945000 -- (-316.245) [-315.397] (-318.339) (-319.538) * (-317.171) (-315.227) [-318.261] (-319.649) -- 0:00:03
Average standard deviation of split frequencies: 0.010247
945500 -- [-315.204] (-318.587) (-316.966) (-318.048) * [-315.400] (-315.623) (-318.840) (-315.878) -- 0:00:03
946000 -- (-318.140) (-316.698) (-316.908) [-315.715] * (-317.527) (-317.357) [-317.194] (-317.240) -- 0:00:03
946500 -- (-318.848) [-316.340] (-316.898) (-315.721) * (-319.974) [-318.455] (-316.300) (-318.747) -- 0:00:03
947000 -- (-316.777) (-317.672) [-316.258] (-317.557) * (-316.499) [-317.954] (-315.898) (-321.852) -- 0:00:03
947500 -- [-317.771] (-315.971) (-316.440) (-315.943) * (-317.357) [-318.141] (-321.972) (-315.572) -- 0:00:03
948000 -- (-317.297) (-317.596) (-316.906) [-315.021] * (-317.191) (-320.155) (-318.056) [-320.351] -- 0:00:03
948500 -- (-317.118) [-316.795] (-317.423) (-316.890) * (-315.308) (-316.792) (-320.734) [-316.551] -- 0:00:03
949000 -- (-316.498) [-316.097] (-317.916) (-316.047) * [-316.275] (-319.507) (-316.401) (-317.302) -- 0:00:03
949500 -- [-316.599] (-317.531) (-317.283) (-316.681) * [-316.935] (-319.054) (-320.185) (-317.889) -- 0:00:02
950000 -- (-315.889) (-316.899) [-317.767] (-318.354) * [-316.675] (-316.133) (-317.279) (-318.016) -- 0:00:02
Average standard deviation of split frequencies: 0.009948
950500 -- (-319.782) (-316.436) [-318.587] (-317.646) * (-315.686) [-317.372] (-317.767) (-322.610) -- 0:00:02
951000 -- (-321.042) (-318.010) (-319.072) [-315.682] * (-317.439) [-317.290] (-315.762) (-317.372) -- 0:00:02
951500 -- (-318.149) (-316.137) [-319.372] (-316.703) * [-316.119] (-319.014) (-315.909) (-315.561) -- 0:00:02
952000 -- (-316.557) [-316.397] (-317.082) (-318.224) * (-318.169) (-319.274) [-317.021] (-316.357) -- 0:00:02
952500 -- (-320.966) (-318.066) [-315.353] (-321.400) * (-318.180) (-317.538) [-318.184] (-315.609) -- 0:00:02
953000 -- (-320.249) [-316.024] (-317.081) (-317.731) * (-316.407) (-319.439) [-316.749] (-317.243) -- 0:00:02
953500 -- [-317.265] (-315.944) (-316.120) (-318.323) * (-316.159) (-321.051) (-316.210) [-317.517] -- 0:00:02
954000 -- (-315.697) [-318.149] (-317.901) (-316.351) * (-315.611) (-317.819) [-316.637] (-320.994) -- 0:00:02
954500 -- (-317.530) (-317.696) [-315.108] (-317.291) * (-321.293) [-317.482] (-315.690) (-317.346) -- 0:00:02
955000 -- (-318.251) (-315.983) [-315.511] (-320.009) * (-320.741) (-315.470) (-316.539) [-316.529] -- 0:00:02
Average standard deviation of split frequencies: 0.010417
955500 -- (-317.737) (-321.980) (-315.983) [-318.191] * (-317.653) (-316.738) (-316.124) [-318.854] -- 0:00:02
956000 -- [-316.371] (-318.441) (-315.723) (-317.865) * [-318.176] (-316.213) (-315.854) (-316.041) -- 0:00:02
956500 -- (-317.440) [-321.788] (-315.060) (-318.270) * (-316.592) (-318.112) (-316.115) [-316.005] -- 0:00:02
957000 -- [-316.178] (-319.193) (-315.984) (-315.575) * (-315.959) (-318.019) (-318.049) [-318.796] -- 0:00:02
957500 -- [-319.117] (-318.424) (-317.904) (-316.636) * [-316.073] (-317.230) (-317.918) (-320.469) -- 0:00:02
958000 -- [-317.013] (-318.762) (-323.613) (-317.790) * (-317.709) [-317.128] (-317.664) (-317.045) -- 0:00:02
958500 -- (-323.896) (-322.651) [-316.533] (-319.737) * (-318.120) (-315.904) [-315.064] (-316.500) -- 0:00:02
959000 -- (-323.528) (-318.268) (-316.487) [-318.917] * (-316.416) (-318.632) [-315.202] (-316.489) -- 0:00:02
959500 -- (-320.846) [-319.185] (-317.076) (-316.431) * (-317.302) (-317.405) [-315.908] (-317.831) -- 0:00:02
960000 -- (-317.406) (-322.133) [-315.432] (-319.525) * [-317.287] (-318.644) (-315.860) (-315.934) -- 0:00:02
Average standard deviation of split frequencies: 0.009998
960500 -- [-317.661] (-320.885) (-317.297) (-317.516) * (-319.230) (-319.713) (-315.294) [-316.708] -- 0:00:02
961000 -- (-322.185) (-320.976) [-316.154] (-319.590) * [-316.658] (-320.628) (-316.225) (-317.416) -- 0:00:02
961500 -- (-316.690) [-315.541] (-316.606) (-316.175) * (-315.499) (-318.450) [-316.668] (-315.968) -- 0:00:02
962000 -- (-316.001) [-318.345] (-318.591) (-315.650) * (-316.028) [-317.880] (-316.785) (-316.443) -- 0:00:02
962500 -- (-316.715) [-315.437] (-317.174) (-316.011) * (-316.146) (-316.286) (-316.183) [-316.385] -- 0:00:02
963000 -- (-319.995) (-315.484) [-318.810] (-315.866) * (-316.137) (-315.485) (-316.848) [-315.961] -- 0:00:02
963500 -- (-317.154) [-316.399] (-318.348) (-317.375) * [-317.819] (-318.798) (-316.537) (-322.104) -- 0:00:02
964000 -- (-319.563) [-315.684] (-318.462) (-318.339) * [-315.693] (-316.986) (-320.013) (-317.005) -- 0:00:02
964500 -- (-315.832) (-315.666) [-320.511] (-320.914) * (-315.364) (-317.900) [-316.556] (-319.592) -- 0:00:02
965000 -- [-315.809] (-317.637) (-316.621) (-315.526) * (-315.292) (-317.280) [-317.418] (-316.342) -- 0:00:02
Average standard deviation of split frequencies: 0.009882
965500 -- (-318.086) [-316.859] (-315.303) (-315.265) * (-315.488) [-315.092] (-319.096) (-317.144) -- 0:00:02
966000 -- (-316.408) (-315.470) (-316.051) [-319.876] * (-321.588) [-315.646] (-315.453) (-315.260) -- 0:00:02
966500 -- [-315.569] (-316.526) (-315.995) (-319.198) * (-322.593) (-316.601) (-319.754) [-320.006] -- 0:00:01
967000 -- (-316.563) (-316.967) [-314.993] (-319.212) * (-318.332) (-316.674) [-318.286] (-317.800) -- 0:00:01
967500 -- (-317.123) (-320.196) [-315.637] (-319.029) * [-318.544] (-315.840) (-316.820) (-315.540) -- 0:00:01
968000 -- [-316.225] (-316.555) (-315.918) (-319.707) * (-320.258) (-316.614) [-315.925] (-319.604) -- 0:00:01
968500 -- [-316.942] (-320.217) (-317.239) (-318.763) * [-315.852] (-317.740) (-316.313) (-316.578) -- 0:00:01
969000 -- [-319.263] (-320.968) (-319.253) (-316.067) * (-317.979) (-316.810) [-315.349] (-315.944) -- 0:00:01
969500 -- (-318.033) [-317.246] (-318.313) (-318.407) * (-318.951) (-316.426) [-315.023] (-321.347) -- 0:00:01
970000 -- (-316.004) (-315.939) [-319.488] (-318.042) * (-319.141) (-316.076) (-315.020) [-316.101] -- 0:00:01
Average standard deviation of split frequencies: 0.009804
970500 -- (-320.007) [-316.462] (-316.514) (-322.198) * (-321.334) (-316.864) (-314.948) [-316.983] -- 0:00:01
971000 -- (-316.680) [-316.784] (-315.923) (-319.509) * (-318.016) (-316.595) (-315.522) [-315.776] -- 0:00:01
971500 -- (-315.811) (-317.940) [-317.415] (-316.782) * (-317.765) [-316.010] (-316.599) (-315.740) -- 0:00:01
972000 -- (-315.879) (-318.586) (-316.523) [-316.964] * [-317.163] (-316.958) (-316.511) (-319.551) -- 0:00:01
972500 -- (-315.577) (-317.784) [-316.256] (-315.977) * (-317.434) (-319.830) [-316.874] (-320.348) -- 0:00:01
973000 -- (-316.807) (-315.856) [-315.919] (-319.791) * [-316.998] (-317.413) (-317.293) (-317.236) -- 0:00:01
973500 -- [-315.644] (-315.813) (-315.785) (-319.000) * [-315.746] (-316.342) (-316.745) (-315.914) -- 0:00:01
974000 -- (-318.242) [-316.104] (-318.762) (-316.067) * (-317.485) (-315.420) [-317.056] (-316.457) -- 0:00:01
974500 -- (-317.170) [-319.986] (-316.268) (-317.495) * (-316.438) (-316.614) [-316.417] (-316.125) -- 0:00:01
975000 -- (-318.988) (-315.784) [-316.614] (-318.506) * (-315.235) [-317.091] (-318.214) (-316.485) -- 0:00:01
Average standard deviation of split frequencies: 0.009630
975500 -- (-316.754) (-316.293) [-317.597] (-316.428) * (-316.572) (-316.941) (-315.816) [-316.015] -- 0:00:01
976000 -- (-316.825) [-316.175] (-318.563) (-317.436) * (-317.255) [-316.461] (-319.189) (-316.610) -- 0:00:01
976500 -- (-316.804) (-315.928) (-315.034) [-316.724] * (-315.602) (-316.717) [-318.133] (-316.600) -- 0:00:01
977000 -- [-318.178] (-317.128) (-315.393) (-315.583) * (-321.430) (-317.447) [-317.582] (-315.993) -- 0:00:01
977500 -- (-322.425) (-315.969) (-315.518) [-317.445] * [-317.173] (-321.005) (-317.119) (-315.483) -- 0:00:01
978000 -- (-319.427) [-316.668] (-317.675) (-316.085) * (-318.271) (-320.025) (-318.600) [-318.078] -- 0:00:01
978500 -- [-320.458] (-316.811) (-316.914) (-316.566) * [-320.593] (-322.405) (-317.711) (-315.955) -- 0:00:01
979000 -- (-317.963) (-316.446) (-319.202) [-318.389] * [-317.213] (-320.361) (-316.063) (-317.328) -- 0:00:01
979500 -- (-316.200) [-319.132] (-315.237) (-317.335) * (-318.929) [-317.185] (-317.893) (-316.539) -- 0:00:01
980000 -- (-317.716) (-317.684) (-315.243) [-321.656] * (-315.488) (-321.880) [-319.326] (-316.334) -- 0:00:01
Average standard deviation of split frequencies: 0.009193
980500 -- (-319.457) [-315.621] (-317.934) (-316.665) * (-316.266) (-319.379) (-320.253) [-316.601] -- 0:00:01
981000 -- (-315.869) (-316.325) (-320.071) [-316.620] * [-317.620] (-319.233) (-320.618) (-315.379) -- 0:00:01
981500 -- [-315.782] (-318.974) (-322.211) (-316.293) * (-316.350) (-317.855) (-317.033) [-315.740] -- 0:00:01
982000 -- (-315.830) (-319.702) (-317.430) [-316.069] * (-318.914) (-318.374) (-316.950) [-316.425] -- 0:00:01
982500 -- [-321.851] (-316.728) (-315.894) (-317.746) * [-318.570] (-319.153) (-315.833) (-316.070) -- 0:00:01
983000 -- (-317.090) (-320.747) [-315.997] (-315.841) * (-317.385) (-318.179) [-318.404] (-316.556) -- 0:00:01
983500 -- (-316.351) [-315.355] (-320.056) (-316.274) * (-317.466) (-316.721) [-315.393] (-315.857) -- 0:00:00
984000 -- (-319.884) (-317.830) [-318.281] (-317.200) * (-321.409) (-317.196) [-317.387] (-317.326) -- 0:00:00
984500 -- (-322.257) (-316.543) [-317.585] (-318.117) * (-317.285) (-325.834) [-316.295] (-315.552) -- 0:00:00
985000 -- (-315.474) (-317.779) (-320.554) [-316.115] * (-320.347) (-316.753) [-317.326] (-315.592) -- 0:00:00
Average standard deviation of split frequencies: 0.009174
985500 -- (-316.772) [-316.340] (-318.085) (-317.792) * [-317.207] (-320.187) (-315.986) (-316.526) -- 0:00:00
986000 -- (-315.735) (-315.725) [-318.867] (-317.857) * [-317.272] (-315.910) (-316.438) (-316.478) -- 0:00:00
986500 -- (-316.200) (-315.348) [-319.045] (-318.273) * (-316.002) [-315.809] (-318.493) (-317.224) -- 0:00:00
987000 -- (-323.416) (-317.874) (-316.582) [-319.469] * (-316.290) (-316.471) [-318.744] (-316.914) -- 0:00:00
987500 -- (-320.983) (-319.150) (-316.432) [-317.596] * (-317.039) (-316.621) [-318.841] (-318.690) -- 0:00:00
988000 -- (-316.054) (-317.889) (-315.194) [-315.924] * (-318.164) (-315.773) (-321.922) [-319.066] -- 0:00:00
988500 -- (-317.623) (-318.959) (-315.930) [-321.803] * (-321.513) [-316.739] (-317.592) (-317.072) -- 0:00:00
989000 -- (-316.399) (-317.612) (-317.048) [-317.721] * (-315.765) [-316.876] (-319.127) (-315.475) -- 0:00:00
989500 -- (-315.902) (-315.342) (-317.683) [-316.619] * (-316.819) (-316.741) [-316.516] (-315.986) -- 0:00:00
990000 -- (-318.447) (-315.518) (-315.956) [-319.672] * (-318.644) [-316.573] (-316.502) (-316.822) -- 0:00:00
Average standard deviation of split frequencies: 0.009487
990500 -- (-320.609) (-316.657) (-320.510) [-315.402] * (-315.736) (-319.380) (-318.813) [-316.184] -- 0:00:00
991000 -- (-317.079) (-320.864) [-316.489] (-317.209) * (-317.423) (-316.194) [-315.864] (-316.513) -- 0:00:00
991500 -- (-318.032) (-317.359) (-319.462) [-318.237] * (-316.835) (-316.302) [-316.012] (-316.001) -- 0:00:00
992000 -- (-316.726) (-316.481) (-317.890) [-321.623] * [-317.449] (-316.273) (-318.613) (-315.935) -- 0:00:00
992500 -- [-316.470] (-316.045) (-316.085) (-316.467) * (-324.799) (-319.206) (-317.448) [-316.469] -- 0:00:00
993000 -- (-322.590) (-316.350) [-315.588] (-318.373) * (-318.079) (-321.449) [-316.069] (-320.189) -- 0:00:00
993500 -- [-317.108] (-318.478) (-316.003) (-316.217) * [-319.640] (-317.829) (-316.972) (-318.172) -- 0:00:00
994000 -- (-316.204) (-317.444) (-317.849) [-316.182] * [-319.612] (-322.473) (-317.534) (-319.803) -- 0:00:00
994500 -- (-315.707) [-320.291] (-318.281) (-318.095) * (-317.467) [-316.565] (-316.533) (-316.792) -- 0:00:00
995000 -- (-316.645) (-322.462) [-318.109] (-317.503) * (-316.671) (-321.697) [-316.547] (-316.174) -- 0:00:00
Average standard deviation of split frequencies: 0.009673
995500 -- [-315.936] (-320.449) (-316.444) (-316.294) * (-316.600) [-321.140] (-315.978) (-317.169) -- 0:00:00
996000 -- (-318.563) (-316.632) [-316.011] (-320.555) * (-315.389) (-318.324) [-317.514] (-319.490) -- 0:00:00
996500 -- (-317.452) (-317.183) [-318.762] (-318.171) * [-316.665] (-316.231) (-317.276) (-315.200) -- 0:00:00
997000 -- (-320.283) (-315.165) (-316.831) [-315.273] * (-315.722) [-317.746] (-320.195) (-316.129) -- 0:00:00
997500 -- (-315.771) (-315.691) [-316.572] (-318.100) * (-318.197) (-316.457) [-318.914] (-315.283) -- 0:00:00
998000 -- [-316.331] (-317.260) (-316.318) (-316.998) * (-319.227) (-318.547) [-319.237] (-316.025) -- 0:00:00
998500 -- [-316.747] (-317.599) (-316.669) (-316.056) * (-317.469) (-317.317) [-317.317] (-316.490) -- 0:00:00
999000 -- [-316.579] (-317.902) (-316.484) (-315.482) * (-318.768) [-320.401] (-316.767) (-318.642) -- 0:00:00
999500 -- (-319.116) (-317.474) (-316.520) [-316.237] * (-317.150) (-317.687) [-315.278] (-316.848) -- 0:00:00
1000000 -- [-317.818] (-318.795) (-315.470) (-317.201) * (-317.834) (-318.027) [-318.585] (-317.600) -- 0:00:00
Average standard deviation of split frequencies: 0.009422
Analysis completed in 59 seconds
Analysis used 57.99 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -314.88
Likelihood of best state for "cold" chain of run 2 was -314.88
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 68 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
44.4 % ( 37 %) Dirichlet(Pi{all})
42.0 % ( 30 %) Slider(Pi{all})
78.3 % ( 45 %) Multiplier(Alpha{1,2})
77.8 % ( 55 %) Multiplier(Alpha{3})
27.2 % ( 32 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.0 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.7 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.5 % ( 66 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
44.3 % ( 38 %) Dirichlet(Pi{all})
41.9 % ( 30 %) Slider(Pi{all})
79.1 % ( 67 %) Multiplier(Alpha{1,2})
78.2 % ( 45 %) Multiplier(Alpha{3})
27.0 % ( 31 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.3 % ( 58 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 30 %) Multiplier(V{all})
97.3 % ( 98 %) Nodeslider(V{all})
30.8 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166706 0.82 0.67
3 | 165964 166696 0.84
4 | 166971 166321 167342
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167164 0.82 0.66
3 | 166253 166688 0.83
4 | 167022 166387 166486
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -316.59
| 1 1 2 1 2 |
| 1 1 2 1 |
| 22 2 1 1 11 2 2122 2 |
| 1 12 21 1 2 2 11 1 1 |
| 1 1 1 2 * 2 *1 1 2 21 1 |
|222 1 1 * 22 11121 2 2 2 11 2 1 121*2 21|
|11 2 1 2 1 2 * 2 2 1 |
| 2 2 1 2 2 2 2 2 12|
| 2 1 2 1 2 1 11 1 * 2 |
| 2 1 2 1 2 |
| 2 |
| 2 |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -318.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -316.58 -320.82
2 -316.56 -321.50
--------------------------------------
TOTAL -316.57 -321.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884991 0.088870 0.372568 1.486494 0.848733 1151.18 1248.86 1.000
r(A<->C){all} 0.164010 0.017891 0.000141 0.424871 0.129783 143.84 158.73 1.006
r(A<->G){all} 0.163601 0.019046 0.000029 0.436627 0.129349 242.64 275.45 1.000
r(A<->T){all} 0.163587 0.018602 0.000014 0.439088 0.132149 201.87 215.14 1.000
r(C<->G){all} 0.169234 0.019252 0.000005 0.440734 0.136021 176.67 182.08 1.003
r(C<->T){all} 0.173853 0.020658 0.000165 0.467439 0.135131 151.44 171.91 1.000
r(G<->T){all} 0.165715 0.019161 0.000134 0.438866 0.134164 213.01 252.77 1.002
pi(A){all} 0.169777 0.000587 0.122379 0.217060 0.168673 1142.31 1205.99 1.000
pi(C){all} 0.251185 0.000785 0.195625 0.305239 0.250501 1277.45 1303.36 1.000
pi(G){all} 0.315517 0.000924 0.255047 0.372915 0.315347 1266.64 1295.14 1.000
pi(T){all} 0.263521 0.000808 0.209767 0.320148 0.262995 1312.39 1406.69 1.000
alpha{1,2} 0.419431 0.223093 0.000180 1.370737 0.254492 770.77 1030.31 1.000
alpha{3} 0.445868 0.226961 0.000172 1.403514 0.287029 1314.36 1355.74 1.000
pinvar{all} 0.992879 0.000076 0.976604 0.999997 0.995721 1086.88 1189.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**.**
8 -- ...**.
9 -- ....**
10 -- .*...*
11 -- ..****
12 -- .****.
13 -- .**...
14 -- .*.***
15 -- .*.*..
16 -- ..**..
17 -- ...*.*
18 -- ..*.*.
19 -- .*..*.
20 -- ..*..*
21 -- .***.*
22 -- ..***.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 445 0.148235 0.000471 0.147901 0.148568 2
8 443 0.147568 0.015546 0.136576 0.158561 2
9 438 0.145903 0.014133 0.135909 0.155896 2
10 437 0.145570 0.004240 0.142572 0.148568 2
11 437 0.145570 0.005182 0.141905 0.149234 2
12 435 0.144903 0.006124 0.140573 0.149234 2
13 435 0.144903 0.002355 0.143238 0.146569 2
14 432 0.143904 0.020728 0.129247 0.158561 2
15 431 0.143571 0.008009 0.137908 0.149234 2
16 430 0.143238 0.011306 0.135243 0.151233 2
17 422 0.140573 0.020728 0.125916 0.155230 2
18 418 0.139241 0.006595 0.134577 0.143904 2
19 417 0.138907 0.000471 0.138574 0.139241 2
20 406 0.135243 0.014133 0.125250 0.145237 2
21 406 0.135243 0.013191 0.125916 0.144570 2
22 286 0.095270 0.007537 0.089940 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.100340 0.010341 0.000009 0.306177 0.068571 1.000 2
length{all}[2] 0.097685 0.008813 0.000007 0.292199 0.068748 1.000 2
length{all}[3] 0.099954 0.010647 0.000004 0.299081 0.068177 1.000 2
length{all}[4] 0.096814 0.009347 0.000003 0.296332 0.067625 1.000 2
length{all}[5] 0.099365 0.009769 0.000018 0.293928 0.069230 1.000 2
length{all}[6] 0.098679 0.009963 0.000074 0.299266 0.068929 1.001 2
length{all}[7] 0.098349 0.011226 0.000228 0.294362 0.066159 0.998 2
length{all}[8] 0.098210 0.009940 0.000569 0.270651 0.070809 1.001 2
length{all}[9] 0.101163 0.011561 0.000011 0.313711 0.067959 0.998 2
length{all}[10] 0.096829 0.008008 0.000278 0.294222 0.071543 0.998 2
length{all}[11] 0.096111 0.009294 0.000166 0.304538 0.065422 0.998 2
length{all}[12] 0.101435 0.010125 0.000045 0.302150 0.066635 1.003 2
length{all}[13] 0.092368 0.010283 0.000016 0.284313 0.056158 0.998 2
length{all}[14] 0.092456 0.009149 0.000488 0.280393 0.066728 0.998 2
length{all}[15] 0.099829 0.009853 0.000039 0.305827 0.070957 1.000 2
length{all}[16] 0.090563 0.007839 0.000209 0.268336 0.064444 0.998 2
length{all}[17] 0.101710 0.008933 0.000170 0.298597 0.071897 0.999 2
length{all}[18] 0.096164 0.009082 0.001130 0.277078 0.070308 0.998 2
length{all}[19] 0.094104 0.008270 0.000094 0.252802 0.067401 1.007 2
length{all}[20] 0.094600 0.008547 0.000137 0.278795 0.069338 0.998 2
length{all}[21] 0.089237 0.007507 0.000235 0.267278 0.064816 0.998 2
length{all}[22] 0.102008 0.013048 0.000055 0.314229 0.064272 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009422
Maximum standard deviation of split frequencies = 0.020728
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|---------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 231
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 39 patterns at 77 / 77 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 39 patterns at 77 / 77 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
38064 bytes for conP
3432 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.089608 0.063451 0.017791 0.097751 0.016164 0.025003 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -320.828419
Iterating by ming2
Initial: fx= 320.828419
x= 0.08961 0.06345 0.01779 0.09775 0.01616 0.02500 0.30000 1.30000
1 h-m-p 0.0000 0.0002 184.3798 +++ 313.570252 m 0.0002 14 | 1/8
2 h-m-p 0.0160 8.0000 24.5272 -------------.. | 1/8
3 h-m-p 0.0000 0.0000 168.6189 ++ 312.959774 m 0.0000 47 | 2/8
4 h-m-p 0.0160 8.0000 20.7693 -------------.. | 2/8
5 h-m-p 0.0000 0.0001 150.5539 ++ 310.797847 m 0.0001 80 | 3/8
6 h-m-p 0.0160 8.0000 16.7281 -------------.. | 3/8
7 h-m-p 0.0000 0.0005 130.1841 +++ 302.086750 m 0.0005 114 | 4/8
8 h-m-p 0.0160 8.0000 13.0163 -------------.. | 4/8
9 h-m-p 0.0000 0.0004 106.9036 +++ 298.073863 m 0.0004 148 | 5/8
10 h-m-p 0.0160 8.0000 9.3817 -------------.. | 5/8
11 h-m-p 0.0000 0.0001 75.9302 ++ 297.443679 m 0.0001 181 | 6/8
12 h-m-p 1.1767 8.0000 0.0000 ++ 297.443679 m 8.0000 192 | 6/8
13 h-m-p 0.0617 8.0000 0.0001 --------------.. | 6/8
14 h-m-p 0.0160 8.0000 0.0000 +++++ 297.443679 m 8.0000 233 | 6/8
15 h-m-p 0.0007 0.3738 1.2882 --------Y 297.443679 0 0.0000 254 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 297.443679 m 8.0000 268 | 6/8
17 h-m-p 0.0160 8.0000 0.0805 ++++Y 297.443678 0 3.2650 285 | 6/8
18 h-m-p 1.6000 8.0000 0.0071 Y 297.443678 0 1.1395 298 | 6/8
19 h-m-p 1.6000 8.0000 0.0000 -Y 297.443678 0 0.1000 312 | 6/8
20 h-m-p 0.0160 8.0000 0.0002 +++++ 297.443678 m 8.0000 328 | 6/8
21 h-m-p 0.0287 8.0000 0.0515 ++Y 297.443678 0 0.8822 343 | 6/8
22 h-m-p 1.6000 8.0000 0.0005 ----------C 297.443678 0 0.0000 366 | 6/8
23 h-m-p 0.0057 2.8437 0.2906 +++Y 297.443677 0 0.7327 382 | 6/8
24 h-m-p 1.6000 8.0000 0.0068 Y 297.443677 0 1.1380 395 | 6/8
25 h-m-p 1.6000 8.0000 0.0001 ++ 297.443677 m 8.0000 408 | 6/8
26 h-m-p 0.0717 8.0000 0.0086 ++Y 297.443677 0 2.6159 423 | 6/8
27 h-m-p 1.6000 8.0000 0.0003 ++ 297.443677 m 8.0000 436 | 6/8
28 h-m-p 0.0010 0.1828 2.1164 -----------.. | 6/8
29 h-m-p 0.0160 8.0000 0.0000 +++++ 297.443677 m 8.0000 472 | 6/8
30 h-m-p 0.0221 8.0000 0.0106 -------------.. | 6/8
31 h-m-p 0.0160 8.0000 0.0000 +++++ 297.443677 m 8.0000 512 | 6/8
32 h-m-p 0.0160 8.0000 4.7312 +++++ 297.443501 m 8.0000 528 | 6/8
33 h-m-p 1.6000 8.0000 0.9891 ++ 297.443496 m 8.0000 539 | 6/8
34 h-m-p 0.2813 8.0000 28.1324 +++ 297.443470 m 8.0000 553 | 6/8
35 h-m-p 1.6000 8.0000 8.3774 ++ 297.443469 m 8.0000 564 | 6/8
36 h-m-p 0.3538 3.6619 189.4249 ++ 297.443465 m 3.6619 575 | 7/8
37 h-m-p 1.6000 8.0000 30.5523 ++ 297.443465 m 8.0000 586 | 7/8
38 h-m-p 1.6000 8.0000 33.4707 ----------------.. | 7/8
39 h-m-p 0.0160 8.0000 0.0000 ----N 297.443465 0 0.0000 626
Out..
lnL = -297.443465
627 lfun, 627 eigenQcodon, 3762 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.082928 0.087448 0.044295 0.014527 0.097922 0.078714 999.000000 0.800035 0.488056
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.024007
np = 9
lnL0 = -328.945966
Iterating by ming2
Initial: fx= 328.945966
x= 0.08293 0.08745 0.04429 0.01453 0.09792 0.07871 951.42857 0.80003 0.48806
1 h-m-p 0.0000 0.0002 185.8526 +++ 322.495395 m 0.0002 15 | 1/9
2 h-m-p 0.0004 0.0021 85.8333 ++ 310.554760 m 0.0021 27 | 2/9
3 h-m-p 0.0003 0.0013 78.8309 ++ 299.496891 m 0.0013 39 | 3/9
4 h-m-p 0.0003 0.0015 9.6703 ++ 299.483076 m 0.0015 51 | 4/9
5 h-m-p 0.0000 0.0002 47.9741 ++ 299.083969 m 0.0002 63 | 5/9
6 h-m-p 0.0001 0.0006 33.5828 ++ 297.443735 m 0.0006 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 297.443735 m 8.0000 87 | 6/9
8 h-m-p 0.0160 8.0000 0.0541 +++++ 297.443704 m 8.0000 105 | 6/9
9 h-m-p 0.3753 1.8766 0.6053 -------------C 297.443704 0 0.0000 133 | 6/9
10 h-m-p 0.0160 8.0000 0.0001 +++++ 297.443704 m 8.0000 151 | 6/9
11 h-m-p 0.0022 1.0857 1.0488 -----------Y 297.443704 0 0.0000 177 | 6/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 297.443704 m 8.0000 192 | 6/9
13 h-m-p 0.0020 1.0146 0.2932 +++++ 297.443684 m 1.0146 210 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 +Y 297.443684 0 4.3333 226 | 7/9
15 h-m-p 0.7500 8.0000 0.0000 ------Y 297.443684 0 0.0000 246
Out..
lnL = -297.443684
247 lfun, 741 eigenQcodon, 2964 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.031754 0.042356 0.010557 0.049261 0.017725 0.055932 951.362042 0.863166 0.492315 0.335204 530.355436
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000225
np = 11
lnL0 = -305.970456
Iterating by ming2
Initial: fx= 305.970456
x= 0.03175 0.04236 0.01056 0.04926 0.01772 0.05593 951.36204 0.86317 0.49231 0.33520 530.35544
1 h-m-p 0.0000 0.0004 60.3956 +++ 304.311354 m 0.0004 17 | 1/11
2 h-m-p 0.0043 0.1087 5.0842 +++ 302.106698 m 0.1087 32 | 2/11
3 h-m-p 0.0000 0.0001 1399.3746 ++ 301.756369 m 0.0001 46 | 3/11
4 h-m-p 0.0001 0.0005 238.6824 ++ 301.237615 m 0.0005 60 | 4/11
5 h-m-p 0.0000 0.0002 2692.7128 ++ 300.530092 m 0.0002 74 | 5/11
6 h-m-p 0.0324 0.6683 13.7079 +++ 297.444057 m 0.6683 89 | 6/11
7 h-m-p 1.6000 8.0000 0.0013 ++ 297.444047 m 8.0000 103 | 6/11
8 h-m-p 0.0337 3.5725 0.2985 ++++ 297.443676 m 3.5725 124 | 7/11
9 h-m-p 1.6000 8.0000 0.0865 ++ 297.443670 m 8.0000 143 | 7/11
10 h-m-p 0.4142 8.0000 1.6718 -------------Y 297.443670 0 0.0000 174 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 297.443670 m 8.0000 191 | 7/11
12 h-m-p 0.0160 8.0000 0.3732 +++++ 297.443651 m 8.0000 212 | 7/11
13 h-m-p 1.6000 8.0000 1.3625 C 297.443648 0 0.5328 230 | 7/11
14 h-m-p 1.6000 8.0000 0.0390 Y 297.443648 0 0.8477 244 | 7/11
15 h-m-p 1.6000 8.0000 0.0001 ++ 297.443648 m 8.0000 262 | 7/11
16 h-m-p 0.0160 8.0000 0.0459 +++Y 297.443648 0 2.0155 283 | 7/11
17 h-m-p 1.6000 8.0000 0.0034 ++ 297.443647 m 8.0000 301 | 7/11
18 h-m-p 0.0160 8.0000 2.3462 ----------Y 297.443647 0 0.0000 329 | 7/11
19 h-m-p 0.0160 8.0000 6.9053 +++++ 297.443465 m 8.0000 346 | 7/11
20 h-m-p 1.6000 8.0000 0.0011 ++ 297.443465 m 8.0000 360 | 7/11
21 h-m-p 0.2061 8.0000 0.0423 +++ 297.443465 m 8.0000 379 | 7/11
22 h-m-p 0.1062 8.0000 3.1842 ++++ 297.443465 m 8.0000 399 | 7/11
23 h-m-p 0.8610 6.2719 29.5859 ------------Y 297.443465 0 0.0000 425 | 7/11
24 h-m-p 1.6000 8.0000 0.0000 Y 297.443465 0 0.4000 439 | 7/11
25 h-m-p 1.6000 8.0000 0.0000 -Y 297.443465 0 0.1000 458
Out..
lnL = -297.443465
459 lfun, 1836 eigenQcodon, 8262 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -297.441863 S = -297.441855 -0.000003
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:04
did 20 / 39 patterns 0:04
did 30 / 39 patterns 0:04
did 39 / 39 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.053284 0.061870 0.037791 0.037376 0.048351 0.050046 979.423566 0.370331 1.596881
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.039193
np = 9
lnL0 = -322.050600
Iterating by ming2
Initial: fx= 322.050600
x= 0.05328 0.06187 0.03779 0.03738 0.04835 0.05005 979.42357 0.37033 1.59688
1 h-m-p 0.0000 0.0005 200.6410 +++ 303.312946 m 0.0005 15 | 1/9
2 h-m-p 0.0000 0.0001 53.3998 ++ 303.124548 m 0.0001 27 | 2/9
3 h-m-p 0.0001 0.0007 36.9903 ++ 298.946442 m 0.0007 39 | 3/9
4 h-m-p 0.0001 0.0004 7.9856 ++ 298.933421 m 0.0004 51 | 4/9
5 h-m-p 0.0000 0.0001 53.7399 ++ 298.568472 m 0.0001 63 | 5/9
6 h-m-p 0.0002 0.0049 6.3951 +++ 297.443973 m 0.0049 76 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 297.443973 m 8.0000 88 | 6/9
8 h-m-p 0.0024 1.1925 1.8360 +++++ 297.443684 m 1.1925 106 | 7/9
9 h-m-p 1.6000 8.0000 0.0000 C 297.443684 0 1.6000 118 | 7/9
10 h-m-p 0.0160 8.0000 0.0000 C 297.443684 0 0.0134 132
Out..
lnL = -297.443684
133 lfun, 1463 eigenQcodon, 7980 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.104572 0.084702 0.027277 0.084913 0.048592 0.020377 979.423564 0.900000 0.504582 1.190803 503.654253
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000457
np = 11
lnL0 = -304.473110
Iterating by ming2
Initial: fx= 304.473110
x= 0.10457 0.08470 0.02728 0.08491 0.04859 0.02038 979.42356 0.90000 0.50458 1.19080 503.65425
1 h-m-p 0.0000 0.0020 51.8273 +++CYYYCYYCCC 300.701334 10 0.0016 34 | 0/11
2 h-m-p 0.0003 0.0015 15.0222 ++ 300.371557 m 0.0015 48 | 1/11
3 h-m-p 0.0017 0.0083 7.5708 ++ 299.738315 m 0.0083 62 | 2/11
4 h-m-p 0.0000 0.0001 1050.8211 ++ 298.969537 m 0.0001 76 | 3/11
5 h-m-p 0.0033 0.0163 2.5284 ++ 298.537019 m 0.0163 90 | 4/11
6 h-m-p 0.0004 0.0018 12.6380 ++ 297.936825 m 0.0018 104 | 5/11
7 h-m-p 0.0414 0.2156 0.2940 ++ 297.443508 m 0.2156 118 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 297.443508 m 8.0000 138 | 6/11
9 h-m-p 0.0160 8.0000 0.0309 +++++ 297.443473 m 8.0000 160 | 6/11
10 h-m-p 1.6000 8.0000 0.0104 ++ 297.443471 m 8.0000 179 | 6/11
11 h-m-p 0.6130 8.0000 0.1363 ++ 297.443466 m 8.0000 198 | 6/11
12 h-m-p 1.6000 8.0000 0.0824 ++ 297.443465 m 8.0000 217 | 6/11
13 h-m-p 0.3746 1.8730 0.6060 +
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
+ 297.443465 m 1.8730 236
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31326, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31296, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
14 h-m-p 0.0000 0.0000 0.8472
h-m-p: 2.69460701e-18 1.34730350e-17 8.47230669e-01 297.443465
..
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31326, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31296, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
C 297.443465 0 0.0040 271
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31326, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31296, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
16 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
Y 297.443465 0 0.0003 292
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -297.443465
293 lfun, 3516 eigenQcodon, 19338 P(t)
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -297.441871 S = -297.441857 -0.000006
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 39 patterns 0:11
did 20 / 39 patterns 0:12
did 30 / 39 patterns 0:12
did 39 / 39 patterns 0:12
QuantileBeta(0.85, 3.31311, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:12
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=77
NC_011896_1_WP_010907813_1_603_MLBR_RS02850 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NC_002677_1_NP_301489_1_361_secG MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
**************************************************
NC_011896_1_WP_010907813_1_603_MLBR_RS02850 NLDRLTLFVTGIWLVSIIGVALLTKYR
NC_002677_1_NP_301489_1_361_secG NLDRLTLFVTGIWLVSIIGVALLTKYR
NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285 NLDRLTLFVTGIWLVSIIGVALLTKYR
NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540 NLDRLTLFVTGIWLVSIIGVALLTKYR
NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145 NLDRLTLFVTGIWLVSIIGVALLTKYR
NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235 NLDRLTLFVTGIWLVSIIGVALLTKYR
***************************
>NC_011896_1_WP_010907813_1_603_MLBR_RS02850 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT TATCGGCGTAGCCCTGCTAACTAAATACCGT >NC_002677_1_NP_301489_1_361_secG ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT TATCGGCGTAGCCCTGCTAACTAAATACCGT >NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT TATCGGCGTAGCCCTGCTAACTAAATACCGT >NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT TATCGGCGTAGCCCTGCTAACTAAATACCGT >NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT TATCGGCGTAGCCCTGCTAACTAAATACCGT >NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235 ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT TATCGGCGTAGCCCTGCTAACTAAATACCGT
>NC_011896_1_WP_010907813_1_603_MLBR_RS02850 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK NLDRLTLFVTGIWLVSIIGVALLTKYR >NC_002677_1_NP_301489_1_361_secG MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK NLDRLTLFVTGIWLVSIIGVALLTKYR >NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK NLDRLTLFVTGIWLVSIIGVALLTKYR >NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK NLDRLTLFVTGIWLVSIIGVALLTKYR >NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK NLDRLTLFVTGIWLVSIIGVALLTKYR >NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235 MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK NLDRLTLFVTGIWLVSIIGVALLTKYR
#NEXUS
[ID: 0425343050]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907813_1_603_MLBR_RS02850
NC_002677_1_NP_301489_1_361_secG
NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285
NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540
NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145
NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907813_1_603_MLBR_RS02850,
2 NC_002677_1_NP_301489_1_361_secG,
3 NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285,
4 NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540,
5 NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145,
6 NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06857078,2:0.06874802,3:0.06817726,4:0.06762462,5:0.06922991,6:0.06892916);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06857078,2:0.06874802,3:0.06817726,4:0.06762462,5:0.06922991,6:0.06892916);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -316.58 -320.82
2 -316.56 -321.50
--------------------------------------
TOTAL -316.57 -321.22
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.884991 0.088870 0.372568 1.486494 0.848733 1151.18 1248.86 1.000
r(A<->C){all} 0.164010 0.017891 0.000141 0.424871 0.129783 143.84 158.73 1.006
r(A<->G){all} 0.163601 0.019046 0.000029 0.436627 0.129349 242.64 275.45 1.000
r(A<->T){all} 0.163587 0.018602 0.000014 0.439088 0.132149 201.87 215.14 1.000
r(C<->G){all} 0.169234 0.019252 0.000005 0.440734 0.136021 176.67 182.08 1.003
r(C<->T){all} 0.173853 0.020658 0.000165 0.467439 0.135131 151.44 171.91 1.000
r(G<->T){all} 0.165715 0.019161 0.000134 0.438866 0.134164 213.01 252.77 1.002
pi(A){all} 0.169777 0.000587 0.122379 0.217060 0.168673 1142.31 1205.99 1.000
pi(C){all} 0.251185 0.000785 0.195625 0.305239 0.250501 1277.45 1303.36 1.000
pi(G){all} 0.315517 0.000924 0.255047 0.372915 0.315347 1266.64 1295.14 1.000
pi(T){all} 0.263521 0.000808 0.209767 0.320148 0.262995 1312.39 1406.69 1.000
alpha{1,2} 0.419431 0.223093 0.000180 1.370737 0.254492 770.77 1030.31 1.000
alpha{3} 0.445868 0.226961 0.000172 1.403514 0.287029 1314.36 1355.74 1.000
pinvar{all} 0.992879 0.000076 0.976604 0.999997 0.995721 1086.88 1189.41 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/secG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 77
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 2 2 2 2 2 2 | TCC 3 3 3 3 3 3 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 5 5 5 5 5 5 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 2 2 2 2 2 2
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 1 1 1 1 1 1 | CGC 0 0 0 0 0 0
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 8 8 8 8 8 8 | CCG 0 0 0 0 0 0 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 3 3 3 3 3 3 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 3 3 3 3 3 3 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 1 1 1 1 | Ala GCT 0 0 0 0 0 0 | Asp GAT 0 0 0 0 0 0 | Gly GGT 3 3 3 3 3 3
GTC 2 2 2 2 2 2 | GCC 2 2 2 2 2 2 | GAC 1 1 1 1 1 1 | GGC 4 4 4 4 4 4
GTA 4 4 4 4 4 4 | GCA 0 0 0 0 0 0 | Glu GAA 0 0 0 0 0 0 | GGA 1 1 1 1 1 1
GTG 4 4 4 4 4 4 | GCG 1 1 1 1 1 1 | GAG 2 2 2 2 2 2 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907813_1_603_MLBR_RS02850
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
#2: NC_002677_1_NP_301489_1_361_secG
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
#3: NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
#4: NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
#5: NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
#6: NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 12 | TCC 18 | TAC 6 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 30 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 12
CTC 6 | CCC 0 | CAC 6 | CGC 0
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 48 | CCG 0 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 24 | ACC 18 | AAC 6 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 6 | ACG 18 | AAG 12 | AGG 0
------------------------------------------------------------------------------
Val V GTT 6 | Ala A GCT 0 | Asp D GAT 0 | Gly G GGT 18
GTC 12 | GCC 12 | GAC 6 | GGC 24
GTA 24 | GCA 0 | Glu E GAA 0 | GGA 6
GTG 24 | GCG 6 | GAG 12 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19481 C:0.22078 A:0.24675 G:0.33766
position 2: T:0.46753 C:0.19481 A:0.14286 G:0.19481
position 3: T:0.12987 C:0.33766 A:0.11688 G:0.41558
Average T:0.26407 C:0.25108 A:0.16883 G:0.31602
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -297.443465 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 999.000000 503.654253
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907813_1_603_MLBR_RS02850: 0.000004, NC_002677_1_NP_301489_1_361_secG: 0.000004, NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285: 0.000004, NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540: 0.000004, NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145: 0.000004, NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 999.00000
omega (dN/dS) = 503.65425
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 163.9 67.1 503.6543 0.0000 0.0000 0.0 0.0
7..2 0.000 163.9 67.1 503.6543 0.0000 0.0000 0.0 0.0
7..3 0.000 163.9 67.1 503.6543 0.0000 0.0000 0.0 0.0
7..4 0.000 163.9 67.1 503.6543 0.0000 0.0000 0.0 0.0
7..5 0.000 163.9 67.1 503.6543 0.0000 0.0000 0.0 0.0
7..6 0.000 163.9 67.1 503.6543 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -297.443684 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 951.362042 0.590251 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907813_1_603_MLBR_RS02850: 0.000004, NC_002677_1_NP_301489_1_361_secG: 0.000004, NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285: 0.000004, NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540: 0.000004, NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145: 0.000004, NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 951.36204
MLEs of dN/dS (w) for site classes (K=2)
p: 0.59025 0.40975
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -297.443465 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 979.423566 0.000000 0.000000 1.000000 540.127547
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907813_1_603_MLBR_RS02850: 0.000004, NC_002677_1_NP_301489_1_361_secG: 0.000004, NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285: 0.000004, NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540: 0.000004, NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145: 0.000004, NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 979.42357
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 540.12755
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 163.9 67.1 540.1275 0.0000 0.0000 0.0 0.0
7..2 0.000 163.9 67.1 540.1275 0.0000 0.0000 0.0 0.0
7..3 0.000 163.9 67.1 540.1275 0.0000 0.0000 0.0 0.0
7..4 0.000 163.9 67.1 540.1275 0.0000 0.0000 0.0 0.0
7..5 0.000 163.9 67.1 540.1275 0.0000 0.0000 0.0 0.0
7..6 0.000 163.9 67.1 540.1275 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907813_1_603_MLBR_RS02850)
Pr(w>1) post mean +- SE for w
1 M 1.000** 540.128
2 E 1.000** 540.128
3 L 1.000** 540.128
4 A 1.000** 540.128
5 L 1.000** 540.128
6 Q 1.000** 540.128
7 I 1.000** 540.128
8 T 1.000** 540.128
9 L 1.000** 540.128
10 V 1.000** 540.128
11 V 1.000** 540.128
12 T 1.000** 540.128
13 S 1.000** 540.128
14 I 1.000** 540.128
15 L 1.000** 540.128
16 V 1.000** 540.128
17 V 1.000** 540.128
18 L 1.000** 540.128
19 L 1.000** 540.128
20 V 1.000** 540.128
21 L 1.000** 540.128
22 L 1.000** 540.128
23 H 1.000** 540.128
24 R 1.000** 540.128
25 A 1.000** 540.128
26 K 1.000** 540.128
27 G 1.000** 540.128
28 G 1.000** 540.128
29 G 1.000** 540.128
30 L 1.000** 540.128
31 S 1.000** 540.128
32 T 1.000** 540.128
33 L 1.000** 540.128
34 F 1.000** 540.128
35 G 1.000** 540.128
36 G 1.000** 540.128
37 G 1.000** 540.128
38 V 1.000** 540.128
39 Q 1.000** 540.128
40 S 1.000** 540.128
41 S 1.000** 540.128
42 L 1.000** 540.128
43 S 1.000** 540.128
44 G 1.000** 540.128
45 S 1.000** 540.128
46 T 1.000** 540.128
47 V 1.000** 540.128
48 V 1.000** 540.128
49 E 1.000** 540.128
50 K 1.000** 540.128
51 N 1.000** 540.128
52 L 1.000** 540.128
53 D 1.000** 540.128
54 R 1.000** 540.128
55 L 1.000** 540.128
56 T 1.000** 540.128
57 L 1.000** 540.128
58 F 1.000** 540.128
59 V 1.000** 540.128
60 T 1.000** 540.128
61 G 1.000** 540.128
62 I 1.000** 540.128
63 W 1.000** 540.128
64 L 1.000** 540.128
65 V 1.000** 540.128
66 S 1.000** 540.128
67 I 1.000** 540.128
68 I 1.000** 540.128
69 G 1.000** 540.128
70 V 1.000** 540.128
71 A 1.000** 540.128
72 L 1.000** 540.128
73 L 1.000** 540.128
74 T 1.000** 540.128
75 K 1.000** 540.128
76 Y 1.000** 540.128
77 R 1.000** 540.128
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907813_1_603_MLBR_RS02850)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -297.443684 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 979.423564 1.929950 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907813_1_603_MLBR_RS02850: 0.000004, NC_002677_1_NP_301489_1_361_secG: 0.000004, NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285: 0.000004, NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540: 0.000004, NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145: 0.000004, NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 979.42356
Parameters in M7 (beta):
p = 1.92995 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 163.9 67.1 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -297.443465 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 979.423641 0.296135 3.313112 0.005000 503.649277
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907813_1_603_MLBR_RS02850: 0.000004, NC_002677_1_NP_301489_1_361_secG: 0.000004, NZ_LVXE01000026_1_WP_010907813_1_1086_A3216_RS08285: 0.000004, NZ_LYPH01000029_1_WP_010907813_1_1154_A8144_RS05540: 0.000004, NZ_CP029543_1_WP_010907813_1_617_DIJ64_RS03145: 0.000004, NZ_AP014567_1_WP_010907813_1_635_JK2ML_RS03235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 979.42364
Parameters in M8 (beta&w>1):
p0 = 0.29613 p = 3.31311 q = 0.00500
(p1 = 0.70387) w = 503.64928
MLEs of dN/dS (w) for site classes (K=11)
p: 0.02961 0.02961 0.02961 0.02961 0.02961 0.02961 0.02961 0.02961 0.02961 0.02961 0.70387
w: 0.99999 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 503.64928
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 163.9 67.1 354.7973 0.0000 0.0000 0.0 0.0
7..2 0.000 163.9 67.1 354.7973 0.0000 0.0000 0.0 0.0
7..3 0.000 163.9 67.1 354.7973 0.0000 0.0000 0.0 0.0
7..4 0.000 163.9 67.1 354.7973 0.0000 0.0000 0.0 0.0
7..5 0.000 163.9 67.1 354.7973 0.0000 0.0000 0.0 0.0
7..6 0.000 163.9 67.1 354.7973 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907813_1_603_MLBR_RS02850)
Pr(w>1) post mean +- SE for w
1 M 0.704 354.789
2 E 0.704 354.794
3 L 0.704 354.796
4 A 0.704 354.792
5 L 0.704 354.796
6 Q 0.704 354.796
7 I 0.704 354.792
8 T 0.704 354.792
9 L 0.704 354.796
10 V 0.704 354.795
11 V 0.704 354.792
12 T 0.704 354.792
13 S 0.704 354.794
14 I 0.704 354.792
15 L 0.704 354.794
16 V 0.704 354.796
17 V 0.704 354.791
18 L 0.704 354.796
19 L 0.704 354.797
20 V 0.704 354.796
21 L 0.704 354.796
22 L 0.704 354.796
23 H 0.704 354.795
24 R 0.704 354.797
25 A 0.704 354.790
26 K 0.704 354.794
27 G 0.704 354.796
28 G 0.704 354.796
29 G 0.704 354.795
30 L 0.704 354.796
31 S 0.704 354.793
32 T 0.704 354.791
33 L 0.704 354.796
34 F 0.704 354.793
35 G 0.704 354.795
36 G 0.704 354.796
37 G 0.704 354.795
38 V 0.704 354.791
39 Q 0.704 354.797
40 S 0.704 354.794
41 S 0.704 354.796
42 L 0.704 354.796
43 S 0.704 354.794
44 G 0.704 354.794
45 S 0.704 354.793
46 T 0.704 354.791
47 V 0.704 354.791
48 V 0.704 354.791
49 E 0.704 354.794
50 K 0.704 354.794
51 N 0.704 354.795
52 L 0.704 354.796
53 D 0.704 354.794
54 R 0.704 354.795
55 L 0.704 354.796
56 T 0.704 354.791
57 L 0.704 354.796
58 F 0.704 354.793
59 V 0.704 354.792
60 T 0.704 354.792
61 G 0.704 354.796
62 I 0.704 354.792
63 W 0.704 354.796
64 L 0.704 354.796
65 V 0.704 354.796
66 S 0.704 354.794
67 I 0.704 354.795
68 I 0.704 354.792
69 G 0.704 354.795
70 V 0.704 354.796
71 A 0.704 354.792
72 L 0.704 354.796
73 L 0.704 354.797
74 T 0.704 354.795
75 K 0.704 354.796
76 Y 0.704 354.795
77 R 0.704 354.797
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907813_1_603_MLBR_RS02850)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:12
Model 1: NearlyNeutral -297.443684 Model 2: PositiveSelection -297.443465 Model 0: one-ratio -297.443465 Model 7: beta -297.443684 Model 8: beta&w>1 -297.443465 Model 0 vs 1 4.380000000310247E-4 Model 2 vs 1 4.380000000310247E-4 Model 8 vs 7 4.380000000310247E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
