--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:18:58 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/secG/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -316.58          -320.82
2       -316.56          -321.50
--------------------------------------
TOTAL     -316.57          -321.22
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.884991    0.088870    0.372568    1.486494    0.848733   1151.18   1248.86    1.000
r(A<->C){all}   0.164010    0.017891    0.000141    0.424871    0.129783    143.84    158.73    1.006
r(A<->G){all}   0.163601    0.019046    0.000029    0.436627    0.129349    242.64    275.45    1.000
r(A<->T){all}   0.163587    0.018602    0.000014    0.439088    0.132149    201.87    215.14    1.000
r(C<->G){all}   0.169234    0.019252    0.000005    0.440734    0.136021    176.67    182.08    1.003
r(C<->T){all}   0.173853    0.020658    0.000165    0.467439    0.135131    151.44    171.91    1.000
r(G<->T){all}   0.165715    0.019161    0.000134    0.438866    0.134164    213.01    252.77    1.002
pi(A){all}      0.169777    0.000587    0.122379    0.217060    0.168673   1142.31   1205.99    1.000
pi(C){all}      0.251185    0.000785    0.195625    0.305239    0.250501   1277.45   1303.36    1.000
pi(G){all}      0.315517    0.000924    0.255047    0.372915    0.315347   1266.64   1295.14    1.000
pi(T){all}      0.263521    0.000808    0.209767    0.320148    0.262995   1312.39   1406.69    1.000
alpha{1,2}      0.419431    0.223093    0.000180    1.370737    0.254492    770.77   1030.31    1.000
alpha{3}        0.445868    0.226961    0.000172    1.403514    0.287029   1314.36   1355.74    1.000
pinvar{all}     0.992879    0.000076    0.976604    0.999997    0.995721   1086.88   1189.41    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-297.443684
Model 2: PositiveSelection	-297.443465
Model 0: one-ratio	-297.443465
Model 7: beta	-297.443684
Model 8: beta&w>1	-297.443465


Model 0 vs 1	4.380000000310247E-4

Model 2 vs 1	4.380000000310247E-4

Model 8 vs 7	4.380000000310247E-4
>C1
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C2
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C3
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C4
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C5
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C6
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=77 

C1              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C2              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C3              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C4              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C5              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C6              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
                **************************************************

C1              NLDRLTLFVTGIWLVSIIGVALLTKYR
C2              NLDRLTLFVTGIWLVSIIGVALLTKYR
C3              NLDRLTLFVTGIWLVSIIGVALLTKYR
C4              NLDRLTLFVTGIWLVSIIGVALLTKYR
C5              NLDRLTLFVTGIWLVSIIGVALLTKYR
C6              NLDRLTLFVTGIWLVSIIGVALLTKYR
                ***************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   77 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   77 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2310]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2310]--->[2310]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.432 Mb, Max= 30.582 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C2              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C3              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C4              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C5              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
C6              MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
                **************************************************

C1              NLDRLTLFVTGIWLVSIIGVALLTKYR
C2              NLDRLTLFVTGIWLVSIIGVALLTKYR
C3              NLDRLTLFVTGIWLVSIIGVALLTKYR
C4              NLDRLTLFVTGIWLVSIIGVALLTKYR
C5              NLDRLTLFVTGIWLVSIIGVALLTKYR
C6              NLDRLTLFVTGIWLVSIIGVALLTKYR
                ***************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C2              ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C3              ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C4              ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C5              ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
C6              ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
                **************************************************

C1              GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C2              GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C3              GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C4              GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C5              GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
C6              GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
                **************************************************

C1              TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C2              TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C3              TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C4              TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C5              TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
C6              TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
                **************************************************

C1              AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C2              AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C3              AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C4              AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C5              AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
C6              AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
                **************************************************

C1              TATCGGCGTAGCCCTGCTAACTAAATACCGT
C2              TATCGGCGTAGCCCTGCTAACTAAATACCGT
C3              TATCGGCGTAGCCCTGCTAACTAAATACCGT
C4              TATCGGCGTAGCCCTGCTAACTAAATACCGT
C5              TATCGGCGTAGCCCTGCTAACTAAATACCGT
C6              TATCGGCGTAGCCCTGCTAACTAAATACCGT
                *******************************



>C1
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C2
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C3
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C4
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C5
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C6
ATGGAGTTGGCCCTGCAGATCACCCTGGTTGTCACCAGCATCCTCGTAGT
GTTGTTAGTACTTTTGCACCGTGCGAAGGGTGGTGGCCTGTCGACGTTGT
TCGGCGGTGGCGTGCAATCCAGTCTGTCCGGGTCGACGGTGGTGGAGAAG
AACCTGGACCGGTTGACGCTGTTCGTCACCGGAATCTGGCTGGTATCCAT
TATCGGCGTAGCCCTGCTAACTAAATACCGT
>C1
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C2
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C3
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C4
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C5
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR
>C6
MELALQITLVVTSILVVLLVLLHRAKGGGLSTLFGGGVQSSLSGSTVVEK
NLDRLTLFVTGIWLVSIIGVALLTKYR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 231 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789066
      Setting output file names to "/data/12res/secG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2101055562
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0425343050
      Seed = 1502308910
      Swapseed = 1579789066
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -516.989042 -- -24.965149
         Chain 2 -- -516.989042 -- -24.965149
         Chain 3 -- -516.989072 -- -24.965149
         Chain 4 -- -516.989072 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -516.989042 -- -24.965149
         Chain 2 -- -516.989042 -- -24.965149
         Chain 3 -- -516.989072 -- -24.965149
         Chain 4 -- -516.989042 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-516.989] (-516.989) (-516.989) (-516.989) * [-516.989] (-516.989) (-516.989) (-516.989) 
        500 -- (-318.491) (-328.086) [-321.594] (-328.042) * [-330.869] (-332.657) (-325.984) (-326.316) -- 0:00:00
       1000 -- (-326.288) (-335.902) [-331.717] (-326.272) * (-328.795) (-324.060) (-328.343) [-324.291] -- 0:00:00
       1500 -- (-327.259) (-321.727) [-326.113] (-329.003) * (-324.987) (-328.956) (-335.838) [-327.269] -- 0:00:00
       2000 -- (-330.467) [-329.626] (-328.866) (-326.729) * (-323.900) [-325.588] (-332.618) (-325.631) -- 0:00:00
       2500 -- (-330.097) (-328.401) [-325.206] (-329.642) * [-322.871] (-325.127) (-329.400) (-331.966) -- 0:00:00
       3000 -- [-321.337] (-329.192) (-323.385) (-324.488) * (-321.437) (-325.637) [-330.239] (-324.307) -- 0:00:00
       3500 -- (-335.407) (-320.567) [-325.845] (-322.445) * (-328.684) [-318.542] (-319.994) (-323.797) -- 0:00:00
       4000 -- (-325.717) (-321.927) [-325.294] (-325.622) * [-327.855] (-321.499) (-327.966) (-323.782) -- 0:00:00
       4500 -- [-322.980] (-323.778) (-327.023) (-322.535) * [-322.258] (-332.289) (-327.926) (-328.250) -- 0:00:00
       5000 -- [-323.715] (-333.932) (-334.257) (-332.082) * (-322.896) (-327.110) (-328.323) [-327.431] -- 0:00:00

      Average standard deviation of split frequencies: 0.099995

       5500 -- (-326.274) [-326.235] (-325.865) (-323.388) * [-328.143] (-327.477) (-325.014) (-323.651) -- 0:00:00
       6000 -- [-322.742] (-324.383) (-330.504) (-336.626) * (-335.623) (-326.280) [-331.050] (-324.852) -- 0:00:00
       6500 -- [-327.487] (-330.187) (-327.354) (-325.780) * (-328.032) (-338.960) [-326.613] (-328.805) -- 0:00:00
       7000 -- [-324.794] (-336.249) (-325.449) (-325.833) * (-324.995) (-337.954) (-330.818) [-321.563] -- 0:00:00
       7500 -- [-324.444] (-327.959) (-322.975) (-326.860) * (-328.200) (-334.506) [-327.974] (-324.593) -- 0:00:00
       8000 -- (-322.317) (-325.530) [-329.887] (-326.301) * [-328.525] (-350.844) (-324.112) (-328.589) -- 0:00:00
       8500 -- (-326.324) [-326.583] (-329.994) (-327.720) * [-320.194] (-334.906) (-329.038) (-333.815) -- 0:00:00
       9000 -- (-338.240) (-331.886) [-324.617] (-324.463) * (-330.756) (-321.767) (-332.857) [-321.419] -- 0:00:00
       9500 -- (-329.855) (-331.231) (-327.416) [-322.536] * (-331.195) [-316.935] (-327.172) (-328.769) -- 0:00:00
      10000 -- [-327.295] (-324.612) (-325.122) (-332.931) * (-322.230) (-317.678) [-331.021] (-326.461) -- 0:00:00

      Average standard deviation of split frequencies: 0.079970

      10500 -- [-326.637] (-334.862) (-327.824) (-324.776) * (-331.493) (-317.089) (-343.886) [-320.601] -- 0:00:00
      11000 -- (-322.205) (-326.681) [-320.801] (-324.277) * (-326.781) (-316.335) (-332.156) [-327.965] -- 0:01:29
      11500 -- [-321.366] (-323.262) (-326.313) (-321.277) * (-325.458) (-316.170) [-329.976] (-321.721) -- 0:01:25
      12000 -- (-328.025) [-323.517] (-330.951) (-329.293) * [-324.667] (-316.371) (-323.418) (-317.711) -- 0:01:22
      12500 -- [-322.682] (-348.199) (-331.237) (-324.385) * (-330.122) (-315.769) [-328.865] (-317.236) -- 0:01:19
      13000 -- (-331.510) (-336.330) [-329.073] (-325.862) * [-330.020] (-318.122) (-325.969) (-317.423) -- 0:01:15
      13500 -- (-331.529) (-335.400) [-324.490] (-327.387) * (-327.276) (-315.608) (-320.351) [-318.143] -- 0:01:13
      14000 -- (-331.949) (-327.066) [-326.508] (-326.454) * [-322.271] (-317.603) (-330.264) (-317.461) -- 0:01:10
      14500 -- (-334.435) [-319.664] (-336.953) (-328.898) * (-321.471) [-319.423] (-335.709) (-318.342) -- 0:01:07
      15000 -- (-325.554) (-316.565) (-331.828) [-327.076] * (-326.977) [-319.173] (-338.159) (-320.165) -- 0:01:05

      Average standard deviation of split frequencies: 0.068230

      15500 -- (-332.821) (-316.194) [-325.431] (-330.360) * [-325.784] (-318.617) (-327.822) (-320.525) -- 0:01:03
      16000 -- [-328.700] (-318.690) (-338.258) (-330.009) * (-324.814) [-315.478] (-333.480) (-317.414) -- 0:01:01
      16500 -- (-326.602) [-318.905] (-327.568) (-328.438) * (-329.344) (-318.962) (-329.812) [-317.646] -- 0:00:59
      17000 -- (-325.802) (-319.382) [-328.664] (-328.533) * (-329.638) (-320.634) (-326.383) [-317.860] -- 0:00:57
      17500 -- (-329.602) (-321.287) [-320.157] (-329.615) * (-324.646) [-317.873] (-322.791) (-322.779) -- 0:00:56
      18000 -- [-325.659] (-317.501) (-327.912) (-319.019) * (-327.387) [-316.930] (-327.899) (-316.727) -- 0:00:54
      18500 -- [-318.861] (-317.208) (-326.372) (-324.636) * [-327.974] (-316.437) (-333.760) (-317.618) -- 0:00:53
      19000 -- (-322.573) (-317.063) (-327.754) [-328.946] * (-322.592) [-315.792] (-320.110) (-318.039) -- 0:00:51
      19500 -- (-319.088) (-320.220) (-327.255) [-327.696] * (-343.797) [-315.539] (-326.400) (-318.204) -- 0:00:50
      20000 -- (-325.584) (-317.330) (-326.908) [-332.084] * (-335.599) [-318.569] (-327.607) (-321.529) -- 0:00:49

      Average standard deviation of split frequencies: 0.060026

      20500 -- (-322.409) (-321.271) [-324.414] (-324.279) * (-334.983) [-316.701] (-326.907) (-320.950) -- 0:00:47
      21000 -- [-320.941] (-316.005) (-324.770) (-322.894) * (-337.845) [-316.482] (-326.985) (-316.142) -- 0:00:46
      21500 -- (-317.921) [-321.548] (-328.561) (-332.096) * (-327.448) (-316.743) (-327.327) [-317.777] -- 0:00:45
      22000 -- (-320.905) (-317.434) [-323.653] (-323.300) * (-326.449) (-318.237) (-329.099) [-317.820] -- 0:00:44
      22500 -- (-318.502) (-321.931) [-320.598] (-335.406) * [-323.067] (-317.421) (-323.575) (-317.140) -- 0:00:43
      23000 -- [-316.429] (-317.696) (-333.073) (-327.007) * (-320.851) [-316.534] (-320.798) (-319.472) -- 0:00:42
      23500 -- (-318.118) (-319.097) [-327.932] (-330.467) * (-316.719) (-317.832) (-325.597) [-318.146] -- 0:00:41
      24000 -- [-318.079] (-321.839) (-332.880) (-321.563) * (-317.994) [-318.746] (-323.746) (-319.374) -- 0:00:40
      24500 -- [-317.572] (-317.753) (-334.575) (-325.045) * (-316.708) [-315.490] (-340.337) (-316.126) -- 0:00:39
      25000 -- (-318.188) (-321.640) (-328.792) [-329.534] * (-320.452) [-315.150] (-333.817) (-318.560) -- 0:00:39

      Average standard deviation of split frequencies: 0.049213

      25500 -- (-319.239) (-317.263) (-328.845) [-323.272] * (-321.499) [-316.263] (-323.181) (-316.738) -- 0:00:38
      26000 -- (-316.736) [-318.606] (-333.163) (-321.997) * (-317.556) (-315.973) [-316.969] (-319.307) -- 0:01:14
      26500 -- (-317.954) (-316.559) [-329.924] (-327.912) * (-315.957) [-318.507] (-317.057) (-317.606) -- 0:01:13
      27000 -- (-317.351) (-316.895) (-329.892) [-330.372] * (-315.667) (-324.413) [-317.569] (-318.765) -- 0:01:12
      27500 -- (-317.179) [-318.046] (-322.023) (-341.781) * (-316.315) (-318.044) (-317.852) [-317.685] -- 0:01:10
      28000 -- (-316.718) [-316.066] (-329.431) (-315.213) * [-316.542] (-316.774) (-316.317) (-324.131) -- 0:01:09
      28500 -- (-315.342) (-316.818) (-328.332) [-316.213] * (-315.599) [-315.528] (-315.617) (-320.593) -- 0:01:08
      29000 -- (-315.838) (-316.361) (-323.368) [-316.545] * (-317.370) (-318.641) [-318.497] (-318.382) -- 0:01:06
      29500 -- [-318.601] (-318.851) (-321.242) (-315.561) * (-317.527) (-319.776) (-317.267) [-317.791] -- 0:01:05
      30000 -- (-315.672) (-316.824) (-333.435) [-315.605] * (-318.259) (-317.686) [-317.141] (-315.658) -- 0:01:04

      Average standard deviation of split frequencies: 0.036407

      30500 -- [-318.433] (-319.092) (-328.765) (-317.516) * (-317.316) [-316.962] (-318.444) (-316.455) -- 0:01:03
      31000 -- [-316.913] (-317.009) (-320.592) (-318.659) * (-319.253) [-316.162] (-316.936) (-315.825) -- 0:01:02
      31500 -- [-317.225] (-316.581) (-325.193) (-319.478) * [-315.376] (-315.941) (-319.253) (-316.336) -- 0:01:01
      32000 -- (-319.175) (-316.980) (-338.858) [-318.587] * (-316.901) [-315.368] (-320.916) (-317.139) -- 0:01:00
      32500 -- (-323.779) (-315.760) (-324.484) [-319.568] * (-319.926) (-318.382) [-320.404] (-319.533) -- 0:00:59
      33000 -- (-319.468) (-316.944) [-320.811] (-322.079) * (-318.816) (-317.294) (-317.018) [-316.052] -- 0:00:58
      33500 -- [-319.617] (-316.902) (-327.793) (-320.345) * [-320.061] (-316.891) (-319.992) (-317.298) -- 0:00:57
      34000 -- (-319.485) [-316.082] (-330.958) (-317.565) * (-317.820) [-316.790] (-317.966) (-317.007) -- 0:00:56
      34500 -- (-316.784) [-315.735] (-327.092) (-315.933) * (-318.795) (-316.606) (-316.782) [-317.515] -- 0:00:55
      35000 -- (-317.290) (-316.912) (-345.165) [-317.778] * (-318.657) (-316.045) [-316.565] (-316.192) -- 0:00:55

      Average standard deviation of split frequencies: 0.035542

      35500 -- [-320.773] (-316.660) (-341.855) (-316.474) * [-319.062] (-316.508) (-317.239) (-319.739) -- 0:00:54
      36000 -- (-317.883) [-315.853] (-329.036) (-320.066) * (-319.540) [-318.413] (-321.395) (-322.576) -- 0:00:53
      36500 -- (-316.816) [-315.839] (-319.746) (-318.869) * [-318.011] (-319.481) (-319.151) (-320.536) -- 0:00:52
      37000 -- (-319.404) [-316.737] (-323.999) (-317.167) * (-316.635) [-316.615] (-320.061) (-316.146) -- 0:00:52
      37500 -- [-320.552] (-317.263) (-315.749) (-316.665) * (-317.592) [-319.395] (-318.540) (-317.218) -- 0:00:51
      38000 -- (-317.944) [-320.612] (-316.186) (-315.894) * [-315.593] (-316.275) (-319.888) (-316.751) -- 0:00:50
      38500 -- (-316.357) (-320.141) [-318.888] (-316.354) * (-318.521) (-316.957) [-320.362] (-316.900) -- 0:00:49
      39000 -- [-317.799] (-316.350) (-317.937) (-318.634) * (-319.689) (-316.907) [-319.924] (-317.559) -- 0:00:49
      39500 -- (-319.725) (-316.731) [-317.279] (-316.883) * (-318.656) [-317.161] (-317.027) (-316.894) -- 0:00:48
      40000 -- (-317.257) (-319.368) [-317.557] (-318.762) * [-318.222] (-318.802) (-315.726) (-316.606) -- 0:00:48

      Average standard deviation of split frequencies: 0.030268

      40500 -- (-318.683) (-317.106) [-319.433] (-322.829) * (-319.950) (-317.777) (-316.588) [-320.249] -- 0:00:47
      41000 -- (-318.950) [-315.380] (-319.891) (-323.243) * (-317.378) [-317.228] (-315.578) (-316.046) -- 0:01:10
      41500 -- (-316.851) (-316.513) [-316.117] (-322.063) * (-315.107) [-318.524] (-316.877) (-316.552) -- 0:01:09
      42000 -- (-323.470) (-319.197) [-318.276] (-315.404) * (-315.573) [-315.847] (-315.774) (-318.954) -- 0:01:08
      42500 -- [-316.135] (-318.273) (-316.222) (-317.228) * (-316.458) (-316.312) [-316.575] (-319.327) -- 0:01:07
      43000 -- (-316.389) [-317.810] (-317.010) (-318.448) * [-318.413] (-316.166) (-316.682) (-322.647) -- 0:01:06
      43500 -- [-318.022] (-317.577) (-319.062) (-320.624) * (-317.636) (-318.060) [-317.167] (-321.898) -- 0:01:05
      44000 -- (-315.966) (-319.037) (-317.297) [-321.030] * [-316.668] (-316.563) (-318.073) (-322.052) -- 0:01:05
      44500 -- (-318.260) [-317.265] (-316.942) (-316.737) * (-316.194) (-317.294) [-318.387] (-315.250) -- 0:01:04
      45000 -- (-317.217) [-317.684] (-316.398) (-316.560) * (-317.071) (-316.461) [-318.404] (-316.666) -- 0:01:03

      Average standard deviation of split frequencies: 0.031283

      45500 -- (-318.227) [-319.057] (-319.529) (-319.333) * (-317.048) (-316.180) [-317.555] (-318.813) -- 0:01:02
      46000 -- (-318.682) (-316.188) [-317.136] (-316.313) * (-319.582) (-317.515) [-317.700] (-320.223) -- 0:01:02
      46500 -- (-319.962) [-319.445] (-317.050) (-318.335) * (-318.609) [-318.288] (-318.252) (-318.157) -- 0:01:01
      47000 -- [-316.843] (-322.077) (-317.973) (-317.590) * (-319.898) [-315.134] (-316.529) (-320.469) -- 0:01:00
      47500 -- [-318.094] (-318.003) (-318.506) (-318.310) * (-316.481) [-317.306] (-318.868) (-321.696) -- 0:01:00
      48000 -- (-319.081) (-318.973) [-315.677] (-317.270) * (-316.647) (-317.598) [-318.373] (-318.383) -- 0:00:59
      48500 -- (-321.730) [-317.145] (-315.912) (-320.898) * (-316.367) [-315.534] (-323.630) (-317.950) -- 0:00:58
      49000 -- (-316.134) (-316.466) [-316.542] (-316.989) * (-316.691) [-317.530] (-317.353) (-320.811) -- 0:00:58
      49500 -- (-317.916) (-316.988) [-316.595] (-320.666) * (-318.862) (-320.966) [-318.398] (-317.367) -- 0:00:57
      50000 -- (-322.374) (-319.125) [-316.419] (-315.493) * (-320.157) (-317.728) [-317.037] (-315.169) -- 0:00:57

      Average standard deviation of split frequencies: 0.034425

      50500 -- [-319.184] (-317.925) (-316.977) (-319.750) * (-317.226) (-322.672) [-317.786] (-315.294) -- 0:00:56
      51000 -- (-318.029) (-315.654) (-315.376) [-316.285] * (-318.772) (-319.905) [-317.111] (-317.302) -- 0:00:55
      51500 -- [-315.545] (-317.420) (-318.724) (-316.147) * [-316.335] (-316.726) (-319.990) (-316.398) -- 0:00:55
      52000 -- [-319.273] (-317.519) (-320.916) (-319.585) * [-315.248] (-317.135) (-318.187) (-319.796) -- 0:00:54
      52500 -- (-326.405) (-317.130) [-318.840] (-316.650) * (-319.669) [-320.228] (-316.505) (-321.446) -- 0:00:54
      53000 -- (-318.945) (-316.262) [-315.950] (-318.903) * [-317.190] (-319.936) (-316.795) (-317.008) -- 0:00:53
      53500 -- (-317.856) [-318.575] (-318.426) (-316.847) * (-319.777) (-317.263) [-317.292] (-318.168) -- 0:00:53
      54000 -- (-316.767) (-315.869) [-317.853] (-318.121) * (-325.915) (-315.641) [-318.238] (-317.684) -- 0:00:52
      54500 -- (-318.072) [-317.649] (-316.981) (-316.299) * (-320.069) (-316.258) [-316.295] (-315.862) -- 0:00:52
      55000 -- (-318.351) [-317.810] (-315.964) (-316.979) * (-315.905) (-318.257) (-316.872) [-316.869] -- 0:00:51

      Average standard deviation of split frequencies: 0.037216

      55500 -- (-317.315) [-316.465] (-315.800) (-317.420) * (-316.023) [-317.730] (-317.920) (-317.300) -- 0:00:51
      56000 -- (-316.116) (-322.151) [-318.234] (-317.087) * (-316.118) [-317.687] (-318.105) (-317.582) -- 0:00:50
      56500 -- (-316.658) [-316.434] (-316.650) (-316.531) * (-316.098) [-316.985] (-316.602) (-321.291) -- 0:00:50
      57000 -- (-320.475) (-316.285) (-317.478) [-316.057] * (-317.080) (-315.872) [-317.492] (-320.185) -- 0:01:06
      57500 -- [-318.203] (-315.675) (-315.312) (-315.657) * (-316.458) [-315.517] (-322.018) (-316.092) -- 0:01:05
      58000 -- [-316.464] (-316.443) (-316.264) (-320.216) * (-315.947) (-315.908) [-324.765] (-319.088) -- 0:01:04
      58500 -- [-315.431] (-316.779) (-320.010) (-316.567) * [-319.028] (-317.879) (-327.031) (-319.585) -- 0:01:04
      59000 -- (-315.583) [-317.366] (-323.048) (-317.166) * (-315.801) (-317.397) (-315.577) [-316.854] -- 0:01:03
      59500 -- (-315.385) (-320.754) (-321.611) [-315.657] * (-318.930) [-321.949] (-320.039) (-320.473) -- 0:01:03
      60000 -- (-316.309) (-320.277) (-318.652) [-318.376] * [-315.173] (-321.911) (-315.725) (-319.016) -- 0:01:02

      Average standard deviation of split frequencies: 0.035989

      60500 -- (-315.715) (-321.018) [-316.561] (-316.663) * (-318.516) (-320.848) [-316.230] (-319.158) -- 0:01:02
      61000 -- [-315.567] (-315.493) (-318.565) (-316.798) * (-318.716) (-317.850) (-315.579) [-316.777] -- 0:01:01
      61500 -- (-316.099) (-316.288) (-316.360) [-316.111] * (-317.526) (-318.552) (-317.548) [-316.488] -- 0:01:01
      62000 -- (-316.926) (-318.302) [-316.492] (-316.294) * [-318.298] (-319.343) (-316.388) (-318.718) -- 0:01:00
      62500 -- (-317.884) (-316.564) (-317.291) [-316.145] * (-316.042) [-316.583] (-318.207) (-316.493) -- 0:01:00
      63000 -- (-319.371) (-318.252) [-318.306] (-318.867) * (-316.960) (-319.414) (-315.732) [-316.530] -- 0:00:59
      63500 -- (-317.240) [-316.236] (-320.073) (-315.352) * (-318.091) (-317.517) (-315.421) [-316.937] -- 0:00:58
      64000 -- (-316.680) [-316.733] (-318.305) (-317.831) * (-316.323) (-315.610) [-316.682] (-315.818) -- 0:00:58
      64500 -- (-322.355) (-316.528) [-315.210] (-317.518) * (-316.403) (-318.587) [-320.415] (-316.161) -- 0:00:58
      65000 -- (-316.088) (-315.658) [-315.232] (-316.337) * (-321.878) (-320.385) (-318.339) [-314.992] -- 0:00:57

      Average standard deviation of split frequencies: 0.029322

      65500 -- (-320.214) (-317.109) (-315.285) [-316.979] * (-318.230) [-316.665] (-315.829) (-317.621) -- 0:00:57
      66000 -- (-317.892) (-317.564) (-318.446) [-317.939] * (-317.136) (-317.497) [-317.591] (-318.052) -- 0:00:56
      66500 -- (-316.846) [-315.345] (-318.405) (-317.090) * (-317.784) (-319.036) [-318.841] (-316.295) -- 0:00:56
      67000 -- (-318.313) (-317.731) [-318.180] (-317.702) * (-316.163) (-316.938) [-319.997] (-316.946) -- 0:00:55
      67500 -- (-317.558) (-319.284) [-316.734] (-319.121) * (-316.576) [-317.211] (-319.849) (-319.252) -- 0:00:55
      68000 -- (-319.794) (-319.698) [-317.763] (-317.707) * [-315.822] (-322.031) (-316.535) (-315.863) -- 0:00:54
      68500 -- [-320.118] (-317.507) (-315.895) (-317.153) * (-319.327) (-321.175) (-316.239) [-315.292] -- 0:00:54
      69000 -- (-316.984) [-316.541] (-316.885) (-319.915) * (-318.776) (-321.806) [-316.806] (-318.228) -- 0:00:53
      69500 -- (-316.752) (-317.001) [-316.168] (-316.958) * (-318.008) (-320.806) [-320.893] (-318.369) -- 0:00:53
      70000 -- (-317.626) (-315.552) (-316.132) [-315.579] * [-316.201] (-317.253) (-315.465) (-318.059) -- 0:00:53

      Average standard deviation of split frequencies: 0.025349

      70500 -- (-316.344) [-316.310] (-317.600) (-316.834) * (-316.272) [-315.345] (-316.073) (-316.137) -- 0:00:52
      71000 -- (-317.167) [-316.092] (-316.279) (-317.209) * (-315.766) (-316.606) (-318.655) [-315.431] -- 0:00:52
      71500 -- [-318.049] (-315.504) (-315.262) (-316.995) * (-317.358) [-318.161] (-320.420) (-317.911) -- 0:00:51
      72000 -- (-317.494) (-319.205) (-315.311) [-320.681] * (-316.048) [-320.877] (-316.467) (-319.018) -- 0:00:51
      72500 -- [-319.554] (-321.334) (-316.737) (-317.230) * (-316.039) (-319.304) (-317.229) [-319.175] -- 0:00:51
      73000 -- (-316.514) [-317.914] (-316.845) (-316.863) * (-316.211) (-317.708) [-319.659] (-317.616) -- 0:00:50
      73500 -- (-318.253) [-319.807] (-316.861) (-317.834) * [-317.248] (-317.952) (-320.938) (-318.247) -- 0:01:03
      74000 -- (-322.097) [-319.241] (-317.739) (-315.611) * [-315.671] (-318.108) (-316.250) (-317.961) -- 0:01:02
      74500 -- (-319.663) (-317.597) [-316.320] (-318.806) * (-317.285) (-317.479) [-318.922] (-319.047) -- 0:01:02
      75000 -- (-316.555) [-315.286] (-317.152) (-315.605) * [-316.127] (-318.803) (-320.173) (-318.258) -- 0:01:01

      Average standard deviation of split frequencies: 0.025121

      75500 -- (-318.435) (-315.852) [-316.898] (-316.581) * (-316.663) [-316.411] (-318.949) (-316.432) -- 0:01:01
      76000 -- (-317.419) (-318.820) (-319.484) [-316.491] * (-321.623) (-318.677) (-316.372) [-321.692] -- 0:01:00
      76500 -- [-315.480] (-319.169) (-315.199) (-323.350) * (-317.738) [-317.782] (-317.988) (-315.679) -- 0:01:00
      77000 -- (-315.831) (-318.175) [-318.790] (-321.627) * [-318.269] (-318.704) (-318.189) (-317.834) -- 0:00:59
      77500 -- (-315.684) (-320.583) [-318.002] (-317.405) * (-316.843) (-316.900) (-317.334) [-316.825] -- 0:00:59
      78000 -- [-316.834] (-317.298) (-318.476) (-316.877) * (-317.864) (-316.686) (-316.665) [-317.004] -- 0:00:59
      78500 -- [-316.316] (-316.611) (-316.089) (-317.393) * (-316.619) [-315.825] (-322.938) (-319.525) -- 0:00:58
      79000 -- (-316.257) (-318.234) [-316.027] (-315.927) * (-317.268) (-315.244) [-315.575] (-319.731) -- 0:00:58
      79500 -- (-319.186) [-316.681] (-317.351) (-316.164) * (-316.238) [-316.805] (-318.544) (-317.711) -- 0:00:57
      80000 -- (-317.552) (-317.533) [-316.406] (-320.215) * [-317.272] (-317.794) (-318.076) (-327.681) -- 0:00:57

      Average standard deviation of split frequencies: 0.029511

      80500 -- (-317.531) [-315.861] (-316.301) (-320.167) * (-322.175) (-315.985) [-316.748] (-320.696) -- 0:00:57
      81000 -- (-320.600) [-316.561] (-318.554) (-321.355) * (-316.192) (-318.094) [-315.690] (-317.022) -- 0:00:56
      81500 -- (-319.338) (-315.641) (-318.992) [-319.200] * (-316.966) (-317.579) [-318.451] (-315.912) -- 0:00:56
      82000 -- (-317.377) [-316.926] (-323.048) (-316.781) * (-318.138) (-317.035) (-315.341) [-316.982] -- 0:00:55
      82500 -- (-315.714) (-318.830) (-317.580) [-317.816] * (-315.785) (-323.278) (-314.877) [-323.756] -- 0:00:55
      83000 -- (-322.280) (-320.254) (-315.074) [-316.607] * (-315.159) (-315.541) [-317.554] (-317.175) -- 0:00:55
      83500 -- (-320.060) [-316.423] (-321.049) (-315.564) * (-316.011) [-315.611] (-321.117) (-318.049) -- 0:00:54
      84000 -- (-315.909) (-317.146) [-316.476] (-316.076) * (-316.442) [-319.955] (-317.091) (-320.633) -- 0:00:54
      84500 -- (-315.716) (-315.860) (-317.875) [-315.577] * (-317.574) (-317.904) (-318.239) [-316.010] -- 0:00:54
      85000 -- (-317.095) [-317.084] (-317.204) (-321.174) * (-316.855) [-316.878] (-318.694) (-316.900) -- 0:00:53

      Average standard deviation of split frequencies: 0.023421

      85500 -- (-316.646) [-317.836] (-315.846) (-319.820) * [-317.954] (-316.376) (-321.240) (-318.470) -- 0:00:53
      86000 -- (-318.513) (-318.029) [-317.078] (-315.893) * (-318.003) (-316.335) [-316.179] (-319.486) -- 0:00:53
      86500 -- [-322.147] (-321.045) (-318.850) (-318.906) * [-315.968] (-316.319) (-317.227) (-319.961) -- 0:00:52
      87000 -- (-316.239) (-318.720) (-316.094) [-317.672] * (-316.071) [-317.322] (-318.209) (-318.612) -- 0:00:52
      87500 -- (-318.473) [-316.152] (-315.460) (-318.780) * (-317.216) (-316.936) (-322.136) [-316.759] -- 0:00:52
      88000 -- (-318.792) [-317.188] (-315.660) (-318.421) * [-316.210] (-315.654) (-324.120) (-317.829) -- 0:00:51
      88500 -- (-320.217) [-318.767] (-316.575) (-315.914) * (-323.712) (-317.667) [-320.283] (-316.551) -- 0:00:51
      89000 -- (-318.050) [-319.053] (-323.573) (-316.226) * (-316.234) [-315.709] (-316.126) (-316.980) -- 0:00:51
      89500 -- (-320.302) (-316.946) (-320.149) [-316.413] * [-315.903] (-316.127) (-316.528) (-317.761) -- 0:00:50
      90000 -- (-315.483) (-316.559) [-317.718] (-317.660) * (-320.408) [-317.865] (-322.497) (-317.105) -- 0:00:50

      Average standard deviation of split frequencies: 0.025749

      90500 -- (-315.784) (-315.843) (-315.711) [-316.611] * (-318.063) (-319.288) [-315.790] (-318.591) -- 0:01:00
      91000 -- [-318.773] (-316.493) (-317.301) (-316.372) * (-318.455) [-315.535] (-318.646) (-321.630) -- 0:00:59
      91500 -- (-318.106) (-317.223) (-315.783) [-317.443] * [-315.999] (-319.382) (-320.050) (-316.438) -- 0:00:59
      92000 -- (-319.984) (-316.901) (-315.519) [-316.487] * [-319.537] (-318.432) (-316.369) (-318.745) -- 0:00:59
      92500 -- (-320.332) (-317.217) [-315.440] (-318.378) * (-316.272) (-319.749) (-316.266) [-316.849] -- 0:00:58
      93000 -- (-316.336) (-318.031) [-318.020] (-316.833) * (-317.383) (-316.556) (-317.819) [-315.881] -- 0:00:58
      93500 -- (-318.770) (-321.541) [-317.190] (-322.161) * (-320.301) [-317.784] (-316.919) (-316.254) -- 0:00:58
      94000 -- [-316.200] (-315.796) (-317.650) (-319.069) * (-317.700) (-318.710) [-317.918] (-316.813) -- 0:00:57
      94500 -- (-319.441) (-317.478) [-317.303] (-318.187) * [-316.514] (-324.628) (-315.572) (-316.860) -- 0:00:57
      95000 -- (-318.722) [-316.377] (-317.251) (-317.827) * (-318.151) (-317.624) [-318.992] (-321.358) -- 0:00:57

      Average standard deviation of split frequencies: 0.027499

      95500 -- (-317.986) (-317.295) [-315.923] (-317.809) * [-317.698] (-319.832) (-320.659) (-317.571) -- 0:00:56
      96000 -- [-319.987] (-315.976) (-315.689) (-320.466) * (-318.526) (-316.537) [-315.649] (-316.392) -- 0:00:56
      96500 -- (-320.054) (-316.891) [-318.719] (-317.967) * (-316.475) (-317.751) [-318.038] (-318.820) -- 0:00:56
      97000 -- (-321.563) (-319.334) [-317.440] (-319.399) * [-319.323] (-316.939) (-317.806) (-318.811) -- 0:00:55
      97500 -- (-316.811) (-318.960) [-319.014] (-320.232) * (-322.048) [-316.677] (-319.197) (-317.009) -- 0:00:55
      98000 -- (-317.492) (-318.783) (-316.319) [-315.456] * [-316.084] (-319.701) (-318.126) (-315.672) -- 0:00:55
      98500 -- (-321.038) [-318.523] (-316.420) (-316.895) * (-319.180) [-318.010] (-318.463) (-316.952) -- 0:00:54
      99000 -- (-317.633) [-316.640] (-317.146) (-317.426) * (-316.543) (-318.505) (-322.557) [-316.641] -- 0:00:54
      99500 -- (-315.376) (-315.521) [-317.504] (-321.681) * (-320.458) [-316.571] (-322.648) (-316.216) -- 0:00:54
      100000 -- (-320.842) [-316.770] (-316.043) (-326.605) * (-317.838) (-316.585) (-317.285) [-316.210] -- 0:00:54

      Average standard deviation of split frequencies: 0.022113

      100500 -- (-316.723) (-320.344) [-317.062] (-324.455) * (-318.522) (-320.851) (-316.553) [-316.111] -- 0:00:53
      101000 -- (-317.931) (-319.573) [-316.224] (-324.592) * [-317.040] (-316.962) (-317.722) (-316.321) -- 0:00:53
      101500 -- (-322.267) (-315.893) [-316.390] (-316.183) * [-315.339] (-315.791) (-318.921) (-318.509) -- 0:00:53
      102000 -- (-320.646) (-315.653) [-321.281] (-318.106) * (-317.352) (-316.899) [-315.378] (-319.123) -- 0:00:52
      102500 -- (-321.920) (-317.863) (-318.272) [-320.174] * (-315.912) (-316.642) [-316.147] (-320.420) -- 0:00:52
      103000 -- [-315.877] (-316.414) (-320.636) (-316.459) * (-318.730) [-317.561] (-317.362) (-316.784) -- 0:00:52
      103500 -- [-317.189] (-316.482) (-316.384) (-316.508) * [-317.457] (-316.230) (-316.765) (-317.090) -- 0:00:51
      104000 -- (-315.862) [-318.128] (-319.127) (-316.416) * (-317.272) (-318.281) (-317.233) [-315.388] -- 0:00:51
      104500 -- (-315.739) (-319.849) (-317.050) [-315.936] * (-317.644) [-315.570] (-315.557) (-316.063) -- 0:00:51
      105000 -- (-317.151) (-318.879) (-316.460) [-316.741] * (-316.394) (-318.081) (-318.506) [-315.685] -- 0:00:51

      Average standard deviation of split frequencies: 0.020118

      105500 -- (-318.024) (-318.033) (-316.865) [-317.311] * (-316.633) (-315.265) [-315.980] (-316.767) -- 0:00:50
      106000 -- (-316.688) [-317.978] (-317.974) (-319.995) * [-316.879] (-315.335) (-315.746) (-317.046) -- 0:00:50
      106500 -- (-316.582) (-316.587) [-316.441] (-317.657) * (-318.594) [-317.857] (-319.531) (-316.962) -- 0:00:50
      107000 -- [-316.439] (-317.194) (-317.133) (-318.770) * (-317.181) [-318.155] (-319.602) (-316.967) -- 0:00:50
      107500 -- (-319.170) [-320.031] (-318.670) (-321.131) * (-317.994) (-317.955) [-316.125] (-317.792) -- 0:00:58
      108000 -- (-316.940) (-317.723) (-316.608) [-317.021] * [-318.578] (-319.998) (-316.660) (-315.906) -- 0:00:57
      108500 -- [-315.795] (-317.215) (-319.887) (-317.921) * (-316.054) (-319.194) (-323.312) [-317.178] -- 0:00:57
      109000 -- (-315.823) (-317.003) (-317.895) [-316.161] * (-319.561) (-318.836) (-316.248) [-315.392] -- 0:00:57
      109500 -- (-315.948) [-317.840] (-319.490) (-314.938) * [-317.646] (-316.643) (-321.058) (-318.574) -- 0:00:56
      110000 -- (-318.563) (-319.817) (-317.334) [-316.034] * (-317.219) (-315.467) [-321.944] (-316.806) -- 0:00:56

      Average standard deviation of split frequencies: 0.019729

      110500 -- [-315.323] (-318.473) (-319.124) (-316.761) * (-316.062) [-316.662] (-318.534) (-315.118) -- 0:00:56
      111000 -- [-317.906] (-316.056) (-315.623) (-318.699) * (-316.164) (-316.016) [-316.920] (-316.501) -- 0:00:56
      111500 -- (-318.923) [-315.920] (-320.138) (-316.507) * [-317.766] (-317.328) (-316.046) (-320.259) -- 0:00:55
      112000 -- [-316.387] (-315.557) (-319.301) (-315.774) * (-320.920) (-316.499) [-316.196] (-317.627) -- 0:00:55
      112500 -- (-315.964) (-316.044) [-321.923] (-316.395) * (-316.221) (-317.731) [-315.575] (-320.247) -- 0:00:55
      113000 -- [-316.345] (-319.055) (-318.798) (-318.554) * [-317.662] (-316.230) (-317.341) (-316.328) -- 0:00:54
      113500 -- (-317.268) (-316.508) [-317.332] (-317.530) * [-317.593] (-319.169) (-316.083) (-316.066) -- 0:00:54
      114000 -- (-317.700) (-323.294) [-322.024] (-317.812) * (-317.453) [-318.818] (-319.322) (-315.807) -- 0:00:54
      114500 -- (-316.534) [-316.195] (-316.386) (-319.293) * [-316.158] (-316.602) (-319.187) (-317.954) -- 0:00:54
      115000 -- [-316.528] (-317.142) (-315.374) (-317.398) * (-317.790) [-316.647] (-319.908) (-317.887) -- 0:00:53

      Average standard deviation of split frequencies: 0.018407

      115500 -- (-316.149) (-316.094) [-317.056] (-318.852) * [-320.182] (-319.271) (-315.140) (-317.452) -- 0:00:53
      116000 -- (-318.088) [-318.095] (-318.150) (-316.357) * (-318.102) [-317.326] (-316.479) (-318.231) -- 0:00:53
      116500 -- (-315.907) (-315.293) [-317.782] (-318.853) * [-315.631] (-316.079) (-318.132) (-319.497) -- 0:00:53
      117000 -- (-317.521) (-315.290) (-320.807) [-317.827] * (-316.132) (-316.236) [-316.433] (-316.222) -- 0:00:52
      117500 -- [-318.088] (-319.816) (-316.366) (-317.184) * [-316.131] (-317.727) (-315.212) (-315.891) -- 0:00:52
      118000 -- [-322.098] (-316.558) (-316.287) (-317.124) * (-315.817) (-318.280) (-316.310) [-315.731] -- 0:00:52
      118500 -- (-315.764) (-317.710) (-318.361) [-316.787] * (-317.072) [-318.159] (-317.019) (-316.547) -- 0:00:52
      119000 -- (-316.099) (-317.019) (-316.602) [-315.592] * (-317.147) [-316.349] (-320.831) (-318.578) -- 0:00:51
      119500 -- (-317.808) (-317.402) [-319.456] (-317.359) * (-315.894) [-315.623] (-317.527) (-317.105) -- 0:00:51
      120000 -- (-317.686) [-318.728] (-316.770) (-320.983) * (-321.262) (-315.061) (-317.634) [-316.572] -- 0:00:51

      Average standard deviation of split frequencies: 0.018313

      120500 -- (-317.775) (-323.953) [-318.948] (-317.566) * [-315.725] (-319.283) (-317.248) (-317.498) -- 0:00:51
      121000 -- (-316.092) (-315.604) [-319.553] (-316.041) * [-319.585] (-317.949) (-317.045) (-319.315) -- 0:00:50
      121500 -- (-316.715) (-317.007) [-316.339] (-319.024) * [-315.805] (-317.399) (-317.494) (-316.209) -- 0:00:50
      122000 -- (-317.055) (-319.043) [-315.941] (-315.774) * [-317.998] (-318.016) (-318.254) (-317.073) -- 0:00:50
      122500 -- [-316.513] (-319.237) (-317.069) (-317.225) * [-318.022] (-323.941) (-317.156) (-317.193) -- 0:00:50
      123000 -- (-317.181) (-317.476) (-317.760) [-318.907] * [-315.877] (-316.722) (-315.167) (-318.384) -- 0:00:49
      123500 -- (-316.431) [-317.351] (-319.632) (-317.390) * (-317.382) (-316.486) [-318.164] (-321.169) -- 0:00:49
      124000 -- [-319.394] (-315.659) (-318.441) (-322.317) * (-315.718) (-316.867) (-315.791) [-319.209] -- 0:00:49
      124500 -- (-320.975) (-317.117) [-317.183] (-317.231) * [-315.615] (-319.421) (-319.030) (-320.494) -- 0:00:56
      125000 -- [-319.305] (-315.334) (-316.679) (-316.717) * (-316.516) (-320.604) (-323.550) [-317.306] -- 0:00:56

      Average standard deviation of split frequencies: 0.017252

      125500 -- (-317.385) [-317.481] (-316.435) (-317.910) * (-318.605) [-317.239] (-318.692) (-319.091) -- 0:00:55
      126000 -- [-317.812] (-317.036) (-316.063) (-318.266) * [-316.706] (-317.955) (-316.696) (-316.484) -- 0:00:55
      126500 -- (-315.805) (-320.673) [-317.942] (-320.535) * [-317.315] (-318.172) (-316.774) (-319.815) -- 0:00:55
      127000 -- (-316.223) (-316.687) (-316.412) [-316.083] * [-316.582] (-318.268) (-315.601) (-317.590) -- 0:00:54
      127500 -- (-317.094) (-317.491) [-316.097] (-315.566) * (-316.440) (-319.175) [-319.036] (-319.971) -- 0:00:54
      128000 -- (-318.322) (-318.495) [-317.022] (-317.795) * (-320.344) [-316.208] (-318.681) (-317.619) -- 0:00:54
      128500 -- (-316.415) (-318.034) [-316.398] (-318.103) * (-316.800) (-317.796) [-317.592] (-316.678) -- 0:00:54
      129000 -- (-318.580) (-316.676) [-317.237] (-321.264) * (-318.889) (-317.794) [-317.564] (-320.868) -- 0:00:54
      129500 -- (-319.030) (-320.351) (-320.241) [-319.701] * [-317.057] (-317.510) (-317.291) (-321.460) -- 0:00:53
      130000 -- (-317.183) [-315.051] (-316.822) (-317.219) * (-320.747) (-320.023) [-324.243] (-317.315) -- 0:00:53

      Average standard deviation of split frequencies: 0.015433

      130500 -- (-319.826) [-318.776] (-318.337) (-319.566) * [-317.393] (-317.222) (-321.256) (-316.318) -- 0:00:53
      131000 -- (-318.866) (-321.031) (-316.918) [-319.492] * (-316.068) [-317.382] (-317.071) (-317.683) -- 0:00:53
      131500 -- (-315.193) (-319.332) (-318.003) [-315.465] * (-315.745) [-315.260] (-322.442) (-317.967) -- 0:00:52
      132000 -- [-316.472] (-315.523) (-318.416) (-317.383) * (-315.440) [-318.261] (-320.488) (-318.245) -- 0:00:52
      132500 -- (-316.107) [-315.934] (-319.863) (-317.839) * (-318.189) (-318.222) [-317.148] (-315.228) -- 0:00:52
      133000 -- [-316.416] (-318.685) (-325.514) (-315.604) * (-316.937) [-315.129] (-319.282) (-316.647) -- 0:00:52
      133500 -- (-316.564) (-316.921) (-317.839) [-317.315] * (-319.061) [-315.755] (-318.080) (-317.138) -- 0:00:51
      134000 -- (-317.326) (-317.311) (-319.937) [-320.850] * (-319.369) [-316.392] (-321.327) (-317.000) -- 0:00:51
      134500 -- (-322.414) (-319.081) [-317.207] (-318.960) * [-316.614] (-316.085) (-317.857) (-317.139) -- 0:00:51
      135000 -- (-316.282) (-316.518) (-323.217) [-318.399] * [-316.313] (-321.489) (-322.499) (-316.193) -- 0:00:51

      Average standard deviation of split frequencies: 0.014680

      135500 -- [-316.814] (-321.257) (-318.480) (-316.750) * (-317.987) [-319.174] (-321.284) (-318.163) -- 0:00:51
      136000 -- (-316.043) [-317.810] (-317.597) (-319.114) * [-316.059] (-318.528) (-316.769) (-320.760) -- 0:00:50
      136500 -- [-315.871] (-315.637) (-316.989) (-317.849) * (-320.442) [-314.970] (-318.415) (-318.382) -- 0:00:50
      137000 -- (-320.931) [-318.776] (-316.445) (-315.666) * (-324.080) (-315.391) (-315.529) [-318.058] -- 0:00:50
      137500 -- (-322.398) (-321.480) [-315.179] (-318.156) * [-316.728] (-317.397) (-315.856) (-317.310) -- 0:00:50
      138000 -- (-315.792) (-320.569) (-316.745) [-317.708] * [-317.358] (-316.865) (-319.509) (-316.990) -- 0:00:49
      138500 -- (-318.838) (-316.984) [-316.226] (-316.788) * [-318.672] (-315.462) (-318.003) (-318.367) -- 0:00:49
      139000 -- [-320.602] (-316.261) (-316.147) (-315.969) * (-315.755) [-316.452] (-319.252) (-321.668) -- 0:00:49
      139500 -- (-320.361) [-317.273] (-318.527) (-315.332) * (-316.233) (-317.404) (-316.944) [-320.734] -- 0:00:49
      140000 -- (-322.565) (-317.675) [-315.278] (-315.414) * (-316.249) [-316.843] (-315.518) (-320.410) -- 0:00:49

      Average standard deviation of split frequencies: 0.016756

      140500 -- (-318.684) (-316.542) [-316.327] (-317.610) * [-317.618] (-317.664) (-316.543) (-316.605) -- 0:00:48
      141000 -- [-319.087] (-321.322) (-315.392) (-316.527) * (-315.298) [-318.513] (-316.894) (-318.891) -- 0:00:54
      141500 -- (-316.942) (-316.187) (-318.451) [-316.694] * [-315.599] (-317.511) (-315.805) (-319.948) -- 0:00:54
      142000 -- (-317.371) (-316.395) [-315.934] (-316.466) * (-315.142) [-318.509] (-316.910) (-316.035) -- 0:00:54
      142500 -- (-317.365) [-317.155] (-318.065) (-317.461) * [-319.890] (-317.902) (-316.151) (-316.216) -- 0:00:54
      143000 -- [-318.571] (-318.417) (-319.752) (-317.848) * (-316.263) (-316.069) [-317.149] (-317.081) -- 0:00:53
      143500 -- (-318.998) (-320.623) (-315.683) [-321.044] * (-319.977) (-316.964) (-318.154) [-322.993] -- 0:00:53
      144000 -- (-316.030) (-317.046) [-316.476] (-319.725) * (-317.611) [-317.380] (-320.517) (-315.664) -- 0:00:53
      144500 -- [-318.228] (-317.098) (-320.386) (-316.275) * (-317.270) (-321.507) (-315.663) [-316.810] -- 0:00:53
      145000 -- (-318.379) [-318.795] (-316.662) (-317.177) * (-317.350) [-317.890] (-317.454) (-324.490) -- 0:00:53

      Average standard deviation of split frequencies: 0.019373

      145500 -- [-316.930] (-317.568) (-315.925) (-316.761) * [-320.250] (-315.694) (-317.611) (-317.202) -- 0:00:52
      146000 -- (-318.049) [-315.839] (-318.460) (-315.213) * (-321.381) (-321.112) [-320.088] (-317.387) -- 0:00:52
      146500 -- (-317.683) (-316.476) (-317.631) [-318.380] * [-316.834] (-317.137) (-317.739) (-317.864) -- 0:00:52
      147000 -- (-318.288) [-318.339] (-315.743) (-320.122) * (-319.099) (-317.033) [-317.223] (-316.177) -- 0:00:52
      147500 -- [-322.503] (-318.396) (-317.130) (-316.397) * [-319.172] (-319.619) (-317.205) (-316.967) -- 0:00:52
      148000 -- (-315.565) [-315.658] (-316.622) (-319.964) * (-316.874) (-324.438) (-319.559) [-315.548] -- 0:00:51
      148500 -- (-318.244) (-317.729) (-317.028) [-315.911] * (-319.149) [-317.535] (-318.936) (-316.432) -- 0:00:51
      149000 -- (-315.609) (-315.638) (-315.739) [-316.876] * (-317.588) [-318.790] (-315.490) (-319.724) -- 0:00:51
      149500 -- (-318.624) (-320.643) [-315.709] (-315.430) * (-316.516) (-321.015) (-317.872) [-318.515] -- 0:00:51
      150000 -- (-315.892) [-316.159] (-316.011) (-316.623) * (-316.801) (-315.869) (-316.590) [-318.839] -- 0:00:51

      Average standard deviation of split frequencies: 0.017730

      150500 -- (-315.255) [-317.865] (-321.965) (-317.538) * (-317.215) (-320.396) (-318.952) [-316.110] -- 0:00:50
      151000 -- [-315.495] (-316.205) (-320.257) (-318.042) * (-317.635) (-322.225) (-318.501) [-319.220] -- 0:00:50
      151500 -- (-315.079) (-319.908) [-316.408] (-318.182) * (-327.077) (-316.830) (-315.989) [-316.332] -- 0:00:50
      152000 -- [-317.432] (-316.389) (-318.066) (-317.391) * (-329.678) (-316.798) (-318.139) [-318.004] -- 0:00:50
      152500 -- [-317.506] (-317.623) (-319.726) (-315.907) * (-327.449) (-316.380) [-314.982] (-317.486) -- 0:00:50
      153000 -- (-316.575) (-317.397) [-316.040] (-317.245) * (-326.825) [-317.664] (-317.327) (-316.938) -- 0:00:49
      153500 -- (-317.228) (-321.383) (-321.203) [-317.125] * (-319.766) [-316.240] (-322.608) (-315.809) -- 0:00:49
      154000 -- (-317.008) (-321.099) (-321.673) [-318.451] * (-324.120) (-316.117) [-317.667] (-317.404) -- 0:00:49
      154500 -- [-316.334] (-320.961) (-316.965) (-320.718) * (-319.399) (-317.374) (-315.473) [-321.476] -- 0:00:49
      155000 -- [-315.905] (-318.759) (-316.722) (-322.823) * [-317.346] (-315.481) (-318.107) (-317.121) -- 0:00:49

      Average standard deviation of split frequencies: 0.017459

      155500 -- (-315.877) (-319.358) (-316.675) [-317.779] * (-316.492) (-321.492) [-320.210] (-316.317) -- 0:00:48
      156000 -- [-318.154] (-321.388) (-315.329) (-323.506) * (-317.213) (-315.843) [-316.438] (-318.632) -- 0:00:48
      156500 -- (-319.005) (-318.906) (-315.393) [-321.789] * (-317.537) [-317.120] (-316.350) (-317.897) -- 0:00:48
      157000 -- (-319.141) (-316.261) (-317.672) [-315.584] * (-316.606) [-318.114] (-315.896) (-316.135) -- 0:00:48
      157500 -- (-322.977) (-320.652) (-323.001) [-315.451] * (-315.689) (-317.781) [-316.907] (-318.267) -- 0:00:53
      158000 -- (-315.209) (-317.845) [-316.741] (-316.551) * (-317.786) (-319.529) (-317.049) [-317.423] -- 0:00:53
      158500 -- [-316.746] (-315.642) (-315.588) (-319.637) * (-318.195) (-318.367) [-316.144] (-317.941) -- 0:00:53
      159000 -- (-317.271) [-320.040] (-316.713) (-321.650) * (-322.561) [-316.716] (-318.880) (-318.051) -- 0:00:52
      159500 -- (-316.317) (-317.893) [-316.981] (-318.985) * (-319.372) [-315.885] (-316.129) (-316.505) -- 0:00:52
      160000 -- (-316.599) [-316.316] (-317.882) (-318.047) * (-319.515) [-315.326] (-315.637) (-315.752) -- 0:00:52

      Average standard deviation of split frequencies: 0.016137

      160500 -- (-315.395) [-315.858] (-318.711) (-317.145) * [-316.347] (-316.694) (-316.740) (-315.409) -- 0:00:52
      161000 -- [-318.924] (-317.556) (-316.671) (-315.738) * (-321.647) (-315.448) (-318.598) [-316.800] -- 0:00:52
      161500 -- (-319.923) (-315.687) (-318.523) [-319.826] * (-318.408) [-315.678] (-315.473) (-318.177) -- 0:00:51
      162000 -- (-318.015) (-318.808) (-315.453) [-316.544] * [-317.511] (-318.096) (-315.086) (-315.777) -- 0:00:51
      162500 -- [-317.234] (-316.057) (-315.387) (-317.496) * (-318.231) (-322.684) (-316.527) [-315.944] -- 0:00:51
      163000 -- (-319.125) [-320.029] (-314.997) (-315.997) * (-319.689) (-320.697) [-316.321] (-315.811) -- 0:00:51
      163500 -- [-316.727] (-318.798) (-317.799) (-323.140) * (-316.204) (-322.027) (-317.752) [-319.877] -- 0:00:51
      164000 -- (-317.948) (-318.536) [-317.269] (-320.073) * (-318.163) [-317.969] (-317.162) (-318.703) -- 0:00:50
      164500 -- (-317.705) [-316.212] (-316.508) (-316.943) * (-318.626) (-317.271) (-319.040) [-316.507] -- 0:00:50
      165000 -- [-318.303] (-318.626) (-317.602) (-321.376) * (-315.388) (-318.136) (-319.335) [-317.524] -- 0:00:50

      Average standard deviation of split frequencies: 0.014376

      165500 -- [-318.332] (-316.439) (-317.211) (-318.652) * (-318.012) (-318.287) (-317.271) [-319.286] -- 0:00:50
      166000 -- (-322.783) (-315.598) (-317.714) [-315.641] * [-316.424] (-318.483) (-316.786) (-319.875) -- 0:00:50
      166500 -- (-319.328) (-316.521) [-315.679] (-317.239) * (-318.048) (-315.413) (-315.773) [-316.522] -- 0:00:50
      167000 -- [-315.957] (-318.387) (-316.973) (-319.110) * (-319.433) (-316.638) (-317.762) [-317.005] -- 0:00:49
      167500 -- (-318.887) [-316.145] (-323.480) (-316.835) * [-316.196] (-319.979) (-315.957) (-318.041) -- 0:00:49
      168000 -- [-317.101] (-316.808) (-320.480) (-316.837) * (-318.097) [-316.305] (-316.486) (-315.545) -- 0:00:49
      168500 -- (-315.587) (-317.352) [-315.991] (-316.465) * (-319.758) (-317.175) [-315.582] (-315.611) -- 0:00:49
      169000 -- (-315.315) (-317.358) (-315.633) [-315.377] * [-318.708] (-318.155) (-316.249) (-319.622) -- 0:00:49
      169500 -- (-316.840) (-322.496) (-315.961) [-318.381] * [-317.775] (-315.336) (-315.681) (-317.165) -- 0:00:48
      170000 -- [-317.818] (-317.965) (-316.624) (-315.400) * (-317.751) (-315.927) (-315.803) [-318.983] -- 0:00:48

      Average standard deviation of split frequencies: 0.016400

      170500 -- (-315.214) (-316.854) [-318.375] (-316.752) * (-321.170) (-317.938) [-315.701] (-316.097) -- 0:00:48
      171000 -- [-316.036] (-316.201) (-316.282) (-319.088) * [-315.605] (-316.839) (-317.812) (-317.607) -- 0:00:48
      171500 -- (-316.044) [-315.564] (-316.638) (-320.577) * (-315.553) [-317.771] (-315.488) (-317.376) -- 0:00:48
      172000 -- (-317.179) [-319.251] (-316.378) (-320.015) * [-315.392] (-319.023) (-317.957) (-318.324) -- 0:00:48
      172500 -- (-317.491) (-318.022) [-319.760] (-317.986) * (-315.819) (-317.051) [-316.591] (-317.752) -- 0:00:47
      173000 -- (-318.465) [-316.606] (-317.934) (-317.459) * (-319.505) (-317.760) (-315.420) [-316.903] -- 0:00:47
      173500 -- (-317.281) [-317.069] (-315.805) (-316.603) * (-319.056) (-318.761) [-318.130] (-316.465) -- 0:00:47
      174000 -- (-316.741) (-319.382) (-317.337) [-315.688] * (-318.591) (-318.366) (-318.554) [-317.371] -- 0:00:47
      174500 -- [-316.613] (-319.117) (-316.158) (-315.789) * (-315.203) [-317.654] (-318.536) (-317.264) -- 0:00:52
      175000 -- (-316.262) (-321.671) (-316.505) [-315.869] * (-317.254) [-318.109] (-318.101) (-317.053) -- 0:00:51

      Average standard deviation of split frequencies: 0.016071

      175500 -- [-316.080] (-316.603) (-317.321) (-316.139) * (-315.490) [-316.937] (-318.007) (-316.074) -- 0:00:51
      176000 -- (-318.099) (-319.552) [-316.538] (-319.210) * (-316.159) (-318.158) [-317.991] (-316.243) -- 0:00:51
      176500 -- (-316.730) (-319.821) [-316.273] (-327.365) * (-318.854) (-320.122) (-319.994) [-316.651] -- 0:00:51
      177000 -- (-316.535) (-318.145) [-317.152] (-319.740) * (-316.598) (-318.089) (-320.129) [-316.314] -- 0:00:51
      177500 -- (-318.099) (-316.481) [-315.473] (-316.079) * (-319.461) [-317.087] (-321.154) (-318.566) -- 0:00:50
      178000 -- (-318.936) [-315.476] (-318.718) (-319.069) * (-316.377) (-320.598) [-318.287] (-320.759) -- 0:00:50
      178500 -- (-317.889) (-316.558) (-318.513) [-315.718] * (-315.290) (-320.242) (-318.558) [-318.449] -- 0:00:50
      179000 -- (-321.615) [-318.192] (-315.635) (-315.412) * (-317.726) (-317.391) (-317.408) [-316.332] -- 0:00:50
      179500 -- [-318.776] (-317.333) (-315.216) (-315.428) * [-318.817] (-319.432) (-315.574) (-317.968) -- 0:00:50
      180000 -- [-315.857] (-319.340) (-317.628) (-316.824) * (-325.990) [-318.011] (-319.748) (-319.486) -- 0:00:50

      Average standard deviation of split frequencies: 0.017612

      180500 -- (-318.023) [-317.356] (-319.258) (-321.488) * [-317.037] (-320.276) (-320.113) (-315.992) -- 0:00:49
      181000 -- (-316.317) (-317.938) (-316.420) [-322.179] * (-316.320) (-323.189) [-316.678] (-315.887) -- 0:00:49
      181500 -- (-316.846) [-317.049] (-315.747) (-320.233) * (-316.379) (-317.468) [-316.693] (-319.852) -- 0:00:49
      182000 -- (-321.787) (-318.878) (-317.615) [-318.120] * (-316.277) (-321.978) [-319.677] (-315.724) -- 0:00:49
      182500 -- (-315.841) (-321.114) [-320.491] (-318.171) * (-315.557) (-319.054) (-317.670) [-316.917] -- 0:00:49
      183000 -- (-316.895) [-317.241] (-318.838) (-316.771) * (-315.152) (-321.519) [-318.339] (-315.519) -- 0:00:49
      183500 -- (-318.611) (-317.688) (-320.117) [-316.574] * (-318.753) (-316.866) [-315.889] (-316.947) -- 0:00:48
      184000 -- (-321.421) [-317.620] (-318.150) (-316.268) * (-316.884) (-317.276) (-315.943) [-315.742] -- 0:00:48
      184500 -- [-317.651] (-322.186) (-317.739) (-317.019) * (-316.019) (-317.794) (-315.312) [-315.838] -- 0:00:48
      185000 -- (-316.139) (-315.543) [-317.540] (-319.813) * (-319.079) (-319.072) [-317.387] (-315.486) -- 0:00:48

      Average standard deviation of split frequencies: 0.019232

      185500 -- [-315.790] (-318.748) (-315.904) (-317.245) * (-316.257) (-322.329) (-318.212) [-318.741] -- 0:00:48
      186000 -- (-317.211) (-318.202) (-317.409) [-317.064] * (-317.197) (-316.675) [-317.447] (-318.547) -- 0:00:48
      186500 -- [-316.760] (-319.758) (-319.513) (-318.669) * (-317.161) (-317.507) [-315.327] (-317.729) -- 0:00:47
      187000 -- [-316.839] (-317.244) (-316.008) (-316.190) * (-316.755) [-316.189] (-315.782) (-316.118) -- 0:00:47
      187500 -- (-316.495) (-317.939) [-317.301] (-319.203) * (-317.962) (-318.108) [-316.941] (-317.137) -- 0:00:47
      188000 -- [-320.661] (-315.767) (-318.102) (-319.952) * (-316.787) (-316.710) [-317.570] (-318.585) -- 0:00:47
      188500 -- (-316.631) (-321.050) (-320.439) [-318.604] * [-317.648] (-316.398) (-316.657) (-320.609) -- 0:00:47
      189000 -- (-316.966) (-320.330) [-316.648] (-319.126) * (-326.155) (-315.598) (-315.734) [-317.184] -- 0:00:47
      189500 -- (-317.312) [-316.359] (-316.003) (-316.703) * (-318.241) (-317.688) (-316.646) [-316.344] -- 0:00:47
      190000 -- [-317.167] (-318.884) (-317.050) (-323.197) * [-317.388] (-320.777) (-323.653) (-319.623) -- 0:00:46

      Average standard deviation of split frequencies: 0.018470

      190500 -- (-317.140) (-317.931) [-322.620] (-320.775) * (-317.058) (-315.144) (-317.387) [-316.654] -- 0:00:46
      191000 -- (-319.780) (-319.280) [-316.281] (-316.091) * (-317.574) [-316.255] (-316.284) (-316.785) -- 0:00:46
      191500 -- [-317.231] (-315.543) (-315.764) (-317.107) * (-316.451) [-316.323] (-316.906) (-317.523) -- 0:00:50
      192000 -- (-315.203) (-315.072) [-316.518] (-316.082) * (-319.217) [-315.684] (-316.452) (-315.686) -- 0:00:50
      192500 -- [-316.968] (-316.257) (-318.273) (-316.468) * [-320.444] (-318.815) (-318.455) (-319.055) -- 0:00:50
      193000 -- [-316.906] (-317.174) (-318.427) (-317.638) * (-316.388) [-318.214] (-317.605) (-317.078) -- 0:00:50
      193500 -- [-315.615] (-320.975) (-317.468) (-316.222) * (-322.960) (-318.794) [-316.546] (-316.776) -- 0:00:50
      194000 -- [-316.761] (-317.991) (-319.132) (-316.309) * [-319.264] (-316.911) (-321.779) (-317.119) -- 0:00:49
      194500 -- (-317.673) [-317.023] (-318.716) (-318.714) * (-317.579) (-320.140) (-316.745) [-315.820] -- 0:00:49
      195000 -- [-316.687] (-316.321) (-317.191) (-316.206) * [-319.125] (-315.699) (-315.512) (-318.216) -- 0:00:49

      Average standard deviation of split frequencies: 0.017826

      195500 -- (-317.130) (-316.939) (-315.952) [-316.292] * [-319.273] (-316.607) (-316.674) (-315.929) -- 0:00:49
      196000 -- [-317.015] (-318.275) (-316.869) (-318.097) * (-320.459) [-319.256] (-315.576) (-317.354) -- 0:00:49
      196500 -- (-316.194) [-317.365] (-319.108) (-317.493) * [-317.384] (-321.887) (-316.542) (-315.404) -- 0:00:49
      197000 -- (-318.263) (-315.880) (-319.448) [-316.225] * (-318.948) (-320.252) [-318.269] (-318.071) -- 0:00:48
      197500 -- (-317.755) (-320.374) [-316.222] (-316.024) * [-317.332] (-317.808) (-316.043) (-317.494) -- 0:00:48
      198000 -- [-316.345] (-320.513) (-319.160) (-315.513) * (-321.973) (-322.236) (-317.357) [-315.380] -- 0:00:48
      198500 -- (-316.485) [-317.875] (-323.146) (-323.135) * (-324.609) [-316.061] (-318.638) (-316.259) -- 0:00:48
      199000 -- (-320.414) [-319.076] (-319.711) (-318.092) * (-321.094) (-318.527) (-315.822) [-317.709] -- 0:00:48
      199500 -- [-316.316] (-319.759) (-316.493) (-318.293) * [-319.167] (-315.664) (-317.620) (-320.703) -- 0:00:48
      200000 -- [-317.036] (-318.072) (-317.872) (-319.533) * (-317.524) (-318.026) (-320.509) [-319.911] -- 0:00:48

      Average standard deviation of split frequencies: 0.017826

      200500 -- (-318.273) (-315.908) (-318.632) [-316.739] * [-318.741] (-315.949) (-315.506) (-316.893) -- 0:00:47
      201000 -- (-316.914) (-316.110) [-316.311] (-318.745) * [-316.022] (-322.162) (-315.881) (-320.248) -- 0:00:47
      201500 -- [-315.136] (-319.478) (-316.870) (-318.105) * (-321.459) (-319.221) [-318.603] (-318.687) -- 0:00:47
      202000 -- (-316.108) (-316.914) [-317.246] (-319.660) * [-316.727] (-321.092) (-318.624) (-316.430) -- 0:00:47
      202500 -- (-315.320) (-321.488) (-318.823) [-316.753] * [-316.704] (-318.581) (-318.093) (-315.150) -- 0:00:47
      203000 -- (-317.623) (-326.304) (-316.974) [-318.738] * [-321.137] (-318.040) (-316.764) (-315.287) -- 0:00:47
      203500 -- [-317.709] (-319.563) (-317.584) (-319.563) * (-315.542) (-318.190) [-318.185] (-317.540) -- 0:00:46
      204000 -- (-318.400) (-318.060) [-319.168] (-318.816) * (-317.515) (-322.742) (-316.415) [-317.069] -- 0:00:46
      204500 -- (-317.285) (-318.287) [-321.287] (-316.362) * [-317.485] (-322.064) (-317.194) (-316.462) -- 0:00:46
      205000 -- (-317.935) (-319.637) [-318.577] (-315.350) * (-316.056) [-322.638] (-317.262) (-316.918) -- 0:00:46

      Average standard deviation of split frequencies: 0.018307

      205500 -- (-316.285) (-321.410) [-316.490] (-319.151) * (-317.236) (-323.613) (-318.311) [-317.195] -- 0:00:46
      206000 -- (-316.326) [-315.901] (-315.425) (-317.229) * (-317.078) (-318.971) (-318.316) [-315.481] -- 0:00:46
      206500 -- [-315.506] (-321.660) (-316.553) (-318.530) * [-316.187] (-316.237) (-316.244) (-315.992) -- 0:00:46
      207000 -- [-315.373] (-325.272) (-316.243) (-322.414) * [-315.459] (-317.097) (-315.992) (-319.314) -- 0:00:45
      207500 -- (-316.478) (-318.511) (-317.605) [-317.957] * (-316.967) [-315.526] (-315.322) (-315.900) -- 0:00:45
      208000 -- (-316.609) (-320.632) [-316.967] (-318.691) * (-316.161) [-315.898] (-315.574) (-317.783) -- 0:00:45
      208500 -- (-315.705) [-319.816] (-322.283) (-317.861) * (-319.461) (-318.307) (-315.792) [-317.328] -- 0:00:49
      209000 -- (-318.002) (-316.967) [-317.768] (-316.559) * (-316.612) (-317.945) (-315.320) [-315.378] -- 0:00:49
      209500 -- (-315.777) (-319.795) [-318.382] (-316.802) * (-318.229) (-320.679) (-319.409) [-317.233] -- 0:00:49
      210000 -- (-316.504) (-322.640) [-317.091] (-316.086) * (-320.485) [-315.682] (-318.768) (-318.321) -- 0:00:48

      Average standard deviation of split frequencies: 0.018033

      210500 -- (-315.857) (-322.082) (-317.959) [-317.107] * (-317.926) (-316.806) (-316.116) [-315.767] -- 0:00:48
      211000 -- (-315.695) [-319.968] (-319.453) (-319.653) * (-315.800) [-317.956] (-316.283) (-319.575) -- 0:00:48
      211500 -- (-317.776) (-319.246) (-316.685) [-319.779] * (-317.693) (-318.001) [-320.568] (-319.244) -- 0:00:48
      212000 -- [-315.548] (-320.829) (-317.873) (-315.174) * (-317.604) [-319.294] (-316.626) (-321.784) -- 0:00:48
      212500 -- [-318.022] (-320.573) (-317.239) (-320.829) * [-316.624] (-319.781) (-317.420) (-316.054) -- 0:00:48
      213000 -- [-316.318] (-317.258) (-317.753) (-317.156) * (-315.989) (-318.393) [-317.563] (-315.567) -- 0:00:48
      213500 -- (-317.670) [-316.785] (-318.019) (-320.895) * (-317.874) [-317.673] (-317.761) (-316.112) -- 0:00:47
      214000 -- (-316.835) [-318.270] (-317.219) (-318.141) * (-316.376) [-318.493] (-320.662) (-321.864) -- 0:00:47
      214500 -- (-317.811) [-315.347] (-321.136) (-320.526) * (-315.086) [-315.529] (-318.394) (-317.788) -- 0:00:47
      215000 -- (-319.640) (-319.009) [-317.490] (-316.330) * (-317.839) (-315.583) (-317.335) [-316.414] -- 0:00:47

      Average standard deviation of split frequencies: 0.018263

      215500 -- (-316.692) (-319.716) [-316.498] (-317.649) * (-316.771) [-317.129] (-317.424) (-317.247) -- 0:00:47
      216000 -- (-319.723) [-317.839] (-316.925) (-315.687) * (-318.486) (-316.071) (-316.667) [-315.763] -- 0:00:47
      216500 -- (-318.925) (-319.682) (-319.551) [-316.900] * [-321.523] (-315.637) (-316.874) (-319.718) -- 0:00:47
      217000 -- (-316.334) (-316.658) (-317.431) [-317.649] * (-316.771) (-316.597) (-319.094) [-319.004] -- 0:00:46
      217500 -- (-315.263) (-319.184) (-317.478) [-317.022] * (-317.792) (-317.999) (-317.879) [-315.795] -- 0:00:46
      218000 -- [-316.028] (-316.580) (-316.475) (-317.799) * (-319.474) (-318.155) (-317.849) [-316.566] -- 0:00:46
      218500 -- (-317.672) (-315.402) [-315.374] (-318.387) * [-316.064] (-323.003) (-320.157) (-316.827) -- 0:00:46
      219000 -- [-317.020] (-317.005) (-320.719) (-318.029) * (-315.084) (-318.937) (-317.458) [-316.669] -- 0:00:46
      219500 -- (-316.692) (-319.189) [-319.100] (-317.264) * (-317.270) (-321.724) (-318.677) [-317.216] -- 0:00:46
      220000 -- (-317.582) (-319.829) (-318.810) [-315.604] * [-316.036] (-315.989) (-315.788) (-317.508) -- 0:00:46

      Average standard deviation of split frequencies: 0.017446

      220500 -- (-320.955) (-320.953) (-316.311) [-317.641] * (-327.344) (-319.874) [-316.585] (-315.975) -- 0:00:45
      221000 -- (-316.881) [-324.955] (-315.430) (-316.743) * (-327.457) (-316.373) (-318.475) [-316.784] -- 0:00:45
      221500 -- [-316.528] (-318.262) (-318.814) (-319.863) * [-316.316] (-316.057) (-317.336) (-322.265) -- 0:00:45
      222000 -- (-318.322) (-318.074) [-320.409] (-316.994) * (-317.638) [-316.838] (-319.052) (-319.903) -- 0:00:45
      222500 -- (-316.722) (-316.413) (-326.380) [-318.815] * (-315.951) (-320.589) [-317.942] (-315.384) -- 0:00:45
      223000 -- (-315.688) (-317.102) [-319.044] (-316.851) * (-321.157) [-315.538] (-318.018) (-316.293) -- 0:00:45
      223500 -- (-318.525) [-316.095] (-317.758) (-316.984) * (-316.643) [-320.469] (-318.098) (-316.863) -- 0:00:45
      224000 -- (-316.995) (-318.853) [-317.592] (-316.469) * [-316.632] (-316.181) (-316.117) (-315.591) -- 0:00:45
      224500 -- (-318.432) [-315.691] (-318.455) (-316.702) * (-315.611) (-317.351) [-317.133] (-316.991) -- 0:00:44
      225000 -- (-316.165) (-315.931) [-318.133] (-316.920) * (-315.900) [-317.374] (-319.102) (-320.049) -- 0:00:44

      Average standard deviation of split frequencies: 0.017150

      225500 -- (-317.615) (-315.779) [-317.865] (-316.016) * (-319.991) (-316.047) (-316.718) [-322.270] -- 0:00:48
      226000 -- [-317.438] (-316.486) (-317.153) (-315.907) * (-317.509) (-317.148) (-315.763) [-316.953] -- 0:00:47
      226500 -- (-316.391) [-318.375] (-316.947) (-318.188) * (-319.285) (-317.046) [-320.703] (-318.665) -- 0:00:47
      227000 -- (-315.119) (-318.255) (-316.512) [-317.838] * (-316.372) (-317.145) [-318.260] (-317.242) -- 0:00:47
      227500 -- (-317.952) [-318.243] (-317.759) (-317.055) * (-316.509) (-324.239) (-321.450) [-315.068] -- 0:00:47
      228000 -- (-317.362) (-316.403) (-318.712) [-317.509] * (-317.579) (-319.476) (-318.399) [-315.876] -- 0:00:47
      228500 -- (-315.747) [-315.571] (-318.066) (-317.887) * [-317.828] (-317.545) (-317.636) (-321.484) -- 0:00:47
      229000 -- [-319.646] (-320.113) (-318.655) (-315.683) * (-315.849) (-317.762) (-317.971) [-317.452] -- 0:00:47
      229500 -- (-321.517) [-316.951] (-316.641) (-316.760) * [-315.991] (-320.449) (-320.979) (-316.559) -- 0:00:47
      230000 -- (-316.945) [-315.640] (-316.133) (-316.228) * (-315.905) (-323.264) [-317.694] (-321.499) -- 0:00:46

      Average standard deviation of split frequencies: 0.018501

      230500 -- (-317.863) (-320.734) (-320.635) [-315.542] * (-317.466) (-320.790) [-316.522] (-316.067) -- 0:00:46
      231000 -- [-316.669] (-318.392) (-318.739) (-316.064) * [-319.045] (-321.217) (-315.710) (-315.876) -- 0:00:46
      231500 -- (-318.030) (-317.919) [-318.513] (-317.223) * (-318.560) (-319.148) [-317.229] (-318.051) -- 0:00:46
      232000 -- (-317.081) (-316.280) (-316.169) [-316.472] * (-315.199) (-317.220) [-315.472] (-322.634) -- 0:00:46
      232500 -- (-315.839) (-315.480) (-318.487) [-316.584] * (-316.281) [-317.573] (-315.422) (-317.758) -- 0:00:46
      233000 -- (-315.926) (-315.654) (-319.364) [-320.910] * (-316.964) (-317.356) [-315.988] (-316.677) -- 0:00:46
      233500 -- [-316.107] (-315.465) (-317.164) (-318.108) * (-320.043) (-325.517) (-315.503) [-317.330] -- 0:00:45
      234000 -- (-315.936) (-316.209) (-318.284) [-318.242] * (-315.935) [-317.906] (-317.585) (-321.063) -- 0:00:45
      234500 -- [-318.415] (-316.114) (-316.383) (-320.548) * (-316.832) (-318.189) [-315.835] (-318.812) -- 0:00:45
      235000 -- [-316.844] (-317.510) (-316.780) (-317.975) * (-318.123) (-319.042) [-318.564] (-319.670) -- 0:00:45

      Average standard deviation of split frequencies: 0.019531

      235500 -- (-319.030) [-317.670] (-315.827) (-316.914) * (-321.334) (-316.628) (-318.324) [-315.916] -- 0:00:45
      236000 -- (-316.976) (-319.797) (-318.699) [-315.305] * [-316.906] (-316.975) (-320.778) (-316.995) -- 0:00:45
      236500 -- (-316.618) (-317.265) (-317.678) [-324.116] * (-320.081) (-316.131) [-318.411] (-316.962) -- 0:00:45
      237000 -- (-319.375) [-316.357] (-316.318) (-321.806) * (-318.178) [-315.752] (-316.967) (-318.114) -- 0:00:45
      237500 -- [-316.833] (-318.404) (-316.027) (-318.966) * [-317.070] (-319.555) (-316.225) (-319.716) -- 0:00:44
      238000 -- (-318.610) (-316.822) (-316.834) [-317.391] * (-315.283) [-315.660] (-317.234) (-316.802) -- 0:00:44
      238500 -- (-319.506) (-317.357) [-315.847] (-319.492) * (-318.412) [-316.322] (-316.576) (-316.813) -- 0:00:44
      239000 -- (-317.423) (-316.693) [-315.277] (-317.910) * (-317.340) [-318.128] (-315.857) (-318.615) -- 0:00:44
      239500 -- (-316.382) (-316.011) [-315.810] (-321.826) * (-316.357) (-317.753) (-315.537) [-320.204] -- 0:00:44
      240000 -- (-315.947) (-319.847) [-320.550] (-316.202) * (-318.160) (-316.907) (-316.083) [-319.691] -- 0:00:44

      Average standard deviation of split frequencies: 0.018282

      240500 -- (-315.472) (-317.855) [-319.041] (-316.050) * (-315.089) (-321.641) (-316.035) [-320.120] -- 0:00:44
      241000 -- (-315.881) (-319.926) [-320.317] (-315.187) * (-317.478) [-318.243] (-318.341) (-316.110) -- 0:00:44
      241500 -- [-319.395] (-320.352) (-320.121) (-315.434) * (-321.078) (-317.079) [-320.555] (-318.285) -- 0:00:43
      242000 -- [-317.877] (-318.843) (-319.191) (-318.481) * [-317.667] (-316.338) (-316.854) (-317.838) -- 0:00:43
      242500 -- (-317.226) (-325.389) [-316.620] (-321.743) * [-318.377] (-315.518) (-318.372) (-316.200) -- 0:00:43
      243000 -- (-316.483) (-317.282) (-316.182) [-319.397] * (-315.312) [-319.895] (-317.935) (-315.129) -- 0:00:46
      243500 -- (-316.258) [-316.367] (-316.441) (-317.914) * (-317.046) (-319.015) (-317.485) [-315.704] -- 0:00:46
      244000 -- (-315.459) [-319.877] (-317.532) (-319.609) * (-318.754) (-317.115) [-315.924] (-319.689) -- 0:00:46
      244500 -- [-317.078] (-321.945) (-317.252) (-316.885) * (-316.581) [-317.622] (-319.475) (-318.308) -- 0:00:46
      245000 -- (-316.767) (-317.137) [-317.603] (-315.142) * [-316.136] (-321.450) (-315.903) (-318.283) -- 0:00:46

      Average standard deviation of split frequencies: 0.019667

      245500 -- [-319.717] (-319.053) (-316.841) (-317.582) * (-315.677) (-316.990) (-317.030) [-320.111] -- 0:00:46
      246000 -- (-315.291) (-317.366) (-315.509) [-316.294] * (-321.622) [-315.147] (-317.921) (-319.293) -- 0:00:45
      246500 -- (-321.072) (-316.225) (-316.252) [-316.342] * (-317.887) (-317.628) [-318.455] (-319.413) -- 0:00:45
      247000 -- (-319.539) (-317.154) [-315.908] (-316.846) * (-323.415) [-316.097] (-320.644) (-316.797) -- 0:00:45
      247500 -- [-320.072] (-316.964) (-315.779) (-318.159) * [-315.438] (-315.297) (-318.848) (-316.671) -- 0:00:45
      248000 -- [-317.057] (-318.072) (-318.431) (-319.172) * (-317.898) [-316.633] (-317.586) (-316.826) -- 0:00:45
      248500 -- (-317.455) (-320.418) [-320.438] (-317.107) * (-315.322) (-318.867) (-319.024) [-316.565] -- 0:00:45
      249000 -- (-316.967) (-317.893) [-318.926] (-317.589) * (-315.797) [-316.526] (-317.363) (-315.880) -- 0:00:45
      249500 -- (-317.651) (-316.240) [-315.936] (-315.841) * (-317.760) [-317.679] (-318.425) (-316.091) -- 0:00:45
      250000 -- (-316.385) (-324.503) [-317.869] (-316.953) * [-316.767] (-315.780) (-318.630) (-320.235) -- 0:00:45

      Average standard deviation of split frequencies: 0.020373

      250500 -- (-319.975) [-318.402] (-317.690) (-318.342) * [-319.181] (-316.454) (-315.808) (-318.397) -- 0:00:44
      251000 -- (-316.658) (-316.281) (-316.492) [-318.069] * (-315.496) (-318.621) [-318.124] (-315.322) -- 0:00:44
      251500 -- (-319.203) (-320.666) [-319.387] (-315.187) * (-317.487) (-324.142) [-318.489] (-316.577) -- 0:00:44
      252000 -- (-318.978) [-319.577] (-316.636) (-316.606) * [-317.750] (-321.231) (-316.318) (-317.069) -- 0:00:44
      252500 -- (-318.799) [-315.276] (-320.950) (-317.135) * [-316.904] (-319.089) (-316.680) (-316.597) -- 0:00:44
      253000 -- (-319.874) (-315.873) (-318.635) [-315.963] * (-320.105) (-320.083) [-315.761] (-315.997) -- 0:00:44
      253500 -- (-317.113) (-316.965) (-318.527) [-316.476] * (-318.814) [-315.995] (-318.052) (-316.062) -- 0:00:44
      254000 -- (-319.791) (-317.542) [-317.082] (-319.903) * [-318.868] (-316.568) (-315.371) (-317.394) -- 0:00:44
      254500 -- [-320.119] (-317.265) (-317.536) (-316.684) * (-317.797) [-315.883] (-320.171) (-317.187) -- 0:00:43
      255000 -- (-318.100) (-316.345) (-318.539) [-317.579] * (-316.057) (-321.400) (-322.145) [-315.910] -- 0:00:43

      Average standard deviation of split frequencies: 0.018848

      255500 -- (-320.981) (-317.206) (-317.639) [-317.019] * [-315.713] (-316.849) (-319.087) (-319.293) -- 0:00:43
      256000 -- [-316.113] (-315.755) (-317.079) (-315.398) * (-318.001) (-318.101) (-317.206) [-316.201] -- 0:00:43
      256500 -- (-316.243) (-316.872) [-319.410] (-321.129) * (-317.769) (-315.538) [-317.476] (-317.934) -- 0:00:43
      257000 -- (-315.838) (-318.125) (-315.760) [-316.688] * (-317.778) (-316.835) (-315.872) [-316.119] -- 0:00:43
      257500 -- (-316.212) [-316.703] (-319.776) (-317.645) * (-320.060) [-317.291] (-320.376) (-319.160) -- 0:00:43
      258000 -- (-316.996) [-320.701] (-319.080) (-317.937) * (-317.419) (-317.145) [-318.487] (-318.284) -- 0:00:43
      258500 -- (-318.927) (-317.178) [-316.065] (-317.756) * (-320.586) (-320.073) (-318.545) [-317.214] -- 0:00:43
      259000 -- (-319.084) (-319.126) [-317.126] (-319.345) * (-320.190) [-318.658] (-315.748) (-319.530) -- 0:00:42
      259500 -- (-316.434) (-315.364) [-316.331] (-317.243) * (-317.031) (-320.404) [-316.450] (-316.858) -- 0:00:42
      260000 -- (-316.465) [-315.722] (-317.013) (-317.236) * (-316.870) (-319.146) (-318.299) [-314.953] -- 0:00:45

      Average standard deviation of split frequencies: 0.017553

      260500 -- (-318.715) (-316.164) (-317.577) [-317.503] * (-318.128) (-323.612) (-318.248) [-315.803] -- 0:00:45
      261000 -- (-317.970) (-319.013) [-317.587] (-317.037) * (-318.232) [-323.411] (-317.977) (-317.734) -- 0:00:45
      261500 -- (-318.504) [-317.334] (-319.132) (-324.445) * (-316.478) (-319.919) [-318.601] (-317.700) -- 0:00:45
      262000 -- (-316.813) [-316.395] (-317.564) (-315.945) * [-317.120] (-316.472) (-316.807) (-319.550) -- 0:00:45
      262500 -- (-317.526) [-317.238] (-317.139) (-318.742) * (-319.905) (-319.748) (-317.201) [-321.536] -- 0:00:44
      263000 -- (-317.067) (-316.195) [-317.337] (-319.909) * (-316.716) (-319.631) [-316.130] (-319.727) -- 0:00:44
      263500 -- (-319.619) (-316.478) (-316.666) [-316.925] * (-317.823) [-318.263] (-316.683) (-317.690) -- 0:00:44
      264000 -- [-315.930] (-317.895) (-320.467) (-317.333) * (-319.549) (-317.363) (-322.657) [-317.913] -- 0:00:44
      264500 -- [-316.999] (-315.969) (-317.403) (-315.707) * (-318.332) [-320.231] (-324.171) (-316.659) -- 0:00:44
      265000 -- (-316.303) (-317.031) (-316.893) [-316.206] * (-315.781) (-319.159) (-320.298) [-317.549] -- 0:00:44

      Average standard deviation of split frequencies: 0.018452

      265500 -- (-317.633) (-315.673) [-317.132] (-318.125) * (-316.815) [-315.870] (-315.728) (-316.082) -- 0:00:44
      266000 -- (-316.403) (-315.350) (-317.973) [-319.628] * (-316.954) [-319.393] (-317.134) (-317.367) -- 0:00:44
      266500 -- (-321.353) (-322.115) [-318.439] (-318.502) * (-318.305) (-320.911) [-316.313] (-317.157) -- 0:00:44
      267000 -- (-319.694) [-317.810] (-317.547) (-322.590) * (-318.071) (-318.102) [-317.522] (-317.708) -- 0:00:43
      267500 -- [-317.106] (-315.733) (-316.348) (-319.170) * (-321.101) [-317.933] (-316.056) (-318.684) -- 0:00:43
      268000 -- [-317.177] (-315.972) (-315.271) (-315.786) * [-317.465] (-317.043) (-318.964) (-315.676) -- 0:00:43
      268500 -- (-317.440) (-317.441) [-316.173] (-320.211) * (-320.223) (-315.843) [-317.837] (-317.535) -- 0:00:43
      269000 -- [-322.952] (-316.846) (-318.459) (-316.677) * (-320.468) (-315.978) [-317.373] (-316.949) -- 0:00:43
      269500 -- [-316.356] (-315.555) (-319.741) (-323.925) * (-322.688) [-315.366] (-318.249) (-316.191) -- 0:00:43
      270000 -- (-318.727) (-318.402) [-316.618] (-317.501) * (-319.353) (-320.658) [-317.933] (-321.250) -- 0:00:43

      Average standard deviation of split frequencies: 0.018748

      270500 -- (-315.595) [-317.152] (-315.154) (-317.884) * (-317.569) (-319.406) [-316.254] (-317.413) -- 0:00:43
      271000 -- (-318.462) (-315.976) [-318.123] (-317.186) * (-318.542) [-315.918] (-316.794) (-318.396) -- 0:00:43
      271500 -- (-318.141) (-316.737) [-316.941] (-315.684) * (-317.745) (-317.548) (-316.357) [-315.955] -- 0:00:42
      272000 -- (-318.924) (-315.793) (-317.993) [-319.642] * (-322.793) [-315.474] (-316.090) (-316.037) -- 0:00:42
      272500 -- [-316.542] (-318.849) (-318.369) (-321.822) * (-317.321) [-315.808] (-315.077) (-316.286) -- 0:00:42
      273000 -- (-316.049) (-317.280) (-319.813) [-316.761] * (-317.722) [-319.070] (-318.281) (-315.838) -- 0:00:42
      273500 -- (-319.519) [-318.568] (-318.589) (-315.730) * (-316.048) (-319.209) (-316.536) [-316.817] -- 0:00:42
      274000 -- (-322.548) (-316.104) [-317.269] (-317.525) * (-317.688) (-315.739) [-317.698] (-316.103) -- 0:00:42
      274500 -- (-323.064) (-316.598) [-317.323] (-316.666) * (-317.030) (-316.956) (-316.968) [-316.828] -- 0:00:42
      275000 -- (-318.336) [-315.745] (-317.224) (-317.679) * (-315.680) (-316.500) [-317.618] (-317.572) -- 0:00:42

      Average standard deviation of split frequencies: 0.018788

      275500 -- (-317.549) (-317.632) [-316.540] (-318.069) * (-317.664) (-316.215) (-318.396) [-316.529] -- 0:00:42
      276000 -- (-317.816) [-318.055] (-316.905) (-317.256) * (-316.348) [-315.056] (-317.631) (-318.362) -- 0:00:41
      276500 -- (-321.799) (-315.731) (-319.486) [-318.465] * (-316.664) (-316.973) (-318.401) [-317.191] -- 0:00:41
      277000 -- (-317.446) (-321.383) (-316.942) [-316.997] * [-316.940] (-318.816) (-316.326) (-315.782) -- 0:00:44
      277500 -- (-318.141) (-318.639) [-320.039] (-317.407) * (-315.691) (-318.477) [-316.113] (-317.259) -- 0:00:44
      278000 -- (-317.743) (-317.604) [-315.745] (-316.835) * (-317.105) [-315.830] (-317.442) (-317.962) -- 0:00:44
      278500 -- (-318.634) (-320.473) (-315.906) [-317.991] * [-319.735] (-318.296) (-316.166) (-317.661) -- 0:00:44
      279000 -- (-316.613) [-316.624] (-320.783) (-317.742) * (-315.755) (-317.253) (-315.656) [-315.610] -- 0:00:43
      279500 -- (-319.633) (-315.642) [-318.116] (-315.694) * (-315.362) (-316.760) [-316.323] (-316.058) -- 0:00:43
      280000 -- (-322.265) [-317.537] (-321.486) (-318.499) * [-316.786] (-317.512) (-316.553) (-316.322) -- 0:00:43

      Average standard deviation of split frequencies: 0.017076

      280500 -- (-319.834) (-315.301) (-315.392) [-318.018] * (-319.476) (-316.278) [-318.747] (-315.845) -- 0:00:43
      281000 -- [-316.890] (-314.951) (-316.458) (-316.849) * (-317.022) (-316.238) (-323.556) [-317.711] -- 0:00:43
      281500 -- (-315.423) (-315.878) [-317.285] (-317.332) * (-318.849) (-315.873) [-317.463] (-315.729) -- 0:00:43
      282000 -- (-317.927) (-316.143) (-316.265) [-316.311] * (-317.232) (-317.553) [-316.373] (-317.899) -- 0:00:43
      282500 -- [-319.318] (-318.357) (-316.622) (-315.247) * (-315.537) [-319.666] (-318.048) (-318.120) -- 0:00:43
      283000 -- (-316.484) (-317.115) (-319.955) [-314.937] * [-315.462] (-316.829) (-316.341) (-316.584) -- 0:00:43
      283500 -- (-317.570) [-316.260] (-318.458) (-315.666) * (-317.010) (-316.848) [-317.190] (-319.397) -- 0:00:42
      284000 -- [-318.977] (-316.987) (-320.010) (-317.840) * [-323.855] (-317.846) (-316.126) (-316.625) -- 0:00:42
      284500 -- (-325.479) (-315.606) (-316.153) [-315.645] * (-328.378) [-317.925] (-319.810) (-316.796) -- 0:00:42
      285000 -- [-317.770] (-315.368) (-319.958) (-317.697) * [-318.232] (-317.746) (-317.609) (-316.098) -- 0:00:42

      Average standard deviation of split frequencies: 0.017263

      285500 -- (-320.275) [-317.242] (-319.160) (-325.272) * (-316.681) [-315.753] (-317.064) (-316.054) -- 0:00:42
      286000 -- (-321.374) (-316.909) [-315.383] (-320.265) * (-325.037) [-315.420] (-317.337) (-317.801) -- 0:00:42
      286500 -- (-319.517) (-318.663) [-315.632] (-320.221) * (-317.694) (-315.953) (-316.047) [-316.086] -- 0:00:42
      287000 -- (-316.423) (-319.094) [-316.330] (-317.800) * (-322.691) (-318.382) (-319.768) [-319.763] -- 0:00:42
      287500 -- (-317.914) [-316.839] (-316.425) (-318.177) * [-319.624] (-318.368) (-318.999) (-320.716) -- 0:00:42
      288000 -- (-316.675) (-318.673) [-315.279] (-317.242) * (-315.688) (-316.682) (-319.261) [-316.417] -- 0:00:42
      288500 -- (-316.792) (-321.532) [-315.866] (-315.652) * (-322.616) (-318.347) (-319.934) [-316.393] -- 0:00:41
      289000 -- (-318.654) [-317.641] (-315.454) (-315.973) * (-318.752) (-318.088) [-318.172] (-319.203) -- 0:00:41
      289500 -- (-318.460) (-321.297) [-316.773] (-320.658) * (-319.208) (-317.427) (-316.945) [-320.067] -- 0:00:41
      290000 -- [-317.494] (-315.451) (-315.530) (-316.666) * (-315.926) (-316.136) (-316.868) [-315.231] -- 0:00:41

      Average standard deviation of split frequencies: 0.017119

      290500 -- (-315.746) (-318.203) (-317.078) [-315.904] * [-319.061] (-316.296) (-319.388) (-315.358) -- 0:00:41
      291000 -- (-317.036) (-322.429) (-317.371) [-316.940] * [-317.357] (-319.912) (-319.009) (-315.455) -- 0:00:41
      291500 -- (-319.514) [-316.435] (-315.797) (-315.722) * [-315.557] (-319.051) (-320.421) (-317.067) -- 0:00:41
      292000 -- (-316.667) (-315.799) (-316.519) [-316.938] * (-315.820) (-316.034) (-316.234) [-317.404] -- 0:00:41
      292500 -- (-316.349) (-320.379) (-317.529) [-316.744] * (-317.088) (-319.803) [-315.524] (-316.708) -- 0:00:41
      293000 -- [-316.330] (-316.142) (-319.005) (-317.304) * (-317.766) (-325.374) [-315.808] (-315.865) -- 0:00:41
      293500 -- [-316.698] (-317.504) (-318.007) (-319.755) * (-317.203) (-320.216) [-319.357] (-316.785) -- 0:00:40
      294000 -- (-315.455) (-317.254) [-317.885] (-318.205) * (-316.229) [-315.728] (-317.491) (-316.378) -- 0:00:40
      294500 -- [-318.968] (-317.560) (-317.257) (-316.710) * (-317.301) (-317.939) [-318.457] (-317.192) -- 0:00:43
      295000 -- [-318.083] (-316.837) (-316.939) (-318.317) * (-317.259) [-318.345] (-318.645) (-317.254) -- 0:00:43

      Average standard deviation of split frequencies: 0.016368

      295500 -- [-316.243] (-317.719) (-318.982) (-318.973) * (-317.053) [-323.778] (-315.767) (-315.257) -- 0:00:42
      296000 -- (-317.290) [-315.611] (-317.994) (-316.484) * (-315.645) [-318.830] (-319.295) (-318.736) -- 0:00:42
      296500 -- (-318.602) [-316.251] (-318.744) (-320.263) * (-316.219) [-316.467] (-317.674) (-316.574) -- 0:00:42
      297000 -- (-315.487) (-315.659) (-316.978) [-317.725] * [-315.637] (-318.020) (-316.170) (-316.492) -- 0:00:42
      297500 -- (-317.140) [-315.968] (-321.637) (-322.330) * (-317.557) (-315.993) [-317.091] (-317.698) -- 0:00:42
      298000 -- (-316.692) (-318.806) (-317.307) [-316.458] * (-315.264) (-317.084) (-322.124) [-318.004] -- 0:00:42
      298500 -- (-315.425) (-318.185) [-317.238] (-316.077) * (-315.914) (-315.979) [-315.458] (-315.549) -- 0:00:42
      299000 -- [-316.314] (-320.660) (-321.687) (-315.793) * (-315.250) (-318.097) [-319.085] (-316.303) -- 0:00:42
      299500 -- [-315.262] (-318.024) (-315.578) (-315.163) * [-315.334] (-317.617) (-320.562) (-318.548) -- 0:00:42
      300000 -- (-316.938) (-320.447) [-315.693] (-316.127) * [-315.145] (-319.304) (-316.027) (-318.577) -- 0:00:42

      Average standard deviation of split frequencies: 0.016550

      300500 -- (-316.229) [-318.011] (-316.404) (-318.809) * (-317.906) (-316.400) [-316.404] (-320.623) -- 0:00:41
      301000 -- (-324.096) [-317.639] (-319.873) (-317.377) * (-320.617) (-317.260) [-315.526] (-318.566) -- 0:00:41
      301500 -- (-319.280) [-317.529] (-320.257) (-319.242) * [-316.200] (-321.224) (-314.959) (-316.910) -- 0:00:41
      302000 -- (-320.263) (-315.799) [-316.959] (-318.142) * (-320.318) (-319.784) (-316.546) [-318.642] -- 0:00:41
      302500 -- (-317.084) [-316.764] (-318.875) (-315.394) * (-321.557) [-317.382] (-316.404) (-318.679) -- 0:00:41
      303000 -- [-315.958] (-315.872) (-317.143) (-318.121) * (-317.116) [-324.251] (-318.043) (-317.272) -- 0:00:41
      303500 -- (-315.940) (-315.339) [-316.126] (-318.793) * (-319.411) (-318.377) (-315.867) [-317.920] -- 0:00:41
      304000 -- (-318.113) (-317.480) [-317.283] (-316.693) * (-317.126) (-318.173) (-316.245) [-319.157] -- 0:00:41
      304500 -- (-319.408) [-316.668] (-317.642) (-316.327) * [-316.824] (-316.221) (-315.857) (-315.541) -- 0:00:41
      305000 -- (-316.961) (-316.869) (-316.288) [-315.394] * (-316.989) (-315.629) [-317.082] (-316.567) -- 0:00:41

      Average standard deviation of split frequencies: 0.015568

      305500 -- [-319.657] (-317.184) (-321.643) (-318.891) * (-316.363) [-318.805] (-316.871) (-316.063) -- 0:00:40
      306000 -- (-317.185) (-315.604) (-317.579) [-316.525] * [-319.274] (-319.474) (-316.145) (-316.437) -- 0:00:40
      306500 -- (-317.420) (-315.597) (-315.393) [-315.985] * [-317.651] (-317.690) (-316.679) (-317.733) -- 0:00:40
      307000 -- [-317.812] (-315.876) (-318.749) (-315.987) * (-317.688) (-316.640) (-317.376) [-316.609] -- 0:00:40
      307500 -- (-316.808) [-316.454] (-316.523) (-316.108) * (-321.075) [-317.745] (-316.465) (-316.113) -- 0:00:40
      308000 -- (-318.965) [-318.121] (-317.173) (-315.849) * (-315.665) (-316.671) [-316.002] (-316.848) -- 0:00:40
      308500 -- (-318.220) (-317.932) (-319.057) [-320.764] * (-318.203) (-321.425) [-315.730] (-315.960) -- 0:00:40
      309000 -- (-316.381) (-317.292) (-317.675) [-317.072] * (-317.888) (-317.294) (-318.165) [-315.108] -- 0:00:40
      309500 -- (-319.428) [-316.868] (-316.457) (-318.903) * [-319.228] (-316.687) (-321.273) (-317.833) -- 0:00:40
      310000 -- [-318.233] (-315.519) (-315.881) (-316.209) * (-321.321) [-317.053] (-315.346) (-317.697) -- 0:00:40

      Average standard deviation of split frequencies: 0.017281

      310500 -- (-320.357) (-317.447) [-315.770] (-317.277) * (-316.319) [-316.163] (-315.350) (-319.234) -- 0:00:39
      311000 -- (-321.597) (-316.387) [-316.066] (-317.284) * [-320.111] (-323.307) (-321.735) (-315.607) -- 0:00:39
      311500 -- [-317.593] (-317.278) (-316.343) (-319.164) * (-320.256) (-320.809) (-318.037) [-316.754] -- 0:00:41
      312000 -- [-318.196] (-319.068) (-318.563) (-316.317) * [-320.780] (-318.904) (-318.669) (-320.337) -- 0:00:41
      312500 -- (-317.279) (-316.646) (-319.526) [-316.832] * (-316.636) (-321.387) (-315.992) [-316.992] -- 0:00:41
      313000 -- (-319.419) (-316.144) [-316.567] (-316.814) * (-316.627) (-317.350) [-316.945] (-316.331) -- 0:00:41
      313500 -- [-318.065] (-321.024) (-318.052) (-316.857) * (-319.887) (-316.855) [-318.451] (-317.239) -- 0:00:41
      314000 -- (-318.063) [-317.343] (-317.748) (-316.401) * [-318.193] (-321.426) (-318.088) (-318.675) -- 0:00:41
      314500 -- (-315.519) (-323.569) [-315.639] (-315.159) * [-319.191] (-318.560) (-316.472) (-324.033) -- 0:00:41
      315000 -- [-319.224] (-322.327) (-317.018) (-316.306) * (-320.655) [-319.323] (-315.818) (-316.483) -- 0:00:41

      Average standard deviation of split frequencies: 0.017006

      315500 -- (-317.674) [-319.160] (-316.448) (-317.298) * [-317.157] (-318.880) (-320.794) (-317.302) -- 0:00:41
      316000 -- (-315.880) (-321.045) (-317.431) [-317.354] * [-316.917] (-319.045) (-320.280) (-318.134) -- 0:00:41
      316500 -- (-317.374) [-316.238] (-318.878) (-315.744) * (-316.330) (-316.155) (-316.952) [-318.297] -- 0:00:41
      317000 -- (-316.237) (-317.703) [-317.167] (-317.525) * (-317.547) (-315.962) [-315.924] (-321.514) -- 0:00:40
      317500 -- [-316.516] (-317.667) (-320.268) (-321.136) * (-317.669) (-319.156) [-316.040] (-320.938) -- 0:00:40
      318000 -- (-322.214) (-318.002) [-317.537] (-322.032) * (-320.640) (-316.776) (-318.071) [-316.283] -- 0:00:40
      318500 -- [-320.298] (-320.756) (-320.437) (-322.697) * (-316.982) (-315.859) (-317.184) [-317.955] -- 0:00:40
      319000 -- (-319.088) (-315.983) (-316.477) [-315.605] * [-315.037] (-317.090) (-317.457) (-318.372) -- 0:00:40
      319500 -- (-315.564) (-316.882) [-315.908] (-315.102) * [-316.334] (-318.073) (-315.880) (-315.993) -- 0:00:40
      320000 -- (-317.083) (-317.076) [-315.566] (-316.734) * (-315.220) (-321.658) (-320.153) [-318.427] -- 0:00:40

      Average standard deviation of split frequencies: 0.017022

      320500 -- (-316.972) (-318.068) (-317.405) [-316.105] * (-316.386) (-319.676) [-315.866] (-316.562) -- 0:00:40
      321000 -- (-318.725) (-317.379) (-315.541) [-316.094] * (-320.576) [-321.955] (-316.327) (-316.939) -- 0:00:40
      321500 -- [-316.509] (-318.339) (-319.371) (-317.063) * (-316.750) [-317.684] (-316.267) (-318.081) -- 0:00:40
      322000 -- (-318.643) (-321.127) [-317.600] (-317.436) * (-315.975) (-316.442) [-318.086] (-316.871) -- 0:00:40
      322500 -- (-318.401) (-320.929) (-317.863) [-320.477] * (-317.430) [-316.506] (-321.882) (-316.598) -- 0:00:39
      323000 -- (-320.082) (-318.404) (-320.432) [-316.503] * (-317.376) [-320.560] (-319.820) (-318.181) -- 0:00:39
      323500 -- (-318.458) [-316.072] (-320.565) (-315.147) * (-318.230) [-322.123] (-317.530) (-316.014) -- 0:00:39
      324000 -- (-322.168) [-318.358] (-319.376) (-319.297) * (-316.137) (-318.633) (-319.794) [-316.583] -- 0:00:39
      324500 -- (-319.945) (-316.520) [-320.214] (-319.341) * [-316.448] (-317.485) (-317.861) (-316.333) -- 0:00:39
      325000 -- (-321.466) (-324.085) [-318.057] (-315.907) * (-319.056) (-316.572) (-315.999) [-317.387] -- 0:00:39

      Average standard deviation of split frequencies: 0.016113

      325500 -- (-320.978) [-320.005] (-319.195) (-317.914) * (-319.236) (-318.284) [-317.517] (-319.504) -- 0:00:39
      326000 -- (-316.662) (-321.592) [-316.309] (-322.310) * (-317.137) (-315.898) (-315.433) [-319.282] -- 0:00:39
      326500 -- (-320.524) (-316.517) [-317.039] (-316.428) * (-318.717) [-315.675] (-316.275) (-318.919) -- 0:00:39
      327000 -- (-320.881) (-316.765) [-317.412] (-317.407) * (-318.034) [-316.236] (-318.090) (-315.836) -- 0:00:39
      327500 -- (-318.929) (-318.079) [-320.245] (-316.841) * (-318.108) (-315.461) (-319.818) [-317.126] -- 0:00:39
      328000 -- (-316.168) [-317.035] (-315.496) (-316.806) * (-319.357) (-315.601) (-317.788) [-317.209] -- 0:00:38
      328500 -- (-316.781) [-322.241] (-316.194) (-322.682) * (-320.921) (-318.012) (-318.850) [-317.574] -- 0:00:40
      329000 -- [-318.809] (-320.072) (-317.275) (-318.750) * (-320.803) (-321.273) (-322.587) [-316.649] -- 0:00:40
      329500 -- (-315.928) (-321.342) (-316.691) [-316.701] * [-315.656] (-315.387) (-320.414) (-320.171) -- 0:00:40
      330000 -- (-317.261) (-318.307) (-316.280) [-318.676] * (-317.244) [-316.438] (-317.754) (-318.506) -- 0:00:40

      Average standard deviation of split frequencies: 0.016507

      330500 -- (-316.625) (-316.800) (-318.877) [-327.534] * (-318.425) [-317.553] (-317.053) (-320.129) -- 0:00:40
      331000 -- (-317.544) [-318.769] (-318.131) (-319.215) * (-316.929) (-316.520) (-317.980) [-319.626] -- 0:00:40
      331500 -- (-318.667) [-319.761] (-316.645) (-320.996) * (-319.187) (-317.350) (-320.336) [-316.734] -- 0:00:40
      332000 -- (-318.551) [-317.448] (-317.760) (-316.113) * (-316.421) (-319.267) (-315.483) [-316.085] -- 0:00:40
      332500 -- (-318.030) (-315.549) (-317.257) [-320.380] * (-319.704) [-316.743] (-318.802) (-316.945) -- 0:00:40
      333000 -- (-316.481) (-319.356) (-315.426) [-319.377] * (-320.213) (-316.320) (-320.690) [-315.284] -- 0:00:40
      333500 -- (-318.030) (-317.544) (-316.101) [-317.890] * (-317.463) [-316.210] (-318.112) (-317.324) -- 0:00:39
      334000 -- (-317.395) (-317.371) (-315.223) [-320.907] * (-324.087) (-316.524) (-315.940) [-315.851] -- 0:00:39
      334500 -- (-320.108) (-319.466) [-318.775] (-317.066) * (-315.671) [-315.940] (-316.490) (-317.555) -- 0:00:39
      335000 -- (-319.377) (-316.608) [-316.616] (-318.358) * [-316.214] (-318.778) (-315.296) (-319.083) -- 0:00:39

      Average standard deviation of split frequencies: 0.015433

      335500 -- (-319.003) [-316.908] (-317.844) (-317.670) * [-316.835] (-320.410) (-316.450) (-318.477) -- 0:00:39
      336000 -- (-317.158) (-318.451) (-320.501) [-315.633] * (-323.674) (-319.193) (-317.137) [-315.586] -- 0:00:39
      336500 -- [-316.062] (-316.784) (-318.449) (-317.137) * [-320.259] (-316.773) (-316.054) (-315.939) -- 0:00:39
      337000 -- (-316.475) (-319.042) (-316.156) [-318.645] * [-317.796] (-321.695) (-316.459) (-316.866) -- 0:00:39
      337500 -- (-320.355) [-316.682] (-316.433) (-316.160) * [-316.524] (-317.829) (-320.231) (-315.856) -- 0:00:39
      338000 -- (-319.620) (-316.773) (-316.510) [-318.135] * [-316.406] (-317.898) (-316.222) (-317.990) -- 0:00:39
      338500 -- (-319.617) (-316.830) (-315.733) [-316.779] * (-316.399) (-318.968) [-317.538] (-318.140) -- 0:00:39
      339000 -- (-318.928) (-317.579) [-315.597] (-316.753) * (-320.206) (-318.512) (-316.264) [-317.426] -- 0:00:38
      339500 -- [-317.662] (-317.265) (-316.339) (-319.094) * (-318.368) (-317.500) [-315.548] (-315.561) -- 0:00:38
      340000 -- [-319.393] (-315.782) (-316.591) (-317.434) * [-317.822] (-321.396) (-315.376) (-319.488) -- 0:00:38

      Average standard deviation of split frequencies: 0.016023

      340500 -- (-320.350) (-317.287) [-319.117] (-316.490) * (-317.457) [-316.358] (-317.615) (-319.698) -- 0:00:38
      341000 -- (-317.010) (-317.915) (-316.743) [-318.033] * (-318.434) (-317.067) (-316.464) [-316.092] -- 0:00:38
      341500 -- (-326.619) (-316.468) [-317.997] (-317.565) * (-317.025) [-318.405] (-318.463) (-320.454) -- 0:00:38
      342000 -- (-316.003) (-317.445) [-320.825] (-316.194) * [-315.668] (-319.125) (-316.250) (-317.590) -- 0:00:38
      342500 -- (-317.700) (-318.878) (-317.521) [-316.846] * (-324.884) [-315.744] (-316.511) (-316.962) -- 0:00:38
      343000 -- (-316.859) [-317.137] (-320.098) (-315.402) * (-318.967) (-316.514) (-316.671) [-318.357] -- 0:00:38
      343500 -- (-316.651) (-317.902) [-318.985] (-316.616) * (-316.638) (-319.307) [-315.447] (-320.771) -- 0:00:38
      344000 -- (-317.855) (-317.676) (-324.751) [-316.958] * (-319.970) (-319.595) [-316.091] (-319.371) -- 0:00:38
      344500 -- (-318.426) [-316.867] (-317.129) (-316.098) * (-317.445) [-320.368] (-318.188) (-316.351) -- 0:00:38
      345000 -- [-319.600] (-318.667) (-317.018) (-316.370) * (-319.584) (-316.262) [-315.898] (-320.280) -- 0:00:37

      Average standard deviation of split frequencies: 0.016220

      345500 -- (-320.415) (-317.275) (-316.207) [-317.272] * (-317.718) [-318.063] (-317.119) (-318.790) -- 0:00:39
      346000 -- [-316.265] (-320.067) (-315.013) (-317.272) * (-315.616) (-315.293) (-320.019) [-315.594] -- 0:00:39
      346500 -- [-317.345] (-317.835) (-315.304) (-319.297) * (-316.582) (-322.673) (-320.252) [-319.911] -- 0:00:39
      347000 -- (-316.882) (-316.588) [-316.267] (-318.147) * (-318.737) (-316.600) [-317.420] (-318.995) -- 0:00:39
      347500 -- (-315.444) [-316.550] (-316.362) (-324.415) * [-316.129] (-318.464) (-320.067) (-319.649) -- 0:00:39
      348000 -- (-319.173) (-317.705) (-315.335) [-315.737] * (-317.451) (-318.200) [-315.844] (-315.962) -- 0:00:39
      348500 -- (-319.940) (-316.730) [-316.450] (-317.453) * (-317.841) [-317.244] (-315.796) (-317.354) -- 0:00:39
      349000 -- (-316.571) (-316.923) [-317.479] (-317.648) * (-318.845) (-315.572) (-316.033) [-316.347] -- 0:00:39
      349500 -- (-315.752) [-315.615] (-317.533) (-318.352) * (-317.464) (-320.202) (-316.744) [-317.726] -- 0:00:39
      350000 -- [-316.416] (-323.531) (-324.427) (-320.289) * (-317.576) (-316.709) [-320.110] (-318.410) -- 0:00:39

      Average standard deviation of split frequencies: 0.015353

      350500 -- (-319.721) (-315.568) (-316.440) [-318.613] * (-317.756) (-317.572) [-319.289] (-316.203) -- 0:00:38
      351000 -- [-317.945] (-317.791) (-315.882) (-318.238) * (-317.701) (-316.485) (-316.523) [-315.579] -- 0:00:38
      351500 -- (-315.734) (-321.408) (-319.025) [-319.293] * (-316.978) (-315.129) [-321.743] (-317.133) -- 0:00:38
      352000 -- [-316.411] (-324.248) (-317.485) (-318.388) * (-316.124) (-316.180) (-315.857) [-315.811] -- 0:00:38
      352500 -- (-316.417) (-317.749) (-315.671) [-318.850] * (-316.880) (-315.897) [-318.662] (-316.678) -- 0:00:38
      353000 -- (-319.190) (-317.103) [-317.334] (-321.151) * (-324.877) [-317.540] (-317.957) (-321.221) -- 0:00:38
      353500 -- [-315.252] (-317.238) (-320.650) (-318.906) * (-319.011) (-321.133) (-318.898) [-320.853] -- 0:00:38
      354000 -- (-316.214) (-316.399) [-317.426] (-317.520) * (-316.525) [-321.469] (-317.752) (-315.665) -- 0:00:38
      354500 -- (-318.532) [-317.269] (-319.133) (-317.260) * (-322.746) [-315.491] (-317.223) (-316.365) -- 0:00:38
      355000 -- [-317.850] (-316.070) (-316.474) (-316.246) * (-317.467) [-314.973] (-316.371) (-318.876) -- 0:00:38

      Average standard deviation of split frequencies: 0.015332

      355500 -- (-320.689) (-316.977) [-316.619] (-315.965) * (-315.422) [-318.414] (-318.859) (-319.874) -- 0:00:38
      356000 -- (-322.836) [-316.592] (-316.017) (-316.732) * [-315.378] (-317.211) (-315.012) (-318.039) -- 0:00:37
      356500 -- (-317.883) (-317.614) [-315.202] (-315.603) * (-315.782) [-319.288] (-316.530) (-319.650) -- 0:00:37
      357000 -- (-315.889) [-319.197] (-318.055) (-317.976) * (-318.693) (-318.046) (-317.013) [-317.196] -- 0:00:37
      357500 -- (-315.027) (-318.739) [-318.188] (-316.060) * [-315.736] (-318.545) (-315.790) (-316.876) -- 0:00:37
      358000 -- [-315.586] (-315.777) (-319.138) (-320.104) * (-317.122) (-318.980) (-315.482) [-315.892] -- 0:00:37
      358500 -- (-317.318) [-316.537] (-317.592) (-321.648) * (-315.219) (-317.965) (-317.360) [-315.204] -- 0:00:37
      359000 -- (-318.432) (-316.781) (-318.903) [-317.491] * (-316.293) (-317.284) (-319.738) [-315.961] -- 0:00:37
      359500 -- (-317.517) (-317.305) [-316.465] (-317.613) * (-317.801) [-317.763] (-317.427) (-316.061) -- 0:00:37
      360000 -- (-316.888) (-317.044) [-317.258] (-319.350) * (-316.440) [-318.535] (-318.385) (-318.293) -- 0:00:37

      Average standard deviation of split frequencies: 0.014668

      360500 -- (-320.128) [-316.810] (-317.165) (-317.511) * [-317.765] (-317.757) (-318.910) (-319.401) -- 0:00:37
      361000 -- (-319.990) (-317.588) (-316.027) [-317.203] * (-323.440) (-315.477) (-315.805) [-321.489] -- 0:00:37
      361500 -- (-318.956) (-316.909) (-317.037) [-315.759] * [-321.489] (-319.090) (-318.225) (-319.179) -- 0:00:37
      362000 -- [-315.588] (-322.352) (-320.096) (-316.822) * (-319.332) [-317.876] (-318.662) (-322.182) -- 0:00:37
      362500 -- (-315.195) (-318.517) (-319.456) [-316.668] * (-318.038) (-317.683) (-317.399) [-318.637] -- 0:00:36
      363000 -- (-323.507) [-319.680] (-320.222) (-316.686) * (-318.172) (-316.484) [-316.244] (-317.940) -- 0:00:38
      363500 -- (-323.172) (-317.525) (-317.624) [-319.408] * [-315.786] (-316.861) (-316.360) (-323.449) -- 0:00:38
      364000 -- (-319.285) (-316.601) (-317.439) [-316.991] * (-316.239) (-316.781) [-316.336] (-322.462) -- 0:00:38
      364500 -- (-319.452) (-318.813) (-315.811) [-316.409] * (-317.671) [-317.296] (-318.573) (-316.103) -- 0:00:38
      365000 -- (-315.561) (-319.714) (-319.752) [-315.189] * (-318.679) [-315.458] (-317.197) (-315.693) -- 0:00:38

      Average standard deviation of split frequencies: 0.015027

      365500 -- (-316.418) [-321.177] (-319.893) (-318.240) * (-318.283) [-316.908] (-317.780) (-319.325) -- 0:00:38
      366000 -- (-320.163) (-317.324) [-316.783] (-319.067) * (-321.152) [-318.724] (-317.374) (-317.852) -- 0:00:38
      366500 -- (-317.071) (-316.076) (-317.360) [-318.140] * (-316.977) (-321.340) (-318.246) [-316.837] -- 0:00:38
      367000 -- [-323.153] (-320.115) (-320.629) (-316.152) * (-317.942) (-319.101) [-319.677] (-317.994) -- 0:00:37
      367500 -- (-321.114) [-319.301] (-319.337) (-320.327) * [-316.659] (-318.242) (-318.665) (-320.655) -- 0:00:37
      368000 -- (-315.590) (-317.628) [-316.454] (-316.058) * (-315.719) (-317.724) (-317.306) [-316.547] -- 0:00:37
      368500 -- [-317.251] (-319.660) (-316.704) (-315.429) * (-317.117) (-318.306) (-320.155) [-315.582] -- 0:00:37
      369000 -- (-314.967) (-317.091) [-316.905] (-317.333) * (-316.441) (-321.830) [-317.493] (-315.285) -- 0:00:37
      369500 -- (-316.726) [-317.712] (-317.329) (-319.075) * (-316.744) [-318.037] (-317.277) (-319.557) -- 0:00:37
      370000 -- [-316.790] (-315.870) (-318.544) (-319.043) * [-315.594] (-317.002) (-320.057) (-317.180) -- 0:00:37

      Average standard deviation of split frequencies: 0.015968

      370500 -- (-324.767) [-317.275] (-321.400) (-315.658) * (-316.066) (-318.317) (-320.427) [-317.365] -- 0:00:37
      371000 -- [-319.076] (-319.348) (-316.911) (-316.103) * (-315.559) [-317.740] (-320.525) (-323.109) -- 0:00:37
      371500 -- (-316.900) [-316.731] (-316.573) (-318.743) * (-316.787) (-318.409) [-318.094] (-320.275) -- 0:00:37
      372000 -- (-315.747) [-317.554] (-317.864) (-316.760) * (-316.262) (-318.258) [-316.948] (-318.549) -- 0:00:37
      372500 -- [-316.563] (-316.511) (-320.448) (-317.611) * [-315.644] (-316.411) (-319.653) (-321.843) -- 0:00:37
      373000 -- (-317.363) (-317.061) [-316.249] (-316.463) * (-316.334) (-316.116) (-318.760) [-316.178] -- 0:00:36
      373500 -- [-317.659] (-316.157) (-320.966) (-316.218) * [-316.916] (-316.667) (-316.561) (-315.586) -- 0:00:36
      374000 -- (-320.324) (-316.024) (-319.300) [-316.560] * (-319.484) (-316.170) [-315.063] (-321.770) -- 0:00:36
      374500 -- (-319.561) (-316.600) (-316.860) [-317.363] * (-320.252) [-319.988] (-315.934) (-319.296) -- 0:00:36
      375000 -- (-318.331) [-317.570] (-318.955) (-317.358) * (-319.324) (-324.246) (-315.124) [-316.612] -- 0:00:36

      Average standard deviation of split frequencies: 0.015323

      375500 -- (-317.040) [-317.872] (-318.185) (-320.002) * (-320.543) (-316.582) [-318.265] (-317.648) -- 0:00:36
      376000 -- (-318.987) (-318.794) (-318.945) [-317.225] * (-322.265) [-320.590] (-316.598) (-317.917) -- 0:00:36
      376500 -- (-319.644) (-317.677) [-318.726] (-315.188) * (-318.349) (-317.065) (-317.882) [-316.636] -- 0:00:36
      377000 -- [-315.905] (-317.151) (-317.083) (-317.632) * (-318.489) (-320.504) [-317.191] (-320.279) -- 0:00:36
      377500 -- (-316.269) (-316.335) [-316.164] (-317.191) * (-318.051) (-317.402) [-316.265] (-316.183) -- 0:00:36
      378000 -- (-318.594) (-317.510) (-317.223) [-317.466] * (-316.878) (-316.516) [-317.009] (-315.578) -- 0:00:36
      378500 -- (-317.269) [-315.754] (-315.247) (-316.219) * [-318.199] (-320.983) (-316.392) (-317.249) -- 0:00:36
      379000 -- [-318.057] (-315.954) (-318.040) (-316.059) * (-316.921) (-316.940) [-317.502] (-317.254) -- 0:00:37
      379500 -- (-317.786) (-316.429) [-316.068] (-316.922) * [-316.520] (-316.457) (-317.769) (-318.737) -- 0:00:37
      380000 -- [-316.385] (-315.430) (-321.287) (-317.953) * (-315.454) (-315.104) [-320.439] (-315.427) -- 0:00:37

      Average standard deviation of split frequencies: 0.015867

      380500 -- (-317.000) [-318.334] (-317.740) (-316.047) * (-317.833) [-317.487] (-315.653) (-318.451) -- 0:00:37
      381000 -- (-316.363) (-318.238) [-315.894] (-316.197) * (-316.331) (-316.452) [-315.833] (-316.056) -- 0:00:37
      381500 -- (-315.424) [-316.971] (-319.533) (-318.333) * (-315.244) (-320.406) (-315.476) [-319.356] -- 0:00:37
      382000 -- (-315.741) [-319.643] (-318.538) (-315.931) * (-316.906) (-318.909) (-316.703) [-317.398] -- 0:00:37
      382500 -- (-315.627) (-318.062) [-317.585] (-320.038) * (-317.923) (-321.113) (-316.317) [-316.188] -- 0:00:37
      383000 -- [-317.390] (-318.231) (-320.194) (-318.663) * (-317.714) [-316.409] (-319.911) (-315.904) -- 0:00:37
      383500 -- (-317.161) [-320.178] (-318.599) (-316.849) * (-316.010) (-319.327) (-316.765) [-316.625] -- 0:00:36
      384000 -- (-317.230) [-315.662] (-317.021) (-316.837) * (-318.894) (-317.755) [-317.484] (-317.155) -- 0:00:36
      384500 -- [-317.378] (-317.358) (-320.006) (-317.235) * (-318.172) [-316.517] (-320.310) (-317.533) -- 0:00:36
      385000 -- (-318.564) [-316.120] (-321.014) (-315.865) * (-317.393) [-318.961] (-320.247) (-315.793) -- 0:00:36

      Average standard deviation of split frequencies: 0.014808

      385500 -- (-318.401) [-319.144] (-321.919) (-317.708) * [-315.975] (-315.851) (-315.836) (-317.631) -- 0:00:36
      386000 -- (-317.077) (-320.658) [-318.375] (-315.651) * (-315.452) (-317.770) [-318.793] (-320.342) -- 0:00:36
      386500 -- [-317.665] (-317.615) (-321.955) (-315.862) * [-317.188] (-315.739) (-316.671) (-317.150) -- 0:00:36
      387000 -- (-318.550) [-316.327] (-317.701) (-316.255) * (-317.872) [-315.525] (-319.885) (-319.171) -- 0:00:36
      387500 -- (-316.083) (-315.530) [-315.668] (-315.554) * (-317.141) (-316.411) [-321.227] (-320.515) -- 0:00:36
      388000 -- (-316.900) (-316.931) (-319.110) [-315.557] * (-316.853) (-318.725) (-317.582) [-319.787] -- 0:00:36
      388500 -- (-318.086) [-318.029] (-322.154) (-320.214) * (-318.286) (-318.795) (-320.979) [-319.688] -- 0:00:36
      389000 -- (-316.874) (-316.682) (-320.501) [-315.431] * (-317.012) [-315.883] (-317.564) (-318.555) -- 0:00:36
      389500 -- (-318.104) (-315.893) [-319.959] (-315.317) * (-316.930) (-317.461) [-316.316] (-316.998) -- 0:00:36
      390000 -- (-317.143) [-317.371] (-318.839) (-315.560) * (-320.184) (-317.858) (-315.880) [-315.855] -- 0:00:35

      Average standard deviation of split frequencies: 0.015048

      390500 -- (-318.942) (-317.632) (-319.813) [-316.978] * [-319.627] (-315.980) (-316.872) (-318.444) -- 0:00:35
      391000 -- [-315.341] (-319.674) (-317.194) (-315.995) * (-317.036) [-315.319] (-317.550) (-316.415) -- 0:00:35
      391500 -- (-317.301) (-319.042) (-318.020) [-316.109] * (-316.940) [-315.046] (-318.883) (-316.329) -- 0:00:35
      392000 -- (-317.348) (-317.058) (-317.782) [-315.974] * (-317.897) (-316.423) (-319.218) [-318.000] -- 0:00:35
      392500 -- (-315.834) (-316.269) [-318.405] (-317.255) * (-315.804) (-317.582) (-316.357) [-315.855] -- 0:00:35
      393000 -- [-318.764] (-316.710) (-318.102) (-320.936) * (-318.519) [-319.756] (-320.611) (-318.798) -- 0:00:35
      393500 -- [-315.806] (-321.010) (-318.517) (-319.333) * (-318.870) (-316.270) (-319.956) [-319.538] -- 0:00:35
      394000 -- [-316.400] (-321.418) (-316.457) (-315.441) * [-316.982] (-316.697) (-320.633) (-319.461) -- 0:00:35
      394500 -- (-321.846) (-318.615) [-317.852] (-315.978) * (-319.134) [-317.057] (-318.761) (-319.719) -- 0:00:35
      395000 -- (-316.296) [-316.831] (-316.712) (-316.150) * (-320.853) [-318.962] (-315.501) (-318.127) -- 0:00:35

      Average standard deviation of split frequencies: 0.013913

      395500 -- (-316.113) [-316.683] (-316.514) (-317.104) * (-317.466) (-315.986) [-322.308] (-317.724) -- 0:00:35
      396000 -- (-315.062) (-315.394) (-316.290) [-316.584] * (-318.078) [-317.157] (-318.988) (-317.322) -- 0:00:36
      396500 -- (-314.925) (-317.180) [-315.726] (-317.196) * (-319.608) [-315.104] (-316.327) (-315.505) -- 0:00:36
      397000 -- (-315.540) [-318.211] (-315.494) (-316.118) * (-318.929) (-315.793) (-321.644) [-317.493] -- 0:00:36
      397500 -- (-317.357) (-319.197) (-317.467) [-316.960] * (-318.578) [-316.855] (-320.765) (-317.063) -- 0:00:36
      398000 -- [-316.303] (-316.261) (-316.305) (-317.613) * (-317.509) (-316.766) [-316.760] (-315.330) -- 0:00:36
      398500 -- (-317.148) [-316.508] (-317.780) (-318.087) * (-316.160) (-315.967) (-319.022) [-316.504] -- 0:00:36
      399000 -- (-316.604) (-317.956) [-316.275] (-316.895) * (-316.201) (-315.791) (-316.956) [-317.854] -- 0:00:36
      399500 -- [-316.800] (-322.786) (-315.839) (-317.684) * [-315.952] (-316.226) (-318.813) (-316.412) -- 0:00:36
      400000 -- (-316.919) (-319.720) [-321.052] (-318.077) * [-318.031] (-316.511) (-317.756) (-318.201) -- 0:00:36

      Average standard deviation of split frequencies: 0.012280

      400500 -- (-317.111) [-316.295] (-316.891) (-324.606) * (-317.737) (-319.469) (-322.564) [-319.498] -- 0:00:35
      401000 -- (-317.637) (-317.769) (-316.433) [-316.695] * [-315.731] (-318.794) (-318.486) (-317.215) -- 0:00:35
      401500 -- (-315.777) (-315.701) [-315.901] (-315.787) * [-316.540] (-316.214) (-317.178) (-318.420) -- 0:00:35
      402000 -- (-317.401) [-317.391] (-318.245) (-318.412) * (-316.241) (-317.096) [-317.478] (-318.313) -- 0:00:35
      402500 -- [-317.482] (-318.993) (-321.197) (-318.444) * (-316.800) [-317.062] (-317.379) (-316.270) -- 0:00:35
      403000 -- (-318.697) (-320.278) (-319.228) [-316.325] * (-321.195) (-319.576) [-319.518] (-317.108) -- 0:00:35
      403500 -- (-319.215) (-318.905) (-318.337) [-316.896] * (-317.678) [-318.447] (-324.458) (-319.657) -- 0:00:35
      404000 -- (-316.938) [-316.272] (-317.389) (-316.006) * (-316.647) (-316.548) (-316.369) [-318.044] -- 0:00:35
      404500 -- [-316.241] (-315.591) (-317.494) (-317.022) * (-321.043) (-317.455) (-316.919) [-320.312] -- 0:00:35
      405000 -- [-316.126] (-316.203) (-316.188) (-318.604) * (-316.195) (-315.862) [-317.689] (-316.464) -- 0:00:35

      Average standard deviation of split frequencies: 0.011884

      405500 -- (-319.368) [-318.101] (-317.289) (-316.491) * (-318.419) (-317.116) (-316.842) [-315.084] -- 0:00:35
      406000 -- [-318.271] (-316.418) (-317.702) (-316.537) * (-316.376) (-315.955) (-316.661) [-315.352] -- 0:00:35
      406500 -- (-320.262) [-316.009] (-317.359) (-320.505) * (-319.579) (-318.172) (-315.880) [-316.035] -- 0:00:35
      407000 -- (-316.632) (-319.245) (-317.007) [-315.300] * (-320.850) [-315.785] (-317.242) (-317.740) -- 0:00:34
      407500 -- [-318.126] (-315.795) (-320.679) (-316.663) * [-316.394] (-316.261) (-316.442) (-318.335) -- 0:00:34
      408000 -- [-315.243] (-319.033) (-319.702) (-319.184) * (-316.492) (-318.766) (-316.212) [-316.963] -- 0:00:34
      408500 -- [-317.846] (-315.730) (-315.991) (-316.916) * (-318.318) [-317.553] (-319.496) (-317.067) -- 0:00:34
      409000 -- (-320.704) (-317.745) [-318.123] (-318.206) * [-315.343] (-319.169) (-315.816) (-319.275) -- 0:00:34
      409500 -- (-315.972) [-320.449] (-316.150) (-316.618) * (-317.093) (-318.355) (-318.880) [-316.306] -- 0:00:34
      410000 -- (-318.300) (-321.611) (-315.298) [-317.006] * (-318.855) [-322.217] (-316.720) (-318.113) -- 0:00:34

      Average standard deviation of split frequencies: 0.011479

      410500 -- (-322.024) (-318.057) [-315.558] (-316.753) * (-316.512) (-320.689) [-318.667] (-317.908) -- 0:00:34
      411000 -- [-316.245] (-318.135) (-317.561) (-318.297) * (-318.903) (-320.959) (-315.661) [-316.670] -- 0:00:34
      411500 -- (-316.913) (-315.499) (-319.090) [-319.518] * [-316.206] (-317.858) (-317.293) (-317.516) -- 0:00:34
      412000 -- [-317.775] (-320.012) (-317.877) (-319.226) * [-317.030] (-320.213) (-315.641) (-317.948) -- 0:00:34
      412500 -- [-316.933] (-319.590) (-315.676) (-318.063) * (-319.484) (-321.015) (-321.429) [-317.160] -- 0:00:34
      413000 -- (-316.210) (-323.277) [-316.406] (-315.509) * (-316.749) (-322.184) (-318.718) [-316.814] -- 0:00:35
      413500 -- (-317.815) (-323.517) [-316.838] (-319.086) * [-315.402] (-322.122) (-316.975) (-317.024) -- 0:00:35
      414000 -- (-319.735) (-317.946) (-319.294) [-315.837] * (-316.799) (-318.882) (-318.005) [-319.387] -- 0:00:35
      414500 -- (-318.709) (-318.082) [-318.224] (-315.559) * (-316.927) [-316.399] (-317.659) (-320.137) -- 0:00:35
      415000 -- (-321.436) (-316.942) [-316.742] (-317.482) * (-327.722) (-317.729) (-320.424) [-318.618] -- 0:00:35

      Average standard deviation of split frequencies: 0.011757

      415500 -- [-317.284] (-318.624) (-320.067) (-319.046) * (-315.745) [-316.047] (-318.594) (-318.136) -- 0:00:35
      416000 -- (-318.507) (-319.555) (-319.962) [-316.949] * (-318.284) [-315.598] (-316.784) (-322.105) -- 0:00:35
      416500 -- (-317.992) (-316.075) [-316.625] (-318.681) * (-315.990) (-317.277) [-317.298] (-319.890) -- 0:00:35
      417000 -- [-316.221] (-316.100) (-316.864) (-315.416) * (-316.558) (-319.523) (-320.323) [-317.507] -- 0:00:34
      417500 -- (-316.274) (-315.433) (-317.696) [-318.164] * [-318.388] (-324.327) (-318.401) (-316.676) -- 0:00:34
      418000 -- (-317.058) (-315.600) (-319.139) [-318.571] * (-315.199) (-319.936) (-318.145) [-318.511] -- 0:00:34
      418500 -- [-317.289] (-315.290) (-320.725) (-323.477) * (-316.785) (-320.708) [-320.942] (-317.675) -- 0:00:34
      419000 -- [-322.845] (-316.973) (-316.622) (-316.022) * [-319.545] (-319.409) (-319.117) (-316.101) -- 0:00:34
      419500 -- (-321.380) [-315.300] (-323.225) (-320.351) * (-318.181) (-320.229) [-315.246] (-319.050) -- 0:00:34
      420000 -- (-316.520) (-320.236) (-317.023) [-316.841] * (-318.310) (-317.879) [-318.334] (-316.693) -- 0:00:34

      Average standard deviation of split frequencies: 0.011556

      420500 -- (-315.175) (-316.817) (-315.725) [-316.935] * (-317.847) (-318.197) [-319.952] (-319.519) -- 0:00:34
      421000 -- [-317.253] (-316.423) (-317.437) (-317.343) * (-319.656) (-317.001) [-316.124] (-319.793) -- 0:00:34
      421500 -- (-316.586) (-317.670) (-315.944) [-316.216] * [-315.066] (-319.491) (-315.763) (-315.644) -- 0:00:34
      422000 -- (-319.752) [-322.806] (-316.999) (-315.869) * (-316.337) [-317.221] (-318.187) (-319.850) -- 0:00:34
      422500 -- (-316.484) (-317.741) [-318.219] (-317.813) * [-316.213] (-316.065) (-318.023) (-315.310) -- 0:00:34
      423000 -- (-325.713) (-315.226) (-317.168) [-321.029] * (-317.369) [-315.092] (-317.424) (-315.994) -- 0:00:34
      423500 -- (-319.172) (-317.725) (-316.367) [-317.471] * (-317.983) (-316.292) (-318.278) [-315.157] -- 0:00:34
      424000 -- (-315.821) (-316.354) [-316.650] (-316.490) * (-319.196) [-319.762] (-319.792) (-316.440) -- 0:00:33
      424500 -- [-317.287] (-317.387) (-316.179) (-319.568) * (-316.874) (-315.625) [-316.538] (-321.546) -- 0:00:33
      425000 -- (-315.748) [-317.957] (-319.521) (-317.907) * [-318.830] (-316.872) (-317.831) (-317.050) -- 0:00:33

      Average standard deviation of split frequencies: 0.012103

      425500 -- (-317.839) (-320.985) (-321.354) [-318.109] * (-318.432) [-317.050] (-319.295) (-316.780) -- 0:00:33
      426000 -- (-318.098) [-316.675] (-318.534) (-321.304) * (-315.558) (-316.683) [-315.789] (-316.430) -- 0:00:33
      426500 -- (-316.236) [-316.191] (-316.279) (-317.419) * (-316.830) (-317.850) (-316.840) [-317.632] -- 0:00:33
      427000 -- (-315.884) [-316.150] (-318.159) (-316.418) * [-318.990] (-323.860) (-319.590) (-318.842) -- 0:00:33
      427500 -- (-318.255) (-317.447) [-317.958] (-316.235) * (-316.400) (-316.620) [-319.883] (-318.869) -- 0:00:33
      428000 -- (-316.634) [-316.233] (-321.034) (-318.608) * (-316.308) [-316.602] (-317.569) (-316.992) -- 0:00:33
      428500 -- [-316.654] (-317.076) (-315.571) (-317.660) * (-326.637) (-317.686) [-315.429] (-318.944) -- 0:00:33
      429000 -- [-316.496] (-316.440) (-321.820) (-317.621) * [-322.045] (-321.390) (-318.618) (-318.218) -- 0:00:33
      429500 -- (-318.228) [-319.283] (-318.851) (-316.197) * [-315.870] (-318.281) (-316.305) (-317.592) -- 0:00:33
      430000 -- (-317.656) (-318.206) (-317.611) [-316.556] * (-315.662) [-316.463] (-318.315) (-317.851) -- 0:00:33

      Average standard deviation of split frequencies: 0.013340

      430500 -- (-317.396) (-316.703) (-318.898) [-315.377] * [-317.444] (-318.154) (-315.609) (-317.137) -- 0:00:34
      431000 -- (-315.732) (-316.967) [-316.740] (-317.667) * (-317.433) (-319.557) (-316.251) [-321.560] -- 0:00:34
      431500 -- (-317.056) (-315.939) [-318.069] (-318.367) * (-317.643) [-318.455] (-317.029) (-316.293) -- 0:00:34
      432000 -- [-317.062] (-317.575) (-318.315) (-317.227) * (-325.664) [-317.043] (-316.271) (-316.482) -- 0:00:34
      432500 -- [-316.435] (-316.268) (-318.364) (-322.665) * (-318.006) [-317.708] (-315.582) (-316.638) -- 0:00:34
      433000 -- (-315.808) [-316.831] (-316.902) (-318.018) * [-316.812] (-317.595) (-316.579) (-316.469) -- 0:00:34
      433500 -- [-315.592] (-316.242) (-315.345) (-316.221) * [-315.711] (-315.170) (-321.820) (-320.576) -- 0:00:33
      434000 -- (-317.198) (-315.984) (-319.405) [-316.772] * (-316.173) [-316.414] (-315.152) (-317.253) -- 0:00:33
      434500 -- (-317.264) (-315.278) (-319.028) [-318.001] * (-314.891) (-318.841) [-316.789] (-320.087) -- 0:00:33
      435000 -- (-318.553) (-318.095) (-319.580) [-316.757] * (-316.194) (-316.055) (-318.205) [-316.134] -- 0:00:33

      Average standard deviation of split frequencies: 0.012164

      435500 -- (-317.549) [-316.104] (-315.574) (-320.462) * [-318.132] (-318.742) (-317.104) (-318.573) -- 0:00:33
      436000 -- (-315.595) (-316.702) [-317.907] (-319.488) * (-315.664) (-320.617) (-321.261) [-319.319] -- 0:00:33
      436500 -- (-314.934) (-321.131) [-320.602] (-318.668) * (-317.441) (-315.701) (-320.772) [-319.136] -- 0:00:33
      437000 -- (-317.625) [-319.448] (-317.952) (-317.512) * (-320.106) (-318.261) [-317.692] (-317.667) -- 0:00:33
      437500 -- [-316.754] (-317.145) (-317.303) (-315.774) * (-319.637) (-316.173) (-321.083) [-319.171] -- 0:00:33
      438000 -- (-318.045) (-316.489) (-319.620) [-318.922] * (-318.523) [-319.967] (-319.324) (-318.077) -- 0:00:33
      438500 -- (-316.741) (-319.205) [-318.150] (-316.097) * [-317.988] (-315.468) (-318.172) (-316.249) -- 0:00:33
      439000 -- (-317.102) (-317.914) [-317.562] (-316.943) * (-315.440) [-320.753] (-317.689) (-315.969) -- 0:00:33
      439500 -- (-317.759) [-318.220] (-318.127) (-316.396) * (-317.477) (-317.266) (-315.644) [-319.156] -- 0:00:33
      440000 -- [-315.937] (-319.047) (-317.583) (-316.570) * (-317.074) (-317.792) [-319.927] (-317.159) -- 0:00:33

      Average standard deviation of split frequencies: 0.011634

      440500 -- (-319.168) (-315.736) (-317.190) [-318.112] * [-315.578] (-324.133) (-319.679) (-316.694) -- 0:00:33
      441000 -- (-319.166) [-316.853] (-317.024) (-317.265) * (-315.586) [-317.155] (-319.879) (-317.595) -- 0:00:32
      441500 -- [-315.968] (-318.521) (-317.086) (-316.170) * (-315.535) [-318.442] (-316.784) (-317.403) -- 0:00:32
      442000 -- [-318.087] (-320.312) (-316.744) (-318.330) * (-321.107) [-317.054] (-315.317) (-317.604) -- 0:00:32
      442500 -- (-317.830) (-319.747) [-318.218] (-317.196) * (-317.866) (-316.421) [-316.519] (-317.306) -- 0:00:32
      443000 -- (-316.386) (-318.435) (-320.033) [-317.045] * [-316.733] (-319.084) (-318.412) (-317.019) -- 0:00:32
      443500 -- [-315.266] (-317.871) (-319.054) (-318.066) * (-319.484) [-319.054] (-317.673) (-318.324) -- 0:00:32
      444000 -- (-316.732) (-315.206) (-317.699) [-317.444] * (-320.031) (-316.976) [-315.482] (-318.198) -- 0:00:32
      444500 -- (-316.676) (-315.709) [-318.268] (-316.611) * [-321.674] (-316.113) (-316.889) (-318.658) -- 0:00:32
      445000 -- (-319.857) [-318.550] (-318.589) (-315.730) * [-323.066] (-318.031) (-322.334) (-316.487) -- 0:00:32

      Average standard deviation of split frequencies: 0.011296

      445500 -- (-319.016) (-322.575) (-319.428) [-316.090] * (-317.543) (-317.180) (-317.654) [-317.128] -- 0:00:32
      446000 -- (-315.300) (-319.075) (-317.407) [-316.052] * (-315.812) (-319.741) (-316.784) [-315.803] -- 0:00:32
      446500 -- [-319.491] (-316.701) (-317.950) (-320.204) * (-315.183) (-318.503) (-319.959) [-319.692] -- 0:00:32
      447000 -- (-316.820) (-315.406) (-319.085) [-315.222] * (-320.198) (-316.976) (-321.639) [-316.965] -- 0:00:32
      447500 -- (-319.763) (-317.607) (-319.069) [-317.640] * (-316.254) (-320.507) (-316.483) [-318.971] -- 0:00:33
      448000 -- (-318.969) (-318.277) (-317.881) [-318.466] * (-317.761) [-316.200] (-320.241) (-316.966) -- 0:00:33
      448500 -- (-317.563) [-318.308] (-319.148) (-315.881) * (-316.467) [-317.347] (-318.762) (-316.335) -- 0:00:33
      449000 -- (-318.278) (-317.387) [-316.209] (-319.007) * (-317.950) (-316.406) (-325.771) [-318.358] -- 0:00:33
      449500 -- (-317.318) (-319.943) [-316.771] (-319.241) * (-316.998) [-315.981] (-316.707) (-316.577) -- 0:00:33
      450000 -- (-315.852) (-317.104) (-316.447) [-318.171] * [-318.837] (-319.135) (-320.721) (-317.093) -- 0:00:33

      Average standard deviation of split frequencies: 0.010199

      450500 -- (-318.218) (-315.781) (-316.564) [-317.015] * (-318.199) (-315.304) (-321.774) [-316.854] -- 0:00:32
      451000 -- (-315.725) (-317.071) (-316.180) [-316.800] * (-318.688) [-315.898] (-317.130) (-319.864) -- 0:00:32
      451500 -- [-315.495] (-316.081) (-317.610) (-319.002) * (-325.835) (-315.473) (-315.822) [-317.311] -- 0:00:32
      452000 -- (-317.617) (-315.559) [-315.897] (-316.470) * (-315.598) [-320.062] (-321.620) (-316.346) -- 0:00:32
      452500 -- [-318.213] (-318.379) (-319.392) (-318.334) * (-318.092) [-316.957] (-321.474) (-318.487) -- 0:00:32
      453000 -- [-318.153] (-315.067) (-319.158) (-316.569) * (-320.047) (-317.378) [-317.232] (-316.895) -- 0:00:32
      453500 -- (-316.450) [-316.769] (-319.099) (-320.664) * (-317.320) [-319.383] (-316.499) (-320.498) -- 0:00:32
      454000 -- (-318.554) (-315.972) [-315.461] (-320.317) * (-315.851) [-319.498] (-319.579) (-316.951) -- 0:00:32
      454500 -- (-318.345) [-317.441] (-323.634) (-316.422) * (-320.677) (-318.778) [-319.258] (-318.017) -- 0:00:32
      455000 -- (-319.868) (-318.059) (-319.528) [-322.697] * [-317.963] (-316.660) (-322.780) (-316.217) -- 0:00:32

      Average standard deviation of split frequencies: 0.010661

      455500 -- (-318.597) [-316.971] (-318.821) (-325.585) * (-318.990) [-315.943] (-317.512) (-314.931) -- 0:00:32
      456000 -- [-317.858] (-318.304) (-316.049) (-316.322) * [-316.074] (-316.936) (-319.733) (-318.133) -- 0:00:32
      456500 -- (-316.212) (-318.562) (-316.461) [-316.175] * [-316.616] (-317.460) (-318.197) (-320.146) -- 0:00:32
      457000 -- (-316.289) [-319.366] (-317.228) (-315.983) * (-318.335) (-320.142) [-316.996] (-319.070) -- 0:00:32
      457500 -- (-318.577) (-321.379) [-316.992] (-319.086) * (-318.495) (-318.008) [-321.211] (-323.227) -- 0:00:32
      458000 -- (-319.552) (-318.025) (-319.559) [-319.829] * (-316.557) (-317.244) (-315.873) [-316.447] -- 0:00:31
      458500 -- (-316.962) (-320.338) [-316.315] (-318.456) * [-316.487] (-316.741) (-316.955) (-315.775) -- 0:00:31
      459000 -- (-318.852) (-319.687) [-316.292] (-318.791) * (-318.507) (-315.398) [-318.415] (-319.472) -- 0:00:31
      459500 -- (-315.208) (-317.205) (-320.585) [-317.208] * [-317.433] (-321.101) (-316.117) (-317.295) -- 0:00:31
      460000 -- (-316.983) (-317.013) [-317.493] (-318.974) * (-315.956) (-316.749) (-317.350) [-316.356] -- 0:00:31

      Average standard deviation of split frequencies: 0.011200

      460500 -- (-316.413) (-318.455) [-316.317] (-317.471) * (-315.258) (-319.804) [-319.352] (-316.456) -- 0:00:31
      461000 -- [-317.591] (-319.319) (-318.611) (-316.078) * [-316.086] (-321.828) (-319.287) (-316.752) -- 0:00:31
      461500 -- [-315.751] (-317.911) (-318.381) (-315.879) * (-317.791) (-318.580) (-320.435) [-316.966] -- 0:00:31
      462000 -- [-316.413] (-315.363) (-318.205) (-316.577) * (-319.819) (-319.836) (-317.715) [-317.681] -- 0:00:31
      462500 -- [-315.640] (-317.268) (-316.730) (-320.030) * (-316.135) (-317.842) (-317.273) [-318.176] -- 0:00:31
      463000 -- (-317.170) (-316.912) [-315.776] (-316.441) * (-317.438) (-318.335) (-319.847) [-318.651] -- 0:00:31
      463500 -- [-321.765] (-317.439) (-318.804) (-315.714) * [-320.255] (-315.852) (-316.810) (-316.559) -- 0:00:31
      464000 -- [-318.567] (-317.143) (-318.786) (-316.085) * (-317.359) (-318.729) (-323.509) [-316.415] -- 0:00:31
      464500 -- (-318.373) (-317.033) [-319.063] (-315.654) * (-316.833) [-319.368] (-320.147) (-316.473) -- 0:00:32
      465000 -- (-316.214) (-316.298) [-315.376] (-315.577) * (-315.926) (-315.262) (-320.298) [-315.560] -- 0:00:32

      Average standard deviation of split frequencies: 0.010056

      465500 -- (-316.125) (-317.368) [-315.590] (-315.672) * [-315.029] (-317.693) (-318.194) (-316.932) -- 0:00:32
      466000 -- (-316.739) [-315.871] (-317.202) (-316.403) * [-315.091] (-319.585) (-318.035) (-318.212) -- 0:00:32
      466500 -- (-320.551) (-318.299) [-316.985] (-316.134) * [-315.505] (-316.048) (-320.585) (-317.422) -- 0:00:32
      467000 -- (-315.698) (-318.398) [-316.264] (-320.324) * (-317.091) (-316.069) [-316.380] (-318.564) -- 0:00:31
      467500 -- (-316.526) (-320.096) [-316.900] (-322.176) * (-322.836) (-317.331) [-316.647] (-318.663) -- 0:00:31
      468000 -- (-317.745) (-321.423) [-317.510] (-316.127) * (-316.596) (-315.758) (-320.011) [-317.402] -- 0:00:31
      468500 -- (-321.700) [-316.130] (-316.813) (-315.922) * [-316.177] (-316.380) (-319.936) (-317.956) -- 0:00:31
      469000 -- (-315.946) (-316.022) [-317.784] (-317.097) * (-318.746) (-318.002) [-316.604] (-320.554) -- 0:00:31
      469500 -- [-316.332] (-318.353) (-318.382) (-315.778) * [-316.663] (-318.591) (-319.300) (-315.948) -- 0:00:31
      470000 -- (-316.284) (-316.158) (-318.472) [-315.913] * (-315.772) [-316.971] (-316.954) (-317.544) -- 0:00:31

      Average standard deviation of split frequencies: 0.011462

      470500 -- (-316.024) [-316.057] (-316.651) (-317.847) * (-318.140) (-317.231) [-317.048] (-319.525) -- 0:00:31
      471000 -- [-317.311] (-315.575) (-320.253) (-316.163) * (-316.197) [-315.952] (-319.450) (-316.472) -- 0:00:31
      471500 -- [-317.799] (-316.614) (-317.544) (-316.299) * (-315.905) (-316.214) (-315.887) [-316.963] -- 0:00:31
      472000 -- (-319.061) (-315.603) [-318.631] (-317.430) * [-315.628] (-315.942) (-315.644) (-317.072) -- 0:00:31
      472500 -- (-318.918) (-319.254) (-317.274) [-319.095] * (-321.600) [-315.851] (-315.436) (-319.086) -- 0:00:31
      473000 -- [-318.118] (-322.077) (-315.249) (-318.707) * (-321.821) (-317.915) (-318.168) [-316.637] -- 0:00:31
      473500 -- (-319.027) [-322.469] (-315.065) (-319.708) * (-319.795) (-317.147) (-318.207) [-317.270] -- 0:00:31
      474000 -- (-318.990) (-324.025) [-317.983] (-315.592) * (-318.724) [-316.729] (-319.026) (-315.657) -- 0:00:31
      474500 -- (-321.108) [-316.564] (-320.894) (-315.861) * [-320.017] (-326.091) (-318.162) (-316.717) -- 0:00:31
      475000 -- (-318.029) (-320.345) [-316.031] (-315.312) * [-315.848] (-317.976) (-317.877) (-315.386) -- 0:00:30

      Average standard deviation of split frequencies: 0.010674

      475500 -- [-316.260] (-318.412) (-316.355) (-315.776) * (-316.065) (-317.801) [-318.153] (-315.827) -- 0:00:30
      476000 -- (-317.520) (-316.593) (-317.019) [-315.483] * (-318.190) (-315.689) (-318.820) [-316.974] -- 0:00:30
      476500 -- (-318.614) (-315.741) (-317.608) [-317.181] * (-321.379) (-321.229) (-316.724) [-317.213] -- 0:00:30
      477000 -- (-319.768) (-316.511) (-317.798) [-316.178] * [-319.462] (-320.131) (-317.300) (-316.744) -- 0:00:30
      477500 -- [-318.704] (-317.103) (-316.583) (-317.062) * (-321.517) [-318.717] (-318.765) (-316.381) -- 0:00:30
      478000 -- (-318.121) [-317.200] (-316.696) (-319.158) * (-318.346) [-320.436] (-322.403) (-316.083) -- 0:00:30
      478500 -- (-319.774) (-324.420) [-316.871] (-316.633) * (-317.749) (-320.970) (-322.480) [-315.357] -- 0:00:30
      479000 -- (-320.686) (-319.277) [-315.704] (-318.713) * (-318.222) [-317.262] (-319.457) (-317.331) -- 0:00:30
      479500 -- [-316.945] (-317.531) (-318.645) (-316.341) * (-321.524) [-317.230] (-318.826) (-316.464) -- 0:00:30
      480000 -- (-318.904) [-317.488] (-318.003) (-315.903) * (-317.779) [-316.636] (-317.973) (-322.150) -- 0:00:30

      Average standard deviation of split frequencies: 0.010407

      480500 -- [-315.449] (-316.500) (-318.095) (-318.328) * (-316.084) (-318.453) [-317.254] (-318.551) -- 0:00:30
      481000 -- (-317.798) (-319.519) [-317.311] (-320.845) * (-316.896) (-318.093) (-321.430) [-316.794] -- 0:00:30
      481500 -- (-317.787) [-315.977] (-316.472) (-324.938) * (-316.861) [-318.818] (-317.922) (-316.793) -- 0:00:31
      482000 -- (-316.615) (-317.934) (-317.264) [-316.910] * (-317.054) (-317.336) [-315.845] (-315.343) -- 0:00:31
      482500 -- (-321.444) (-316.102) (-317.901) [-317.520] * (-317.720) (-319.223) (-317.086) [-317.356] -- 0:00:31
      483000 -- (-318.653) (-315.955) [-316.146] (-318.146) * [-321.168] (-316.434) (-318.493) (-319.529) -- 0:00:31
      483500 -- (-318.119) (-316.770) (-319.966) [-317.078] * (-319.877) (-317.182) [-316.473] (-317.054) -- 0:00:30
      484000 -- [-318.187] (-316.556) (-316.797) (-315.407) * (-315.944) [-315.582] (-322.302) (-317.547) -- 0:00:30
      484500 -- [-319.151] (-317.014) (-315.823) (-318.724) * (-317.380) (-315.160) [-317.400] (-316.455) -- 0:00:30
      485000 -- (-318.057) (-319.445) (-317.899) [-315.491] * (-319.452) [-318.197] (-318.468) (-315.244) -- 0:00:30

      Average standard deviation of split frequencies: 0.010508

      485500 -- [-316.651] (-316.847) (-321.026) (-315.419) * [-316.312] (-316.408) (-318.635) (-318.783) -- 0:00:30
      486000 -- [-316.451] (-319.902) (-317.598) (-315.824) * [-315.399] (-317.196) (-320.584) (-317.739) -- 0:00:30
      486500 -- (-318.261) [-318.091] (-317.491) (-317.312) * (-316.792) (-317.000) (-318.686) [-317.545] -- 0:00:30
      487000 -- (-319.446) (-316.048) (-321.892) [-315.927] * (-317.203) (-317.671) (-321.468) [-317.327] -- 0:00:30
      487500 -- (-317.482) [-317.424] (-317.962) (-319.327) * (-319.169) (-317.836) [-318.219] (-316.519) -- 0:00:30
      488000 -- (-315.423) (-317.178) [-317.187] (-315.867) * (-317.501) (-316.363) [-316.634] (-316.832) -- 0:00:30
      488500 -- (-317.138) (-318.214) (-319.667) [-318.691] * (-317.469) (-316.005) [-316.305] (-318.736) -- 0:00:30
      489000 -- (-315.285) [-316.561] (-315.981) (-318.689) * (-315.839) (-325.108) (-319.370) [-316.290] -- 0:00:30
      489500 -- (-317.232) (-316.192) [-315.983] (-317.224) * (-317.609) (-318.755) (-319.414) [-316.747] -- 0:00:30
      490000 -- (-317.761) (-318.200) (-317.798) [-315.339] * (-315.914) (-317.146) [-318.072] (-317.269) -- 0:00:30

      Average standard deviation of split frequencies: 0.011049

      490500 -- (-316.530) (-318.093) (-315.279) [-317.819] * (-316.951) (-317.706) [-316.713] (-324.946) -- 0:00:30
      491000 -- (-315.739) (-316.014) (-318.027) [-320.417] * (-315.721) [-316.574] (-316.373) (-318.226) -- 0:00:30
      491500 -- (-315.764) (-317.197) [-318.073] (-319.808) * (-317.299) (-320.827) [-315.932] (-318.244) -- 0:00:30
      492000 -- [-316.322] (-326.845) (-317.494) (-319.666) * (-316.527) (-319.476) (-315.611) [-316.798] -- 0:00:29
      492500 -- (-316.938) (-315.971) (-316.820) [-315.965] * [-318.384] (-319.620) (-318.229) (-315.518) -- 0:00:29
      493000 -- (-317.311) (-316.052) [-318.739] (-322.476) * (-316.017) (-318.694) [-316.461] (-316.774) -- 0:00:29
      493500 -- (-315.894) (-315.973) (-316.583) [-315.547] * [-318.375] (-320.798) (-316.128) (-318.219) -- 0:00:29
      494000 -- [-317.535] (-318.517) (-316.628) (-321.294) * (-318.337) [-315.516] (-317.828) (-318.027) -- 0:00:29
      494500 -- (-317.074) [-319.949] (-318.909) (-318.360) * [-317.036] (-316.146) (-316.707) (-316.495) -- 0:00:29
      495000 -- [-315.305] (-315.561) (-319.060) (-315.397) * (-315.455) (-319.819) [-315.936] (-315.995) -- 0:00:29

      Average standard deviation of split frequencies: 0.011035

      495500 -- (-315.790) (-322.592) (-318.688) [-316.193] * (-316.510) (-316.775) (-315.756) [-316.015] -- 0:00:29
      496000 -- (-315.802) (-318.892) (-320.626) [-315.180] * (-317.791) (-320.763) (-318.036) [-318.096] -- 0:00:29
      496500 -- (-320.229) (-317.346) (-319.575) [-316.290] * (-319.750) (-318.428) (-316.040) [-318.024] -- 0:00:29
      497000 -- (-315.970) [-318.927] (-315.930) (-316.853) * (-315.749) (-320.491) (-317.328) [-321.157] -- 0:00:29
      497500 -- [-317.381] (-318.073) (-315.362) (-316.947) * (-315.398) (-319.123) [-316.167] (-318.261) -- 0:00:29
      498000 -- (-318.317) [-317.946] (-316.414) (-316.864) * (-317.449) (-318.011) [-316.944] (-316.083) -- 0:00:29
      498500 -- (-319.145) (-317.271) (-317.766) [-320.210] * (-319.911) (-321.110) [-318.870] (-317.100) -- 0:00:29
      499000 -- [-316.131] (-316.575) (-317.799) (-316.370) * [-318.459] (-320.037) (-315.999) (-318.442) -- 0:00:30
      499500 -- (-316.352) (-319.422) (-317.425) [-317.279] * (-317.282) (-317.085) (-317.859) [-315.841] -- 0:00:30
      500000 -- (-316.085) (-319.671) [-317.860] (-316.020) * (-316.404) (-318.792) [-316.148] (-316.327) -- 0:00:30

      Average standard deviation of split frequencies: 0.010191

      500500 -- [-316.566] (-319.597) (-318.268) (-315.237) * [-317.232] (-316.717) (-322.079) (-319.194) -- 0:00:29
      501000 -- (-315.285) (-317.988) [-318.297] (-318.109) * (-317.131) (-315.567) (-316.252) [-315.720] -- 0:00:29
      501500 -- (-319.450) (-317.178) (-320.363) [-315.643] * (-317.796) (-316.334) [-315.361] (-317.058) -- 0:00:29
      502000 -- (-315.674) (-318.867) [-316.659] (-318.427) * (-317.082) (-317.511) (-315.430) [-318.338] -- 0:00:29
      502500 -- (-318.237) (-315.486) [-315.925] (-317.985) * (-319.801) (-317.045) (-318.712) [-316.292] -- 0:00:29
      503000 -- (-315.759) (-317.378) (-315.610) [-319.962] * (-315.653) [-316.670] (-317.757) (-317.838) -- 0:00:29
      503500 -- (-316.472) (-316.328) [-323.610] (-316.420) * (-319.081) [-315.627] (-315.887) (-316.437) -- 0:00:29
      504000 -- (-316.802) (-321.304) (-324.741) [-316.781] * [-316.706] (-316.656) (-318.605) (-317.274) -- 0:00:29
      504500 -- (-316.334) (-316.051) (-317.799) [-319.324] * (-316.625) (-316.234) (-317.264) [-317.054] -- 0:00:29
      505000 -- (-316.282) (-315.457) (-316.935) [-317.097] * (-316.528) (-317.363) [-317.313] (-317.662) -- 0:00:29

      Average standard deviation of split frequencies: 0.010869

      505500 -- (-320.893) (-318.226) (-317.954) [-316.719] * (-317.183) (-319.446) [-315.461] (-316.882) -- 0:00:29
      506000 -- (-316.115) [-315.814] (-319.868) (-316.355) * (-317.064) (-317.904) [-315.730] (-318.823) -- 0:00:29
      506500 -- (-316.191) (-317.591) (-318.353) [-316.467] * [-315.972] (-319.963) (-317.549) (-320.581) -- 0:00:29
      507000 -- (-316.564) [-318.435] (-315.670) (-321.570) * (-315.558) [-322.629] (-321.382) (-316.462) -- 0:00:29
      507500 -- (-323.268) (-315.203) [-316.361] (-319.064) * (-316.789) (-322.244) [-316.496] (-317.310) -- 0:00:29
      508000 -- (-320.328) [-317.724] (-318.861) (-317.163) * (-316.368) (-320.402) (-318.265) [-319.263] -- 0:00:29
      508500 -- [-315.805] (-316.890) (-315.208) (-316.431) * [-315.641] (-318.902) (-318.713) (-317.865) -- 0:00:28
      509000 -- [-315.517] (-316.746) (-316.807) (-316.288) * (-315.961) [-315.598] (-318.366) (-316.771) -- 0:00:28
      509500 -- (-316.448) (-316.432) [-315.930] (-316.985) * (-316.393) (-315.183) (-316.935) [-316.851] -- 0:00:28
      510000 -- [-317.955] (-319.345) (-318.726) (-316.208) * (-315.449) [-316.482] (-316.714) (-314.972) -- 0:00:28

      Average standard deviation of split frequencies: 0.009394

      510500 -- [-319.014] (-317.866) (-315.812) (-317.196) * (-317.748) [-315.219] (-316.531) (-316.848) -- 0:00:28
      511000 -- (-315.959) [-317.359] (-318.838) (-319.474) * (-317.711) (-318.026) (-315.683) [-315.303] -- 0:00:28
      511500 -- (-315.599) [-320.193] (-316.908) (-315.572) * (-316.935) (-316.191) (-316.387) [-318.316] -- 0:00:28
      512000 -- [-315.856] (-319.944) (-317.260) (-315.177) * (-319.561) [-318.243] (-316.383) (-315.664) -- 0:00:28
      512500 -- (-315.833) [-316.464] (-316.372) (-315.901) * [-316.404] (-317.486) (-319.450) (-316.863) -- 0:00:28
      513000 -- (-316.762) (-316.471) [-316.060] (-316.269) * (-317.301) [-315.244] (-315.615) (-317.197) -- 0:00:28
      513500 -- [-316.455] (-316.895) (-317.535) (-318.646) * (-317.570) (-317.651) (-317.296) [-317.881] -- 0:00:28
      514000 -- (-317.854) (-319.347) [-316.537] (-320.866) * (-316.705) (-316.451) [-316.258] (-318.709) -- 0:00:28
      514500 -- (-318.745) [-316.365] (-316.179) (-322.858) * [-316.326] (-316.019) (-317.081) (-322.617) -- 0:00:28
      515000 -- (-319.187) [-315.735] (-317.610) (-316.877) * (-316.126) (-316.544) (-320.400) [-320.792] -- 0:00:28

      Average standard deviation of split frequencies: 0.009650

      515500 -- (-317.355) (-318.440) [-316.478] (-317.631) * (-315.633) (-316.753) [-317.388] (-325.631) -- 0:00:29
      516000 -- (-319.060) (-318.576) (-320.089) [-315.435] * (-316.434) [-317.666] (-315.347) (-319.457) -- 0:00:29
      516500 -- (-318.441) (-320.698) [-317.099] (-315.586) * [-315.219] (-317.116) (-315.577) (-318.729) -- 0:00:29
      517000 -- [-315.730] (-318.158) (-316.964) (-317.137) * (-315.657) [-315.896] (-317.781) (-315.765) -- 0:00:28
      517500 -- (-321.042) (-316.376) (-316.906) [-316.036] * [-316.548] (-317.002) (-318.585) (-316.092) -- 0:00:28
      518000 -- [-316.889] (-317.778) (-316.088) (-317.437) * (-319.030) (-317.207) [-315.359] (-316.329) -- 0:00:28
      518500 -- (-317.971) (-316.379) [-316.972] (-315.267) * (-316.969) [-318.715] (-319.744) (-316.670) -- 0:00:28
      519000 -- (-318.794) [-317.198] (-324.797) (-316.515) * (-316.208) [-317.173] (-317.153) (-316.995) -- 0:00:28
      519500 -- (-316.654) [-317.916] (-316.923) (-321.531) * (-318.552) [-320.250] (-317.056) (-316.510) -- 0:00:28
      520000 -- (-316.021) (-316.683) [-319.093] (-316.805) * (-318.695) (-318.944) [-317.346] (-317.573) -- 0:00:28

      Average standard deviation of split frequencies: 0.010119

      520500 -- [-320.627] (-316.723) (-318.656) (-315.977) * (-317.939) (-320.217) [-318.951] (-318.124) -- 0:00:28
      521000 -- (-318.614) (-321.224) [-317.248] (-317.325) * (-316.823) (-317.783) [-318.733] (-317.407) -- 0:00:28
      521500 -- (-316.105) (-323.730) (-315.566) [-320.121] * (-317.784) [-317.765] (-316.807) (-316.597) -- 0:00:28
      522000 -- (-318.553) [-319.446] (-318.288) (-319.370) * (-317.225) [-315.817] (-315.732) (-315.441) -- 0:00:28
      522500 -- (-324.297) (-318.058) (-317.422) [-315.969] * [-316.586] (-316.246) (-316.099) (-318.792) -- 0:00:28
      523000 -- [-317.659] (-320.961) (-316.414) (-320.565) * [-315.928] (-316.505) (-316.806) (-317.899) -- 0:00:28
      523500 -- (-316.764) (-316.405) (-317.642) [-315.357] * [-316.820] (-316.953) (-315.070) (-317.143) -- 0:00:28
      524000 -- (-318.289) [-315.597] (-315.209) (-317.450) * (-320.808) (-317.255) [-316.213] (-316.195) -- 0:00:28
      524500 -- (-317.732) (-316.955) [-315.939] (-318.615) * [-320.940] (-316.910) (-317.937) (-317.329) -- 0:00:28
      525000 -- [-317.827] (-319.839) (-319.220) (-316.255) * [-315.993] (-316.714) (-316.470) (-317.835) -- 0:00:28

      Average standard deviation of split frequencies: 0.010438

      525500 -- [-316.750] (-319.089) (-316.050) (-316.871) * (-317.487) (-318.841) [-316.941] (-317.750) -- 0:00:27
      526000 -- (-319.239) (-318.530) [-317.500] (-317.866) * [-316.246] (-317.628) (-316.550) (-316.044) -- 0:00:27
      526500 -- (-319.447) (-319.131) [-316.151] (-316.531) * [-316.220] (-316.447) (-316.475) (-316.809) -- 0:00:27
      527000 -- [-320.178] (-319.884) (-316.346) (-316.568) * (-316.469) (-315.683) [-315.390] (-315.197) -- 0:00:27
      527500 -- (-324.205) [-317.435] (-315.704) (-315.967) * (-315.030) (-315.766) [-316.006] (-315.812) -- 0:00:27
      528000 -- (-315.095) (-315.940) [-316.749] (-315.679) * (-316.305) [-319.216] (-315.597) (-316.692) -- 0:00:27
      528500 -- (-315.368) (-317.059) (-316.989) [-318.666] * [-317.467] (-317.794) (-316.136) (-316.636) -- 0:00:27
      529000 -- (-325.473) [-323.255] (-316.463) (-316.937) * (-315.145) (-318.727) (-318.916) [-317.234] -- 0:00:27
      529500 -- (-319.062) (-315.536) (-317.409) [-316.284] * [-317.373] (-318.241) (-320.960) (-318.533) -- 0:00:27
      530000 -- (-318.107) [-317.684] (-316.692) (-316.312) * (-320.456) (-317.453) (-319.710) [-317.341] -- 0:00:27

      Average standard deviation of split frequencies: 0.010451

      530500 -- (-318.610) [-320.623] (-316.641) (-316.696) * (-317.297) (-315.217) (-317.250) [-321.687] -- 0:00:27
      531000 -- [-317.918] (-322.811) (-315.480) (-316.351) * [-320.001] (-316.411) (-316.510) (-315.856) -- 0:00:27
      531500 -- (-318.590) [-318.835] (-317.500) (-319.355) * (-318.115) (-318.121) [-316.524] (-317.916) -- 0:00:27
      532000 -- [-317.169] (-318.322) (-318.968) (-317.561) * [-317.236] (-316.317) (-317.601) (-315.832) -- 0:00:27
      532500 -- (-320.403) [-315.718] (-322.085) (-316.652) * [-316.108] (-317.035) (-317.275) (-316.029) -- 0:00:28
      533000 -- (-319.363) (-316.606) [-322.134] (-317.247) * (-320.084) (-317.499) (-316.370) [-318.528] -- 0:00:28
      533500 -- (-320.598) (-317.700) (-323.952) [-317.876] * [-316.609] (-316.154) (-318.718) (-316.228) -- 0:00:27
      534000 -- (-317.299) (-316.178) (-321.100) [-317.749] * (-316.763) (-315.914) [-317.506] (-317.238) -- 0:00:27
      534500 -- (-316.014) [-315.095] (-317.775) (-316.462) * (-315.881) [-316.046] (-316.768) (-319.495) -- 0:00:27
      535000 -- (-317.078) (-316.971) (-321.173) [-317.181] * (-315.900) (-321.749) (-316.016) [-319.044] -- 0:00:27

      Average standard deviation of split frequencies: 0.011433

      535500 -- [-315.605] (-317.891) (-322.194) (-316.354) * (-316.598) (-321.634) (-317.243) [-319.862] -- 0:00:27
      536000 -- (-319.417) [-316.082] (-319.255) (-317.610) * [-319.661] (-319.013) (-316.328) (-318.924) -- 0:00:27
      536500 -- (-316.484) (-317.267) [-317.752] (-316.737) * (-317.072) [-315.850] (-316.590) (-319.401) -- 0:00:27
      537000 -- (-315.336) [-316.573] (-322.054) (-323.342) * [-318.594] (-315.929) (-319.568) (-318.397) -- 0:00:27
      537500 -- [-315.734] (-320.921) (-319.292) (-319.528) * (-318.478) (-317.698) [-316.556] (-319.382) -- 0:00:27
      538000 -- (-320.023) (-316.871) (-320.382) [-317.836] * (-317.299) (-320.344) [-316.200] (-318.236) -- 0:00:27
      538500 -- (-315.955) [-317.602] (-317.452) (-315.549) * (-316.692) (-317.630) (-316.291) [-315.321] -- 0:00:27
      539000 -- (-317.097) (-316.257) [-316.817] (-316.565) * [-319.961] (-316.066) (-315.328) (-315.279) -- 0:00:27
      539500 -- (-318.412) (-321.792) (-316.605) [-316.028] * (-315.355) [-315.482] (-319.447) (-317.386) -- 0:00:27
      540000 -- (-317.164) (-315.954) [-322.700] (-320.278) * (-316.541) (-322.401) (-318.416) [-320.235] -- 0:00:27

      Average standard deviation of split frequencies: 0.011444

      540500 -- (-318.520) [-316.738] (-316.794) (-316.495) * (-317.861) [-316.260] (-316.816) (-316.520) -- 0:00:27
      541000 -- (-318.883) [-317.142] (-316.061) (-316.736) * (-320.243) (-318.510) (-316.027) [-318.122] -- 0:00:27
      541500 -- (-315.367) (-319.391) (-316.314) [-317.652] * (-318.584) (-316.001) (-316.030) [-319.030] -- 0:00:27
      542000 -- (-316.215) (-320.156) (-316.807) [-317.458] * (-316.135) (-316.390) [-319.077] (-316.090) -- 0:00:27
      542500 -- [-317.572] (-316.552) (-316.936) (-318.052) * (-316.945) [-315.915] (-319.473) (-316.354) -- 0:00:26
      543000 -- [-316.995] (-318.475) (-319.342) (-317.906) * (-317.393) [-316.264] (-316.090) (-317.728) -- 0:00:26
      543500 -- (-315.443) [-316.375] (-317.251) (-315.740) * (-318.784) (-315.280) [-317.482] (-316.498) -- 0:00:26
      544000 -- (-316.364) (-321.368) [-316.937] (-317.273) * [-316.404] (-315.151) (-319.823) (-315.990) -- 0:00:26
      544500 -- [-318.140] (-316.383) (-316.171) (-316.201) * (-319.214) [-316.747] (-315.018) (-316.583) -- 0:00:26
      545000 -- [-319.083] (-316.088) (-315.239) (-315.772) * (-317.312) (-317.075) [-316.247] (-317.006) -- 0:00:26

      Average standard deviation of split frequencies: 0.011871

      545500 -- (-320.361) (-315.219) [-316.221] (-317.445) * (-317.913) (-323.803) (-317.263) [-319.103] -- 0:00:26
      546000 -- (-316.429) (-316.155) (-315.267) [-317.101] * [-315.767] (-315.788) (-316.501) (-320.418) -- 0:00:26
      546500 -- [-318.575] (-321.368) (-317.130) (-321.357) * (-314.953) (-315.837) [-318.172] (-321.167) -- 0:00:26
      547000 -- (-317.009) (-315.969) (-320.432) [-315.958] * [-315.144] (-319.239) (-317.545) (-316.412) -- 0:00:26
      547500 -- (-317.467) [-315.575] (-316.000) (-315.010) * [-318.772] (-319.313) (-318.016) (-318.953) -- 0:00:26
      548000 -- (-316.543) (-315.631) (-318.584) [-317.009] * (-317.955) [-318.278] (-317.462) (-316.200) -- 0:00:26
      548500 -- (-315.819) (-315.185) [-315.669] (-316.572) * (-316.760) (-316.857) (-318.651) [-317.624] -- 0:00:26
      549000 -- [-317.843] (-316.435) (-319.388) (-316.469) * (-316.359) [-315.695] (-316.518) (-316.785) -- 0:00:26
      549500 -- (-317.570) [-316.730] (-317.314) (-317.338) * (-318.188) (-315.610) (-317.591) [-316.247] -- 0:00:27
      550000 -- [-316.050] (-316.121) (-316.105) (-316.374) * (-317.760) (-316.805) (-317.844) [-316.809] -- 0:00:27

      Average standard deviation of split frequencies: 0.011664

      550500 -- [-318.283] (-319.987) (-316.486) (-316.823) * [-317.815] (-316.201) (-318.299) (-318.685) -- 0:00:26
      551000 -- (-321.590) (-319.735) [-316.464] (-319.186) * (-318.362) [-317.811] (-318.295) (-320.178) -- 0:00:26
      551500 -- [-319.665] (-317.942) (-316.795) (-316.525) * (-315.505) (-316.215) (-316.782) [-316.054] -- 0:00:26
      552000 -- (-315.264) [-318.252] (-317.179) (-315.519) * (-316.690) (-317.482) (-317.668) [-315.620] -- 0:00:26
      552500 -- [-316.008] (-316.921) (-315.859) (-316.074) * (-316.246) (-321.321) (-317.667) [-316.022] -- 0:00:26
      553000 -- [-316.808] (-316.578) (-320.434) (-315.832) * (-317.111) [-316.725] (-319.042) (-317.269) -- 0:00:26
      553500 -- (-316.783) (-317.469) (-321.956) [-315.871] * (-316.738) [-315.696] (-318.820) (-318.397) -- 0:00:26
      554000 -- (-316.923) (-315.935) (-318.206) [-317.701] * (-315.404) [-318.172] (-318.229) (-317.820) -- 0:00:26
      554500 -- (-320.456) (-317.284) [-317.862] (-319.724) * (-317.131) (-318.843) (-316.690) [-317.437] -- 0:00:26
      555000 -- (-317.138) [-316.076] (-319.031) (-321.492) * (-316.755) [-316.050] (-319.526) (-319.171) -- 0:00:26

      Average standard deviation of split frequencies: 0.011022

      555500 -- (-316.997) [-319.218] (-316.737) (-317.696) * (-317.009) (-320.529) (-317.000) [-319.257] -- 0:00:26
      556000 -- (-315.796) (-316.776) (-316.380) [-316.586] * (-316.392) (-315.813) [-318.627] (-315.851) -- 0:00:26
      556500 -- (-316.484) [-315.841] (-317.516) (-316.633) * (-320.373) (-315.944) [-317.563] (-319.007) -- 0:00:26
      557000 -- [-316.386] (-315.870) (-316.436) (-319.059) * (-318.502) [-317.725] (-316.906) (-316.721) -- 0:00:26
      557500 -- (-321.109) [-315.344] (-315.902) (-318.576) * (-317.358) [-315.665] (-315.310) (-315.232) -- 0:00:26
      558000 -- [-316.477] (-316.049) (-315.683) (-315.949) * [-316.938] (-315.904) (-316.348) (-316.476) -- 0:00:26
      558500 -- (-315.862) (-316.692) [-316.480] (-316.970) * (-318.075) (-317.118) (-317.749) [-315.656] -- 0:00:26
      559000 -- (-316.634) (-319.128) [-316.306] (-317.774) * (-316.515) (-318.774) (-320.048) [-316.309] -- 0:00:26
      559500 -- (-320.360) (-318.943) [-319.012] (-318.188) * (-315.807) (-316.379) (-317.000) [-319.006] -- 0:00:25
      560000 -- (-318.579) [-316.753] (-317.898) (-317.160) * (-316.894) [-320.011] (-319.119) (-316.544) -- 0:00:25

      Average standard deviation of split frequencies: 0.010825

      560500 -- (-317.768) (-315.617) [-316.507] (-317.521) * (-318.103) (-316.663) (-317.502) [-316.826] -- 0:00:25
      561000 -- (-317.768) [-315.835] (-318.421) (-320.553) * [-316.678] (-318.523) (-315.994) (-316.101) -- 0:00:25
      561500 -- (-318.565) [-316.460] (-316.030) (-317.690) * (-318.874) (-315.574) [-316.492] (-318.721) -- 0:00:25
      562000 -- [-318.053] (-318.177) (-316.058) (-316.363) * (-317.382) (-315.955) (-318.225) [-315.647] -- 0:00:25
      562500 -- [-316.598] (-318.295) (-315.238) (-317.592) * (-315.870) (-317.002) [-317.807] (-315.999) -- 0:00:25
      563000 -- (-316.181) [-318.196] (-316.274) (-317.359) * (-317.536) (-316.599) [-317.349] (-316.089) -- 0:00:25
      563500 -- (-317.711) (-321.099) [-315.490] (-320.070) * (-317.164) (-316.060) (-316.788) [-315.768] -- 0:00:25
      564000 -- [-316.143] (-321.900) (-315.754) (-319.375) * (-315.247) (-317.066) [-317.064] (-315.432) -- 0:00:25
      564500 -- (-317.322) (-319.865) (-321.108) [-315.771] * (-316.463) [-315.637] (-315.519) (-315.714) -- 0:00:25
      565000 -- [-317.501] (-320.524) (-317.168) (-316.457) * (-317.276) (-316.267) [-318.763] (-318.571) -- 0:00:25

      Average standard deviation of split frequencies: 0.010723

      565500 -- (-316.918) (-323.935) (-317.428) [-320.710] * (-318.529) (-317.652) [-320.364] (-315.498) -- 0:00:25
      566000 -- (-318.020) (-320.930) [-318.195] (-318.804) * (-315.056) (-319.108) (-316.268) [-317.870] -- 0:00:25
      566500 -- (-316.217) (-316.460) (-317.996) [-316.117] * (-315.134) (-317.050) [-318.524] (-317.019) -- 0:00:26
      567000 -- (-319.968) [-316.457] (-317.261) (-316.497) * (-315.230) (-316.529) [-319.929] (-318.103) -- 0:00:25
      567500 -- (-316.950) (-318.389) (-317.204) [-318.514] * (-320.260) [-316.527] (-320.039) (-316.322) -- 0:00:25
      568000 -- (-320.355) [-315.518] (-317.562) (-320.142) * (-317.322) [-316.958] (-315.937) (-315.365) -- 0:00:25
      568500 -- (-315.716) (-318.470) [-315.441] (-316.040) * (-318.764) (-316.265) (-317.064) [-316.041] -- 0:00:25
      569000 -- (-316.662) (-321.232) (-317.953) [-316.168] * (-319.731) (-317.051) [-316.595] (-317.534) -- 0:00:25
      569500 -- (-316.934) (-321.186) [-315.509] (-317.355) * (-315.926) [-319.304] (-317.914) (-316.535) -- 0:00:25
      570000 -- (-316.755) (-317.200) [-317.444] (-321.349) * (-317.606) (-320.009) (-319.706) [-316.093] -- 0:00:25

      Average standard deviation of split frequencies: 0.010997

      570500 -- [-320.328] (-318.159) (-315.499) (-321.015) * (-317.635) [-319.023] (-318.184) (-315.771) -- 0:00:25
      571000 -- (-315.876) (-316.384) (-316.009) [-317.634] * (-319.488) (-316.455) [-317.158] (-316.272) -- 0:00:25
      571500 -- [-316.234] (-317.765) (-315.526) (-317.388) * [-321.993] (-316.309) (-318.900) (-316.807) -- 0:00:25
      572000 -- (-320.991) (-315.695) [-316.288] (-316.729) * (-318.167) (-317.290) [-317.608] (-317.961) -- 0:00:25
      572500 -- (-317.735) (-318.937) (-316.194) [-318.947] * (-318.523) (-316.875) [-315.273] (-316.096) -- 0:00:25
      573000 -- (-315.893) (-319.115) (-318.641) [-316.388] * (-317.260) (-317.997) (-315.829) [-317.877] -- 0:00:25
      573500 -- (-317.371) (-320.902) (-318.803) [-318.073] * [-318.472] (-319.426) (-317.038) (-315.628) -- 0:00:25
      574000 -- (-316.490) (-317.685) (-323.025) [-315.942] * (-317.773) (-318.596) (-322.086) [-318.799] -- 0:00:25
      574500 -- (-318.353) [-317.309] (-316.429) (-316.875) * (-322.058) [-317.483] (-317.160) (-316.708) -- 0:00:25
      575000 -- (-319.602) [-318.054] (-321.840) (-319.358) * (-319.194) (-317.263) [-316.579] (-316.132) -- 0:00:25

      Average standard deviation of split frequencies: 0.010895

      575500 -- [-315.599] (-320.182) (-315.945) (-317.414) * (-320.711) (-318.591) (-316.046) [-317.834] -- 0:00:25
      576000 -- [-315.256] (-317.025) (-316.463) (-320.671) * (-318.177) (-315.882) [-316.209] (-315.811) -- 0:00:25
      576500 -- (-315.299) (-316.540) [-317.137] (-316.578) * (-317.124) (-317.313) (-315.950) [-316.184] -- 0:00:24
      577000 -- (-315.241) (-323.200) [-316.684] (-316.655) * [-316.194] (-319.122) (-315.784) (-315.851) -- 0:00:24
      577500 -- (-317.223) (-316.675) (-315.680) [-315.485] * (-319.581) [-316.872] (-319.686) (-317.984) -- 0:00:24
      578000 -- (-319.011) (-320.096) [-317.595] (-315.665) * (-316.081) (-316.528) [-317.124] (-319.052) -- 0:00:24
      578500 -- (-319.103) [-316.011] (-317.305) (-316.319) * (-317.496) (-315.948) (-316.513) [-316.284] -- 0:00:24
      579000 -- (-316.231) [-315.079] (-317.792) (-315.964) * (-315.772) (-317.814) (-319.593) [-317.111] -- 0:00:24
      579500 -- (-316.234) (-317.803) [-316.189] (-317.800) * [-316.253] (-318.826) (-316.274) (-317.824) -- 0:00:24
      580000 -- [-316.024] (-318.909) (-316.886) (-321.865) * [-319.347] (-318.268) (-316.428) (-318.587) -- 0:00:24

      Average standard deviation of split frequencies: 0.010757

      580500 -- (-315.591) (-317.922) [-316.477] (-318.883) * (-317.193) (-317.567) [-317.144] (-317.069) -- 0:00:24
      581000 -- [-316.791] (-318.976) (-318.299) (-318.974) * (-317.479) [-318.271] (-315.988) (-318.487) -- 0:00:24
      581500 -- [-315.995] (-319.274) (-319.611) (-319.622) * (-317.867) (-315.684) [-318.338] (-316.403) -- 0:00:24
      582000 -- (-318.889) (-317.978) [-314.991] (-316.480) * (-318.086) (-316.605) [-320.429] (-316.801) -- 0:00:24
      582500 -- (-315.633) (-317.833) [-317.676] (-323.056) * (-322.904) (-320.331) [-319.177] (-317.953) -- 0:00:24
      583000 -- [-315.201] (-318.090) (-316.791) (-319.102) * (-322.684) (-318.902) (-319.880) [-317.440] -- 0:00:25
      583500 -- (-316.707) [-316.716] (-316.886) (-319.069) * [-319.545] (-315.973) (-317.445) (-315.812) -- 0:00:24
      584000 -- (-315.568) [-315.714] (-317.508) (-322.804) * [-316.818] (-317.300) (-319.785) (-315.666) -- 0:00:24
      584500 -- (-316.467) (-319.797) (-317.302) [-319.081] * (-319.096) [-318.440] (-320.249) (-319.729) -- 0:00:24
      585000 -- (-316.887) (-317.569) [-319.476] (-319.316) * (-315.641) [-316.192] (-322.172) (-318.353) -- 0:00:24

      Average standard deviation of split frequencies: 0.011011

      585500 -- (-315.893) (-315.602) (-316.645) [-316.872] * (-316.309) [-316.488] (-319.245) (-318.904) -- 0:00:24
      586000 -- [-316.700] (-317.066) (-319.549) (-316.967) * (-316.731) [-317.111] (-319.160) (-316.140) -- 0:00:24
      586500 -- (-315.902) (-315.442) [-318.419] (-319.904) * (-318.513) [-317.286] (-321.603) (-317.447) -- 0:00:24
      587000 -- [-318.116] (-321.168) (-316.726) (-319.359) * (-318.217) [-315.353] (-316.791) (-315.185) -- 0:00:24
      587500 -- (-320.246) (-318.124) [-316.250] (-319.392) * (-317.407) (-317.200) [-322.269] (-315.115) -- 0:00:24
      588000 -- (-316.853) [-315.737] (-316.090) (-318.861) * (-316.629) (-315.637) (-317.178) [-316.432] -- 0:00:24
      588500 -- (-315.051) (-317.927) [-316.718] (-318.620) * (-314.955) [-317.875] (-315.240) (-321.406) -- 0:00:24
      589000 -- (-317.814) [-318.331] (-317.494) (-318.776) * (-318.270) (-317.827) [-317.874] (-317.116) -- 0:00:24
      589500 -- [-318.618] (-315.635) (-316.612) (-316.830) * (-315.557) [-317.337] (-320.932) (-315.296) -- 0:00:24
      590000 -- (-315.560) (-319.590) [-315.162] (-316.536) * (-316.713) (-315.060) [-318.575] (-315.784) -- 0:00:24

      Average standard deviation of split frequencies: 0.010724

      590500 -- (-316.051) (-317.786) (-317.684) [-316.108] * (-316.175) (-315.069) [-319.005] (-321.002) -- 0:00:24
      591000 -- (-317.084) (-315.268) [-317.580] (-319.579) * (-316.901) (-317.795) [-323.148] (-317.601) -- 0:00:24
      591500 -- (-316.656) (-317.323) [-316.226] (-318.495) * (-317.932) [-317.580] (-320.520) (-320.985) -- 0:00:24
      592000 -- (-318.414) [-315.781] (-318.599) (-316.046) * (-321.284) [-317.618] (-315.993) (-318.315) -- 0:00:24
      592500 -- (-322.094) (-316.806) [-319.925] (-315.955) * (-319.644) [-315.506] (-316.244) (-315.699) -- 0:00:24
      593000 -- (-321.460) [-317.772] (-318.170) (-316.430) * (-316.007) (-315.432) [-315.550] (-318.187) -- 0:00:24
      593500 -- (-317.804) [-316.624] (-318.670) (-317.262) * (-317.213) [-315.450] (-315.126) (-317.911) -- 0:00:23
      594000 -- (-317.940) (-317.693) [-316.193] (-319.650) * (-316.492) (-316.818) (-316.519) [-315.956] -- 0:00:23
      594500 -- (-315.775) (-319.328) (-316.346) [-318.778] * (-317.574) [-318.083] (-317.237) (-318.542) -- 0:00:23
      595000 -- [-316.825] (-316.550) (-316.102) (-324.231) * [-320.417] (-317.616) (-316.095) (-316.448) -- 0:00:23

      Average standard deviation of split frequencies: 0.011024

      595500 -- (-317.284) [-316.505] (-316.206) (-319.449) * [-318.776] (-317.555) (-318.472) (-317.036) -- 0:00:23
      596000 -- (-317.009) (-317.882) [-317.353] (-317.368) * (-316.896) [-318.675] (-317.446) (-316.083) -- 0:00:23
      596500 -- (-316.160) (-315.784) [-316.512] (-317.681) * [-316.449] (-319.133) (-317.956) (-316.955) -- 0:00:23
      597000 -- (-316.789) (-315.103) [-316.408] (-315.238) * [-315.954] (-316.443) (-318.138) (-315.864) -- 0:00:23
      597500 -- (-322.510) (-315.967) [-317.105] (-316.036) * (-317.532) [-318.908] (-316.200) (-317.346) -- 0:00:23
      598000 -- (-317.900) [-319.130] (-317.625) (-317.671) * [-316.201] (-317.762) (-317.505) (-316.978) -- 0:00:23
      598500 -- (-317.278) (-317.810) (-321.580) [-316.193] * (-320.036) (-319.873) [-315.448] (-317.957) -- 0:00:23
      599000 -- (-320.647) (-316.478) [-316.381] (-317.819) * (-324.087) (-320.520) [-320.056] (-316.057) -- 0:00:23
      599500 -- (-318.127) (-318.868) [-316.948] (-316.622) * [-322.008] (-318.643) (-316.263) (-316.105) -- 0:00:23
      600000 -- [-319.686] (-318.514) (-317.114) (-316.587) * [-319.646] (-316.028) (-321.754) (-318.061) -- 0:00:23

      Average standard deviation of split frequencies: 0.010791

      600500 -- [-318.024] (-321.269) (-318.347) (-317.546) * [-315.417] (-319.166) (-317.258) (-318.477) -- 0:00:23
      601000 -- [-316.096] (-321.389) (-319.306) (-316.286) * (-318.155) [-318.850] (-318.988) (-316.550) -- 0:00:23
      601500 -- (-318.849) [-318.012] (-316.640) (-316.093) * (-320.138) [-316.544] (-319.072) (-317.890) -- 0:00:23
      602000 -- (-315.363) (-315.376) (-316.295) [-318.170] * (-319.181) [-316.186] (-318.403) (-317.185) -- 0:00:23
      602500 -- (-316.849) [-315.886] (-317.612) (-317.458) * (-316.042) (-316.085) [-317.243] (-318.199) -- 0:00:23
      603000 -- [-317.054] (-316.256) (-315.415) (-317.228) * (-316.862) (-318.378) [-318.735] (-319.036) -- 0:00:23
      603500 -- (-316.816) (-315.791) (-316.282) [-316.113] * (-318.083) [-319.403] (-317.920) (-322.607) -- 0:00:23
      604000 -- (-318.059) (-315.955) (-317.521) [-315.074] * [-315.753] (-317.022) (-318.165) (-317.620) -- 0:00:23
      604500 -- [-315.580] (-320.487) (-318.189) (-316.369) * (-317.736) (-318.136) (-316.822) [-316.393] -- 0:00:23
      605000 -- (-317.328) (-317.670) [-316.330] (-316.667) * [-316.114] (-317.462) (-315.393) (-319.710) -- 0:00:23

      Average standard deviation of split frequencies: 0.011523

      605500 -- (-316.329) [-316.638] (-317.380) (-316.307) * (-316.129) (-319.579) [-317.198] (-316.175) -- 0:00:23
      606000 -- (-315.767) [-315.488] (-315.646) (-320.254) * (-316.944) [-315.606] (-320.547) (-318.289) -- 0:00:23
      606500 -- (-317.333) (-315.464) [-315.262] (-316.220) * (-319.306) [-318.371] (-316.379) (-316.656) -- 0:00:23
      607000 -- (-316.697) [-314.943] (-317.146) (-318.443) * (-316.830) (-317.718) [-316.851] (-315.741) -- 0:00:23
      607500 -- [-318.794] (-316.176) (-317.955) (-317.000) * (-320.988) (-320.158) (-318.795) [-315.282] -- 0:00:23
      608000 -- (-323.466) [-315.981] (-315.326) (-316.559) * [-317.729] (-323.442) (-319.854) (-316.982) -- 0:00:23
      608500 -- (-316.285) (-315.871) [-315.665] (-317.432) * (-318.304) (-316.434) (-317.540) [-316.791] -- 0:00:23
      609000 -- [-315.967] (-316.383) (-315.560) (-320.256) * (-318.056) [-317.339] (-317.468) (-317.997) -- 0:00:23
      609500 -- (-316.388) [-315.503] (-316.630) (-320.616) * (-316.643) [-321.121] (-320.496) (-316.803) -- 0:00:23
      610000 -- (-316.334) (-316.967) (-317.379) [-318.567] * [-316.866] (-316.547) (-316.853) (-316.151) -- 0:00:23

      Average standard deviation of split frequencies: 0.010856

      610500 -- (-316.768) (-320.362) (-316.100) [-318.905] * (-315.924) [-317.733] (-319.875) (-315.309) -- 0:00:22
      611000 -- [-318.172] (-318.066) (-317.296) (-316.898) * (-315.842) [-315.845] (-316.316) (-316.873) -- 0:00:22
      611500 -- (-319.200) [-316.754] (-315.394) (-316.782) * (-315.818) [-318.022] (-316.793) (-320.837) -- 0:00:22
      612000 -- (-316.684) [-319.586] (-317.901) (-316.898) * [-318.884] (-318.208) (-317.161) (-316.204) -- 0:00:22
      612500 -- (-320.617) (-315.760) [-317.907] (-318.641) * (-318.148) (-316.888) (-317.519) [-315.619] -- 0:00:22
      613000 -- (-325.654) (-322.466) (-317.807) [-317.106] * (-323.242) [-319.992] (-317.416) (-318.017) -- 0:00:22
      613500 -- (-319.590) (-318.249) [-316.517] (-316.944) * (-316.587) (-319.444) [-316.144] (-317.336) -- 0:00:22
      614000 -- (-318.460) (-317.669) [-316.068] (-315.724) * (-316.547) [-315.901] (-316.166) (-315.347) -- 0:00:22
      614500 -- (-316.579) (-318.830) [-316.425] (-316.612) * (-316.589) (-320.469) [-316.746] (-317.010) -- 0:00:22
      615000 -- (-318.107) (-316.482) [-316.678] (-316.994) * (-317.101) (-316.586) [-317.643] (-318.198) -- 0:00:22

      Average standard deviation of split frequencies: 0.011049

      615500 -- (-317.945) (-320.260) (-315.569) [-316.278] * [-317.901] (-317.690) (-319.976) (-317.146) -- 0:00:22
      616000 -- (-320.226) (-317.786) [-316.022] (-316.369) * (-317.822) [-317.471] (-319.053) (-317.666) -- 0:00:22
      616500 -- (-320.784) [-316.279] (-317.147) (-315.781) * (-316.584) (-317.918) (-316.086) [-317.185] -- 0:00:22
      617000 -- (-318.486) (-317.916) (-319.562) [-316.236] * (-315.057) (-317.083) [-316.751] (-320.985) -- 0:00:22
      617500 -- [-318.062] (-316.542) (-317.346) (-315.292) * (-319.576) [-316.266] (-317.383) (-315.255) -- 0:00:22
      618000 -- (-315.816) [-317.084] (-318.904) (-319.867) * (-317.165) (-316.080) [-322.630] (-315.915) -- 0:00:22
      618500 -- (-317.776) [-317.549] (-316.680) (-315.709) * (-316.944) [-320.368] (-318.309) (-315.157) -- 0:00:22
      619000 -- (-316.174) (-321.260) (-317.984) [-316.087] * (-318.406) [-320.811] (-318.133) (-315.335) -- 0:00:22
      619500 -- (-316.698) (-319.166) [-316.240] (-317.235) * (-317.907) (-318.451) (-317.444) [-316.261] -- 0:00:22
      620000 -- (-320.233) [-315.942] (-320.263) (-320.871) * (-316.483) (-317.727) [-317.426] (-315.992) -- 0:00:22

      Average standard deviation of split frequencies: 0.011298

      620500 -- (-318.113) (-315.781) [-316.224] (-317.774) * (-316.034) (-316.518) [-318.631] (-315.409) -- 0:00:22
      621000 -- (-315.914) [-318.705] (-316.348) (-315.659) * (-316.867) (-316.466) (-317.953) [-316.083] -- 0:00:22
      621500 -- (-316.788) (-318.218) [-319.698] (-316.615) * [-315.816] (-319.071) (-316.729) (-316.398) -- 0:00:22
      622000 -- (-316.137) [-319.631] (-316.294) (-319.155) * [-315.056] (-319.731) (-318.456) (-316.033) -- 0:00:22
      622500 -- [-316.478] (-316.770) (-315.228) (-317.631) * [-317.625] (-315.482) (-320.690) (-316.703) -- 0:00:22
      623000 -- (-316.154) [-317.448] (-320.967) (-317.263) * (-318.265) (-315.969) [-316.986] (-316.731) -- 0:00:22
      623500 -- (-318.426) (-317.122) (-315.419) [-318.362] * [-318.074] (-317.218) (-316.097) (-317.870) -- 0:00:22
      624000 -- (-320.678) (-316.475) [-315.055] (-316.611) * [-319.564] (-317.862) (-316.275) (-316.138) -- 0:00:22
      624500 -- (-318.576) [-317.769] (-317.182) (-316.538) * (-314.967) [-317.807] (-316.137) (-315.419) -- 0:00:22
      625000 -- (-316.024) (-318.245) [-316.570] (-318.055) * [-318.538] (-318.378) (-316.196) (-317.099) -- 0:00:22

      Average standard deviation of split frequencies: 0.011437

      625500 -- (-317.751) [-317.143] (-319.802) (-317.316) * (-316.951) [-319.601] (-315.877) (-317.189) -- 0:00:22
      626000 -- (-320.107) [-319.129] (-318.447) (-317.286) * (-316.816) (-320.677) [-316.704] (-318.364) -- 0:00:22
      626500 -- (-318.824) [-316.583] (-316.634) (-317.897) * (-320.045) (-320.478) (-317.554) [-318.719] -- 0:00:22
      627000 -- (-315.809) (-319.433) (-316.046) [-316.486] * (-317.658) (-317.378) (-317.286) [-315.824] -- 0:00:22
      627500 -- (-321.453) [-316.578] (-319.417) (-320.081) * [-315.438] (-316.630) (-315.999) (-317.096) -- 0:00:21
      628000 -- [-318.017] (-316.805) (-320.329) (-316.673) * (-322.092) [-317.017] (-318.307) (-316.801) -- 0:00:21
      628500 -- (-319.132) (-317.074) [-317.704] (-315.963) * (-317.118) (-318.698) [-316.331] (-318.744) -- 0:00:21
      629000 -- (-320.481) (-317.897) [-316.266] (-318.186) * (-317.891) (-317.497) (-315.907) [-317.893] -- 0:00:21
      629500 -- (-319.593) [-316.452] (-316.833) (-318.417) * [-315.919] (-319.032) (-316.865) (-316.314) -- 0:00:21
      630000 -- (-318.315) [-315.778] (-316.642) (-316.359) * [-316.052] (-317.215) (-315.992) (-316.703) -- 0:00:21

      Average standard deviation of split frequencies: 0.011025

      630500 -- (-318.782) [-319.873] (-318.920) (-316.919) * (-315.913) [-319.516] (-320.290) (-315.426) -- 0:00:21
      631000 -- (-316.635) (-319.999) (-315.288) [-318.036] * (-316.727) [-318.715] (-320.468) (-317.141) -- 0:00:21
      631500 -- (-317.504) (-317.406) (-316.346) [-317.828] * (-318.614) (-317.245) (-318.098) [-316.621] -- 0:00:21
      632000 -- [-317.840] (-323.829) (-317.132) (-321.948) * [-317.203] (-317.492) (-316.643) (-315.390) -- 0:00:21
      632500 -- (-318.642) [-320.682] (-318.541) (-318.474) * (-316.215) (-320.592) [-316.040] (-318.409) -- 0:00:21
      633000 -- (-318.918) (-320.911) [-318.070] (-316.255) * (-315.358) [-317.122] (-316.317) (-315.762) -- 0:00:21
      633500 -- (-316.561) (-316.358) (-318.511) [-317.912] * [-315.916] (-315.042) (-315.278) (-318.133) -- 0:00:21
      634000 -- (-315.286) [-316.555] (-315.723) (-318.523) * (-316.089) (-317.214) [-319.389] (-323.859) -- 0:00:21
      634500 -- (-321.184) (-319.043) (-316.885) [-317.521] * [-316.750] (-315.438) (-318.036) (-316.824) -- 0:00:21
      635000 -- [-320.362] (-322.135) (-321.162) (-316.646) * (-318.714) (-314.919) (-316.802) [-317.624] -- 0:00:21

      Average standard deviation of split frequencies: 0.011072

      635500 -- [-316.260] (-317.508) (-318.119) (-317.055) * (-320.008) [-316.967] (-317.256) (-318.341) -- 0:00:21
      636000 -- (-318.575) (-316.326) (-315.568) [-317.023] * (-317.925) (-316.966) [-316.835] (-316.324) -- 0:00:21
      636500 -- (-315.700) (-316.947) (-317.555) [-315.660] * (-316.781) (-316.342) (-317.109) [-316.910] -- 0:00:21
      637000 -- (-316.989) (-317.766) [-318.222] (-318.989) * (-318.526) [-315.801] (-316.358) (-319.624) -- 0:00:21
      637500 -- [-319.230] (-315.348) (-323.538) (-316.512) * (-316.236) [-315.425] (-316.148) (-319.646) -- 0:00:21
      638000 -- (-316.172) [-314.935] (-318.556) (-316.841) * (-317.679) [-315.589] (-317.971) (-317.461) -- 0:00:21
      638500 -- (-317.455) (-315.061) [-316.771] (-318.042) * (-319.676) (-317.920) (-316.595) [-317.898] -- 0:00:21
      639000 -- [-316.374] (-317.008) (-318.333) (-316.995) * (-317.432) (-318.937) (-319.923) [-316.234] -- 0:00:21
      639500 -- (-317.653) (-315.575) (-320.363) [-317.309] * [-315.692] (-316.258) (-317.462) (-318.132) -- 0:00:21
      640000 -- (-317.952) [-319.388] (-320.367) (-318.125) * (-317.807) (-319.313) (-315.018) [-315.504] -- 0:00:21

      Average standard deviation of split frequencies: 0.011589

      640500 -- (-317.614) [-318.687] (-318.905) (-321.231) * (-317.138) (-317.611) (-318.566) [-315.744] -- 0:00:21
      641000 -- (-320.352) [-317.341] (-315.951) (-321.961) * (-315.654) (-318.171) [-316.840] (-318.259) -- 0:00:21
      641500 -- [-317.777] (-323.772) (-316.944) (-315.876) * (-317.790) (-316.779) (-319.284) [-315.316] -- 0:00:21
      642000 -- (-316.808) (-319.083) (-321.111) [-318.169] * (-320.548) (-315.130) (-316.033) [-320.185] -- 0:00:21
      642500 -- (-317.887) (-318.436) (-318.120) [-317.456] * (-322.638) (-317.894) [-318.319] (-321.225) -- 0:00:21
      643000 -- (-316.328) (-316.951) [-319.486] (-317.231) * (-321.190) (-316.127) (-317.598) [-321.052] -- 0:00:21
      643500 -- (-317.967) (-315.968) [-317.950] (-319.249) * (-318.495) [-316.294] (-316.447) (-316.249) -- 0:00:21
      644000 -- (-316.188) [-316.013] (-325.074) (-319.836) * [-316.424] (-316.666) (-318.118) (-316.536) -- 0:00:21
      644500 -- (-317.171) (-320.257) (-317.764) [-317.403] * (-319.802) (-316.663) (-317.625) [-315.333] -- 0:00:20
      645000 -- (-316.686) (-323.832) [-318.936] (-318.770) * (-317.238) (-317.760) (-320.223) [-318.266] -- 0:00:20

      Average standard deviation of split frequencies: 0.011402

      645500 -- (-318.973) (-319.066) (-318.527) [-316.582] * (-316.237) (-317.347) [-316.765] (-315.695) -- 0:00:20
      646000 -- (-321.321) [-317.372] (-317.136) (-318.485) * [-316.461] (-317.299) (-319.357) (-316.909) -- 0:00:20
      646500 -- (-318.065) [-316.010] (-319.000) (-316.884) * [-315.744] (-318.333) (-315.288) (-316.918) -- 0:00:20
      647000 -- (-319.019) (-319.432) (-316.171) [-317.550] * [-315.534] (-317.934) (-320.282) (-316.971) -- 0:00:20
      647500 -- [-319.168] (-315.618) (-317.475) (-317.174) * (-315.545) (-319.564) (-317.859) [-315.313] -- 0:00:20
      648000 -- (-320.903) (-317.015) [-319.086] (-316.701) * (-319.353) [-316.832] (-322.477) (-317.165) -- 0:00:20
      648500 -- (-315.015) (-316.276) (-317.760) [-318.351] * (-315.806) (-316.613) (-320.222) [-316.215] -- 0:00:20
      649000 -- [-318.577] (-319.634) (-324.654) (-315.580) * [-316.378] (-318.397) (-315.789) (-316.716) -- 0:00:20
      649500 -- (-315.680) [-317.736] (-320.710) (-315.462) * (-320.806) (-317.744) (-315.472) [-317.082] -- 0:00:20
      650000 -- [-315.404] (-319.240) (-319.121) (-316.230) * (-318.993) (-317.013) (-316.227) [-316.986] -- 0:00:20

      Average standard deviation of split frequencies: 0.011049

      650500 -- (-316.524) (-318.506) (-318.877) [-317.200] * (-317.659) [-316.486] (-320.959) (-320.539) -- 0:00:20
      651000 -- [-322.125] (-317.863) (-320.020) (-317.299) * (-319.216) [-317.393] (-318.917) (-316.449) -- 0:00:20
      651500 -- (-317.563) [-316.173] (-318.289) (-317.443) * (-317.877) [-317.667] (-318.657) (-318.566) -- 0:00:20
      652000 -- [-318.111] (-316.318) (-317.859) (-319.172) * (-319.394) [-319.825] (-322.575) (-318.252) -- 0:00:20
      652500 -- [-318.089] (-317.141) (-319.865) (-317.075) * (-320.266) (-317.940) [-321.529] (-315.758) -- 0:00:20
      653000 -- (-316.602) (-315.664) [-317.743] (-320.119) * (-319.151) (-317.061) [-315.909] (-316.482) -- 0:00:20
      653500 -- (-320.089) (-316.048) (-315.456) [-318.441] * (-318.250) (-320.002) [-318.631] (-315.650) -- 0:00:20
      654000 -- [-317.636] (-316.744) (-315.282) (-315.246) * (-317.934) (-318.627) [-318.349] (-317.666) -- 0:00:20
      654500 -- (-317.820) (-318.779) (-318.537) [-319.810] * (-318.367) (-316.751) (-320.600) [-316.941] -- 0:00:20
      655000 -- (-316.886) [-320.853] (-315.909) (-322.328) * (-316.819) (-317.104) (-315.975) [-316.330] -- 0:00:20

      Average standard deviation of split frequencies: 0.010510

      655500 -- [-316.023] (-318.810) (-315.948) (-323.698) * [-316.597] (-319.294) (-315.869) (-316.422) -- 0:00:20
      656000 -- [-315.794] (-318.585) (-319.702) (-322.581) * [-316.755] (-317.186) (-318.276) (-317.458) -- 0:00:20
      656500 -- (-320.665) [-317.022] (-317.886) (-320.194) * (-315.353) (-319.448) (-317.576) [-316.244] -- 0:00:20
      657000 -- (-317.590) (-317.159) [-319.370] (-317.404) * [-316.572] (-317.725) (-315.744) (-317.643) -- 0:00:20
      657500 -- (-318.420) (-316.471) (-319.757) [-316.854] * [-316.565] (-321.702) (-315.532) (-317.136) -- 0:00:20
      658000 -- (-317.651) (-316.974) (-319.958) [-319.886] * (-318.727) [-317.725] (-315.666) (-318.424) -- 0:00:20
      658500 -- [-320.277] (-322.640) (-318.971) (-316.777) * (-315.364) (-316.987) [-317.313] (-316.596) -- 0:00:20
      659000 -- (-315.853) (-320.039) (-318.152) [-316.975] * [-315.458] (-316.739) (-320.164) (-320.774) -- 0:00:20
      659500 -- [-315.523] (-320.658) (-318.721) (-319.291) * [-322.967] (-316.501) (-318.746) (-318.735) -- 0:00:20
      660000 -- (-316.845) [-322.732] (-316.642) (-317.988) * [-319.009] (-321.472) (-315.989) (-316.400) -- 0:00:20

      Average standard deviation of split frequencies: 0.010703

      660500 -- [-315.790] (-315.939) (-315.937) (-315.831) * (-318.977) (-316.036) [-317.484] (-316.768) -- 0:00:20
      661000 -- (-320.289) [-318.160] (-317.026) (-316.814) * (-317.196) (-319.428) [-317.280] (-316.394) -- 0:00:20
      661500 -- (-315.436) (-316.335) (-318.238) [-316.417] * (-317.723) (-315.425) (-315.586) [-316.258] -- 0:00:19
      662000 -- [-315.391] (-319.662) (-317.855) (-322.767) * (-319.144) (-316.804) (-317.690) [-317.464] -- 0:00:19
      662500 -- (-315.818) (-317.549) [-315.891] (-317.783) * (-318.846) (-316.819) [-317.396] (-315.914) -- 0:00:19
      663000 -- [-316.940] (-317.561) (-320.096) (-316.558) * [-317.876] (-319.802) (-320.312) (-319.245) -- 0:00:19
      663500 -- (-315.334) [-318.980] (-321.227) (-318.828) * (-319.361) [-316.945] (-319.663) (-316.689) -- 0:00:19
      664000 -- (-318.483) (-316.932) [-317.592] (-323.469) * [-315.678] (-316.579) (-315.896) (-315.362) -- 0:00:19
      664500 -- (-316.698) (-324.126) (-321.826) [-326.727] * [-316.358] (-317.028) (-319.504) (-315.471) -- 0:00:19
      665000 -- [-318.103] (-315.632) (-324.734) (-318.652) * [-317.413] (-317.455) (-315.568) (-315.400) -- 0:00:19

      Average standard deviation of split frequencies: 0.010883

      665500 -- (-317.599) (-318.196) (-320.758) [-318.662] * [-318.120] (-318.456) (-317.193) (-315.659) -- 0:00:19
      666000 -- (-322.820) (-320.131) [-316.719] (-318.674) * (-318.831) (-319.762) (-317.924) [-315.953] -- 0:00:19
      666500 -- (-316.458) [-315.269] (-317.794) (-320.190) * (-319.777) (-316.497) (-316.243) [-319.291] -- 0:00:19
      667000 -- (-322.625) (-316.509) (-318.738) [-318.656] * [-315.784] (-320.079) (-320.645) (-317.332) -- 0:00:19
      667500 -- (-319.450) (-316.271) [-316.239] (-320.626) * (-315.696) (-316.582) [-317.421] (-317.136) -- 0:00:19
      668000 -- (-318.174) [-319.713] (-316.938) (-316.978) * (-317.143) [-316.092] (-317.397) (-317.905) -- 0:00:19
      668500 -- (-316.885) [-318.080] (-315.488) (-318.231) * (-318.106) [-316.837] (-317.162) (-317.932) -- 0:00:19
      669000 -- (-318.243) (-320.329) [-316.487] (-317.493) * (-318.425) (-322.474) (-319.533) [-317.119] -- 0:00:19
      669500 -- (-317.418) (-316.985) [-316.216] (-317.601) * (-321.460) [-316.747] (-316.007) (-318.445) -- 0:00:19
      670000 -- (-319.843) (-317.798) [-319.489] (-318.860) * [-318.321] (-317.675) (-315.548) (-317.419) -- 0:00:19

      Average standard deviation of split frequencies: 0.010368

      670500 -- (-316.167) (-317.700) [-316.048] (-315.993) * (-316.601) (-316.977) [-315.366] (-327.038) -- 0:00:19
      671000 -- (-315.675) [-318.111] (-318.008) (-315.678) * (-316.583) [-318.270] (-317.918) (-323.931) -- 0:00:19
      671500 -- (-317.051) [-317.673] (-318.803) (-317.662) * (-317.577) (-318.057) (-315.367) [-316.781] -- 0:00:19
      672000 -- (-318.110) [-315.132] (-319.572) (-319.181) * [-318.162] (-315.720) (-317.779) (-320.483) -- 0:00:19
      672500 -- [-316.946] (-317.589) (-318.254) (-318.719) * (-315.915) [-317.419] (-320.661) (-319.360) -- 0:00:19
      673000 -- (-319.241) [-319.958] (-317.638) (-321.652) * [-316.817] (-318.085) (-318.286) (-315.384) -- 0:00:19
      673500 -- (-321.566) (-323.579) (-318.477) [-316.178] * (-318.397) [-317.029] (-319.131) (-315.923) -- 0:00:19
      674000 -- (-319.513) (-318.564) (-316.732) [-317.496] * [-316.269] (-320.564) (-316.977) (-315.758) -- 0:00:19
      674500 -- (-321.396) (-319.852) (-317.327) [-317.481] * (-320.158) (-315.937) (-317.767) [-317.058] -- 0:00:19
      675000 -- (-320.157) (-321.985) (-316.536) [-317.048] * (-318.849) (-315.326) (-320.553) [-317.010] -- 0:00:19

      Average standard deviation of split frequencies: 0.010329

      675500 -- (-320.212) (-317.179) (-316.014) [-317.346] * [-316.870] (-316.567) (-316.283) (-316.888) -- 0:00:19
      676000 -- (-318.702) (-317.501) (-317.208) [-318.801] * [-318.334] (-320.615) (-321.197) (-316.142) -- 0:00:19
      676500 -- (-316.617) (-316.145) [-318.348] (-316.078) * [-315.468] (-317.587) (-319.220) (-316.718) -- 0:00:19
      677000 -- (-317.113) (-322.600) [-315.142] (-324.256) * [-318.154] (-316.854) (-321.713) (-319.517) -- 0:00:19
      677500 -- (-315.555) (-315.865) (-316.135) [-315.915] * (-317.908) [-315.912] (-317.408) (-316.921) -- 0:00:19
      678000 -- [-318.976] (-316.790) (-317.480) (-315.466) * (-317.225) (-315.531) (-316.218) [-319.909] -- 0:00:18
      678500 -- [-317.587] (-318.205) (-315.888) (-317.049) * [-316.700] (-315.672) (-320.589) (-316.832) -- 0:00:18
      679000 -- [-317.961] (-317.908) (-319.841) (-316.373) * (-315.352) (-316.454) (-322.080) [-316.573] -- 0:00:18
      679500 -- (-321.853) (-316.484) (-317.263) [-315.362] * (-316.724) [-317.045] (-325.083) (-317.958) -- 0:00:18
      680000 -- (-323.535) (-317.381) (-318.810) [-316.138] * (-318.979) [-316.435] (-316.894) (-318.327) -- 0:00:18

      Average standard deviation of split frequencies: 0.010475

      680500 -- (-318.968) (-316.087) [-316.948] (-319.191) * [-317.303] (-318.306) (-318.364) (-315.301) -- 0:00:18
      681000 -- (-323.166) [-317.503] (-319.032) (-316.985) * [-321.519] (-316.843) (-319.324) (-315.611) -- 0:00:18
      681500 -- (-326.432) (-317.150) (-317.853) [-316.513] * [-316.461] (-316.331) (-317.091) (-317.693) -- 0:00:18
      682000 -- (-317.431) (-318.269) (-317.989) [-319.346] * [-318.106] (-319.053) (-318.264) (-317.975) -- 0:00:18
      682500 -- (-316.252) (-317.448) (-315.551) [-320.585] * (-318.480) (-315.955) [-317.287] (-316.743) -- 0:00:18
      683000 -- (-318.263) [-317.855] (-315.814) (-320.079) * (-316.219) [-316.670] (-317.583) (-317.370) -- 0:00:18
      683500 -- (-316.796) (-315.922) [-321.394] (-319.340) * [-317.011] (-316.953) (-316.743) (-317.897) -- 0:00:18
      684000 -- [-316.231] (-320.711) (-315.886) (-316.031) * [-317.588] (-316.428) (-315.978) (-317.060) -- 0:00:18
      684500 -- (-318.485) (-320.267) (-317.626) [-320.801] * (-321.346) (-320.051) [-316.699] (-318.347) -- 0:00:18
      685000 -- (-317.092) (-320.022) [-317.043] (-317.646) * (-319.414) (-323.182) [-315.196] (-317.580) -- 0:00:18

      Average standard deviation of split frequencies: 0.010093

      685500 -- (-317.114) (-317.568) (-319.366) [-318.655] * [-319.483] (-318.659) (-317.572) (-317.750) -- 0:00:18
      686000 -- [-317.985] (-317.431) (-316.846) (-317.380) * (-315.796) [-320.805] (-315.991) (-319.801) -- 0:00:18
      686500 -- (-316.467) [-319.526] (-318.834) (-317.104) * (-320.682) [-318.579] (-316.652) (-318.287) -- 0:00:18
      687000 -- (-317.243) (-320.648) [-315.744] (-315.552) * (-316.561) (-318.140) (-315.853) [-316.199] -- 0:00:18
      687500 -- (-315.196) (-318.942) (-317.216) [-318.177] * (-316.259) (-316.224) [-317.126] (-315.384) -- 0:00:18
      688000 -- [-317.242] (-319.940) (-316.779) (-318.446) * (-316.650) [-316.251] (-317.818) (-316.557) -- 0:00:18
      688500 -- (-316.626) [-316.571] (-317.045) (-317.944) * (-315.339) (-321.579) (-317.287) [-315.882] -- 0:00:18
      689000 -- (-315.733) [-319.244] (-315.215) (-316.663) * (-317.640) (-320.314) [-317.467] (-317.570) -- 0:00:18
      689500 -- (-320.705) [-316.112] (-317.407) (-315.721) * [-318.439] (-318.602) (-316.965) (-316.780) -- 0:00:18
      690000 -- [-316.709] (-320.836) (-315.655) (-316.996) * (-319.904) (-323.216) (-320.018) [-320.128] -- 0:00:18

      Average standard deviation of split frequencies: 0.010025

      690500 -- (-315.209) (-318.659) [-316.973] (-316.776) * (-319.388) (-322.296) (-318.620) [-328.684] -- 0:00:18
      691000 -- (-316.051) [-315.929] (-323.172) (-317.215) * (-318.426) (-316.234) [-318.935] (-326.720) -- 0:00:18
      691500 -- (-316.485) (-316.907) (-317.002) [-321.314] * (-319.068) [-315.552] (-319.713) (-317.041) -- 0:00:18
      692000 -- (-315.950) (-316.542) (-318.799) [-317.151] * (-317.191) (-317.399) (-315.305) [-319.770] -- 0:00:18
      692500 -- (-317.816) (-316.045) (-318.886) [-316.241] * (-318.726) [-316.851] (-315.688) (-318.563) -- 0:00:18
      693000 -- [-317.937] (-320.576) (-316.741) (-319.436) * (-317.231) (-318.427) [-315.733] (-316.049) -- 0:00:18
      693500 -- (-323.157) (-315.880) (-317.881) [-318.433] * (-315.666) [-315.044] (-316.429) (-317.344) -- 0:00:18
      694000 -- (-315.960) (-317.582) (-317.298) [-315.621] * [-315.328] (-318.612) (-317.452) (-317.652) -- 0:00:18
      694500 -- (-319.517) (-321.745) [-315.879] (-318.156) * (-315.538) (-317.453) [-317.109] (-316.595) -- 0:00:18
      695000 -- (-317.794) [-316.456] (-315.780) (-318.553) * [-315.997] (-317.241) (-317.740) (-319.609) -- 0:00:17

      Average standard deviation of split frequencies: 0.010117

      695500 -- (-316.211) [-317.428] (-317.445) (-316.965) * [-317.807] (-320.967) (-320.564) (-320.524) -- 0:00:17
      696000 -- (-315.458) [-316.977] (-317.022) (-317.013) * [-319.399] (-319.665) (-317.794) (-315.427) -- 0:00:17
      696500 -- [-319.174] (-324.077) (-318.776) (-316.971) * (-316.844) (-319.027) [-317.203] (-316.238) -- 0:00:17
      697000 -- (-316.612) [-316.275] (-318.138) (-317.467) * (-315.746) (-318.395) [-316.480] (-321.169) -- 0:00:17
      697500 -- (-319.556) (-318.282) [-318.224] (-317.010) * (-317.461) [-318.621] (-316.545) (-320.419) -- 0:00:17
      698000 -- (-317.740) (-316.715) [-315.320] (-316.531) * (-318.086) (-319.528) [-316.307] (-320.184) -- 0:00:17
      698500 -- [-318.854] (-319.071) (-316.156) (-318.719) * [-320.149] (-319.640) (-320.469) (-316.927) -- 0:00:17
      699000 -- (-317.260) (-317.779) [-316.655] (-315.435) * (-316.168) [-320.514] (-315.164) (-317.159) -- 0:00:17
      699500 -- (-320.375) (-316.815) [-320.739] (-319.366) * (-315.687) [-318.510] (-315.130) (-315.630) -- 0:00:17
      700000 -- (-316.854) (-321.343) [-318.903] (-318.265) * (-316.761) (-317.377) [-318.589] (-315.635) -- 0:00:17

      Average standard deviation of split frequencies: 0.009798

      700500 -- (-318.225) [-316.557] (-315.893) (-317.256) * [-316.095] (-316.595) (-318.446) (-318.850) -- 0:00:17
      701000 -- (-319.517) [-317.021] (-315.656) (-316.758) * (-317.236) (-319.502) [-316.693] (-317.325) -- 0:00:17
      701500 -- (-316.272) (-315.582) [-316.004] (-316.441) * (-315.415) [-316.919] (-320.021) (-315.558) -- 0:00:17
      702000 -- (-316.090) (-315.505) [-318.756] (-315.430) * [-317.799] (-316.680) (-316.557) (-319.374) -- 0:00:17
      702500 -- (-319.756) [-315.351] (-317.899) (-317.455) * (-316.494) [-319.113] (-317.496) (-316.656) -- 0:00:17
      703000 -- (-317.103) (-316.292) (-323.007) [-316.553] * [-316.114] (-318.635) (-319.628) (-320.254) -- 0:00:17
      703500 -- (-318.015) (-318.796) (-323.009) [-315.691] * (-317.145) [-316.767] (-320.731) (-316.564) -- 0:00:17
      704000 -- (-317.625) [-320.436] (-318.529) (-316.835) * (-317.330) [-316.500] (-317.049) (-316.715) -- 0:00:17
      704500 -- [-316.611] (-315.759) (-316.891) (-316.575) * (-316.230) (-315.590) (-315.943) [-319.400] -- 0:00:17
      705000 -- (-316.504) (-316.614) (-316.641) [-314.997] * [-316.690] (-320.421) (-319.988) (-317.376) -- 0:00:17

      Average standard deviation of split frequencies: 0.009932

      705500 -- (-317.543) [-315.752] (-322.259) (-317.783) * (-319.097) (-323.955) [-316.444] (-315.936) -- 0:00:17
      706000 -- [-318.179] (-318.305) (-318.212) (-315.732) * (-317.902) (-317.085) (-321.397) [-319.289] -- 0:00:17
      706500 -- (-315.907) [-317.269] (-317.023) (-315.862) * (-317.132) (-316.669) (-319.765) [-317.021] -- 0:00:17
      707000 -- (-319.784) (-316.814) (-319.910) [-316.985] * (-318.517) (-317.140) (-321.224) [-319.955] -- 0:00:17
      707500 -- (-316.022) [-316.502] (-319.955) (-315.776) * (-316.175) (-317.693) [-315.212] (-320.831) -- 0:00:17
      708000 -- (-317.744) (-320.558) [-316.134] (-316.537) * (-319.340) (-315.968) [-315.608] (-318.341) -- 0:00:17
      708500 -- (-317.133) (-316.713) [-316.830] (-315.166) * (-317.820) [-317.074] (-315.843) (-315.711) -- 0:00:17
      709000 -- (-316.905) (-316.875) (-317.136) [-317.997] * (-318.217) (-317.196) (-315.208) [-316.355] -- 0:00:17
      709500 -- (-317.050) (-319.489) [-317.916] (-318.076) * [-316.627] (-318.351) (-317.441) (-317.157) -- 0:00:17
      710000 -- [-324.368] (-318.698) (-317.455) (-318.249) * (-318.531) (-316.975) (-317.191) [-317.137] -- 0:00:17

      Average standard deviation of split frequencies: 0.009452

      710500 -- (-319.283) (-315.149) [-320.652] (-317.544) * (-320.172) [-317.528] (-315.461) (-321.037) -- 0:00:17
      711000 -- (-318.473) (-315.563) [-315.452] (-317.916) * (-316.689) (-317.001) (-316.301) [-316.550] -- 0:00:17
      711500 -- (-319.921) [-315.995] (-316.504) (-316.072) * (-317.874) [-316.187] (-317.805) (-316.531) -- 0:00:17
      712000 -- (-317.439) (-315.785) [-315.386] (-316.971) * (-316.456) (-323.370) [-316.613] (-320.087) -- 0:00:16
      712500 -- [-315.506] (-319.546) (-316.274) (-317.963) * (-316.759) (-315.804) [-316.639] (-318.384) -- 0:00:16
      713000 -- (-315.339) (-319.486) [-315.892] (-316.873) * (-319.656) (-315.533) [-316.020] (-316.256) -- 0:00:16
      713500 -- (-318.335) [-317.466] (-316.925) (-319.689) * (-318.424) [-315.283] (-319.224) (-317.078) -- 0:00:16
      714000 -- (-317.244) (-320.558) (-315.938) [-315.862] * [-317.326] (-316.113) (-317.200) (-316.199) -- 0:00:16
      714500 -- [-316.540] (-320.049) (-316.093) (-316.921) * (-319.445) [-319.443] (-319.561) (-318.808) -- 0:00:16
      715000 -- [-316.527] (-318.156) (-317.460) (-321.214) * [-316.321] (-317.269) (-316.936) (-315.779) -- 0:00:16

      Average standard deviation of split frequencies: 0.009835

      715500 -- [-317.119] (-319.312) (-315.893) (-320.873) * (-317.058) (-316.998) (-321.069) [-316.166] -- 0:00:16
      716000 -- [-318.550] (-317.707) (-322.926) (-316.776) * (-317.380) [-315.774] (-320.262) (-315.631) -- 0:00:16
      716500 -- [-316.582] (-318.782) (-317.814) (-317.581) * [-315.137] (-315.961) (-319.787) (-318.116) -- 0:00:16
      717000 -- [-317.375] (-323.814) (-317.280) (-316.602) * (-318.089) (-318.524) [-318.340] (-319.949) -- 0:00:16
      717500 -- (-321.192) (-320.372) (-322.938) [-317.487] * (-317.438) (-315.765) (-318.305) [-320.015] -- 0:00:16
      718000 -- [-318.044] (-321.627) (-317.910) (-316.610) * (-319.123) (-316.358) (-320.011) [-318.029] -- 0:00:16
      718500 -- (-317.308) (-320.507) (-320.592) [-317.075] * (-319.876) (-315.473) (-319.185) [-320.507] -- 0:00:16
      719000 -- (-321.297) (-320.194) [-318.184] (-315.757) * (-317.249) (-317.163) (-316.408) [-317.594] -- 0:00:16
      719500 -- (-317.056) [-315.543] (-318.696) (-315.908) * [-315.358] (-318.599) (-318.480) (-318.166) -- 0:00:16
      720000 -- [-317.820] (-315.897) (-317.866) (-317.559) * (-317.180) (-316.975) [-316.386] (-321.095) -- 0:00:16

      Average standard deviation of split frequencies: 0.009853

      720500 -- (-317.286) (-316.641) [-320.076] (-316.824) * (-316.435) [-315.930] (-316.008) (-318.676) -- 0:00:16
      721000 -- [-315.666] (-315.982) (-317.068) (-316.481) * (-319.248) [-315.170] (-317.295) (-317.165) -- 0:00:16
      721500 -- (-316.623) (-316.261) [-321.317] (-317.873) * [-316.863] (-316.903) (-317.229) (-318.310) -- 0:00:16
      722000 -- [-316.023] (-321.030) (-319.521) (-316.300) * (-316.749) (-319.240) (-317.851) [-318.223] -- 0:00:16
      722500 -- (-319.068) (-325.214) [-315.782] (-315.841) * (-316.775) (-316.922) [-315.146] (-315.810) -- 0:00:16
      723000 -- (-318.279) [-318.890] (-321.159) (-315.742) * (-315.492) (-318.173) [-316.506] (-316.047) -- 0:00:16
      723500 -- [-316.948] (-317.751) (-323.053) (-317.128) * [-320.852] (-316.069) (-316.659) (-318.133) -- 0:00:16
      724000 -- (-318.333) (-315.988) [-320.391] (-317.859) * (-318.315) (-317.873) [-316.079] (-315.319) -- 0:00:16
      724500 -- (-317.225) (-319.500) [-315.280] (-319.407) * (-315.520) (-316.522) (-316.045) [-319.670] -- 0:00:16
      725000 -- [-318.057] (-317.363) (-317.820) (-319.383) * (-316.550) [-315.856] (-319.291) (-316.984) -- 0:00:16

      Average standard deviation of split frequencies: 0.009293

      725500 -- [-315.797] (-317.241) (-317.110) (-317.101) * (-318.172) (-318.966) (-324.940) [-316.368] -- 0:00:16
      726000 -- (-317.185) (-318.058) (-321.191) [-316.797] * (-316.946) (-317.937) (-315.617) [-316.942] -- 0:00:16
      726500 -- (-317.180) [-316.473] (-316.762) (-315.869) * [-316.598] (-316.003) (-317.110) (-317.888) -- 0:00:16
      727000 -- (-317.184) [-315.395] (-319.083) (-322.492) * [-317.122] (-318.071) (-317.961) (-317.762) -- 0:00:16
      727500 -- (-321.870) (-315.911) [-316.112] (-320.541) * (-317.538) [-318.281] (-315.877) (-316.375) -- 0:00:16
      728000 -- [-317.931] (-315.942) (-320.642) (-317.144) * (-316.554) (-317.588) (-317.873) [-316.106] -- 0:00:16
      728500 -- (-321.381) (-316.836) (-315.592) [-317.107] * [-317.019] (-321.168) (-316.735) (-317.154) -- 0:00:16
      729000 -- (-318.516) (-316.962) [-317.834] (-320.725) * [-317.274] (-321.688) (-316.137) (-316.361) -- 0:00:15
      729500 -- (-317.412) (-315.847) (-318.236) [-320.361] * [-317.339] (-318.512) (-316.375) (-316.807) -- 0:00:15
      730000 -- [-316.455] (-323.053) (-318.697) (-318.331) * (-318.112) (-317.769) (-319.198) [-315.798] -- 0:00:15

      Average standard deviation of split frequencies: 0.009234

      730500 -- [-315.766] (-317.929) (-319.862) (-316.974) * [-316.962] (-317.603) (-316.262) (-316.176) -- 0:00:15
      731000 -- [-318.031] (-316.961) (-316.289) (-316.576) * (-316.871) (-315.889) (-315.713) [-320.076] -- 0:00:15
      731500 -- (-316.707) [-317.781] (-317.837) (-320.411) * (-318.125) [-320.039] (-318.630) (-318.926) -- 0:00:15
      732000 -- (-316.606) (-318.395) [-317.248] (-315.830) * (-318.214) (-319.356) [-318.450] (-320.014) -- 0:00:15
      732500 -- (-318.868) [-315.585] (-316.786) (-317.330) * (-319.711) (-315.931) [-316.585] (-320.953) -- 0:00:15
      733000 -- (-318.932) [-321.294] (-318.521) (-317.176) * (-316.219) [-316.468] (-315.534) (-319.785) -- 0:00:15
      733500 -- (-316.783) [-319.766] (-321.185) (-316.248) * [-316.293] (-318.150) (-318.847) (-317.550) -- 0:00:15
      734000 -- (-321.360) [-317.023] (-319.626) (-317.816) * [-318.565] (-317.560) (-325.345) (-317.881) -- 0:00:15
      734500 -- (-321.446) (-316.857) [-318.080] (-323.718) * [-318.360] (-317.249) (-317.558) (-315.279) -- 0:00:15
      735000 -- (-320.566) (-320.063) [-315.449] (-315.892) * (-320.728) (-317.127) [-316.934] (-318.629) -- 0:00:15

      Average standard deviation of split frequencies: 0.009087

      735500 -- (-316.825) [-316.107] (-318.544) (-316.958) * (-315.834) (-318.137) (-316.940) [-317.318] -- 0:00:15
      736000 -- (-316.135) (-317.916) [-316.865] (-318.199) * (-315.981) [-318.768] (-316.351) (-317.011) -- 0:00:15
      736500 -- (-318.254) (-319.253) (-318.561) [-316.383] * (-316.177) (-316.275) (-319.152) [-317.562] -- 0:00:15
      737000 -- (-317.035) (-324.327) (-315.965) [-317.185] * [-316.321] (-316.189) (-319.011) (-317.453) -- 0:00:15
      737500 -- (-319.990) (-320.006) (-319.279) [-317.274] * (-316.362) (-319.107) (-321.781) [-316.912] -- 0:00:15
      738000 -- (-318.737) [-316.473] (-319.165) (-317.961) * (-321.352) (-318.356) (-317.135) [-316.079] -- 0:00:15
      738500 -- (-315.805) (-316.274) [-316.294] (-317.854) * (-318.820) [-319.235] (-319.357) (-320.371) -- 0:00:15
      739000 -- (-316.303) (-318.414) [-318.316] (-317.640) * (-322.440) [-315.722] (-324.058) (-316.371) -- 0:00:15
      739500 -- (-318.058) (-316.505) (-316.777) [-317.022] * [-315.431] (-319.264) (-324.902) (-317.420) -- 0:00:15
      740000 -- (-316.980) [-316.721] (-318.460) (-317.962) * (-317.883) (-319.025) (-323.213) [-324.035] -- 0:00:15

      Average standard deviation of split frequencies: 0.008632

      740500 -- (-322.288) [-319.736] (-319.382) (-317.974) * (-320.463) (-321.702) [-317.911] (-318.771) -- 0:00:15
      741000 -- (-318.602) (-321.289) (-318.200) [-318.426] * [-319.631] (-317.000) (-316.264) (-315.435) -- 0:00:15
      741500 -- (-318.929) (-328.430) [-316.022] (-318.531) * [-316.066] (-316.745) (-317.684) (-315.551) -- 0:00:15
      742000 -- (-321.950) (-327.656) [-316.034] (-317.999) * (-317.198) (-318.337) (-317.257) [-315.339] -- 0:00:15
      742500 -- [-323.011] (-320.636) (-315.347) (-319.182) * (-317.662) [-317.723] (-318.571) (-315.551) -- 0:00:15
      743000 -- (-320.896) (-319.628) (-314.949) [-316.335] * (-318.587) (-316.276) [-317.163] (-316.814) -- 0:00:15
      743500 -- [-315.768] (-317.210) (-317.075) (-315.623) * (-318.000) (-317.056) [-316.782] (-318.987) -- 0:00:15
      744000 -- (-319.463) (-315.586) (-321.843) [-315.315] * [-316.088] (-316.945) (-316.858) (-315.451) -- 0:00:15
      744500 -- (-323.978) (-315.007) (-322.051) [-316.264] * (-317.323) (-317.063) (-315.724) [-316.973] -- 0:00:15
      745000 -- [-320.358] (-316.917) (-316.985) (-315.981) * (-320.444) (-318.038) [-315.530] (-318.051) -- 0:00:15

      Average standard deviation of split frequencies: 0.008689

      745500 -- (-317.435) [-317.365] (-320.254) (-316.460) * [-315.696] (-318.370) (-315.677) (-319.842) -- 0:00:15
      746000 -- (-318.201) [-317.378] (-319.177) (-316.547) * [-318.466] (-318.682) (-315.876) (-320.168) -- 0:00:14
      746500 -- (-317.243) (-320.717) (-318.386) [-315.699] * (-319.245) [-315.948] (-318.248) (-316.875) -- 0:00:14
      747000 -- (-315.892) [-322.222] (-317.685) (-317.196) * [-317.527] (-317.139) (-316.367) (-319.679) -- 0:00:14
      747500 -- (-319.055) (-318.116) [-315.614] (-316.247) * (-317.693) (-316.293) (-319.023) [-316.106] -- 0:00:14
      748000 -- (-316.564) (-318.014) (-319.195) [-316.485] * (-323.622) (-316.366) (-317.249) [-318.168] -- 0:00:14
      748500 -- [-317.840] (-319.438) (-322.509) (-315.718) * [-319.159] (-319.454) (-315.156) (-318.246) -- 0:00:14
      749000 -- (-315.957) (-316.481) (-317.245) [-317.441] * [-322.985] (-319.251) (-317.958) (-318.258) -- 0:00:14
      749500 -- (-316.053) [-316.494] (-316.189) (-316.309) * [-317.689] (-316.979) (-315.596) (-317.278) -- 0:00:14
      750000 -- (-316.207) (-316.802) [-318.281] (-319.266) * (-318.515) (-317.506) [-316.291] (-316.521) -- 0:00:14

      Average standard deviation of split frequencies: 0.008164

      750500 -- (-316.328) [-319.179] (-318.676) (-321.014) * (-318.241) (-316.500) (-316.262) [-316.626] -- 0:00:14
      751000 -- [-316.251] (-316.969) (-319.117) (-318.992) * (-316.692) (-316.402) (-320.450) [-316.673] -- 0:00:14
      751500 -- (-318.697) (-317.594) [-321.293] (-316.628) * (-317.973) [-321.258] (-318.445) (-316.158) -- 0:00:14
      752000 -- (-316.370) (-318.979) [-320.362] (-317.930) * [-319.782] (-319.864) (-317.300) (-316.471) -- 0:00:14
      752500 -- (-317.498) (-319.740) [-316.294] (-316.166) * (-318.198) (-321.960) (-319.018) [-318.108] -- 0:00:14
      753000 -- (-321.389) (-318.048) [-317.881] (-318.517) * [-320.152] (-320.163) (-318.240) (-316.242) -- 0:00:14
      753500 -- (-319.027) [-317.157] (-316.368) (-316.917) * [-317.836] (-319.211) (-318.672) (-315.862) -- 0:00:14
      754000 -- (-316.312) (-321.023) (-318.339) [-316.121] * (-317.161) (-317.403) [-318.376] (-320.859) -- 0:00:14
      754500 -- (-320.127) (-316.770) (-316.653) [-322.784] * (-318.303) (-317.656) [-316.602] (-316.496) -- 0:00:14
      755000 -- (-321.936) (-317.330) (-316.209) [-316.698] * [-317.092] (-316.431) (-316.159) (-316.351) -- 0:00:14

      Average standard deviation of split frequencies: 0.008067

      755500 -- (-316.748) (-316.941) (-319.774) [-317.120] * (-317.881) (-317.619) [-316.857] (-316.072) -- 0:00:14
      756000 -- (-321.585) (-316.652) (-316.451) [-317.252] * (-319.043) (-317.491) (-316.763) [-316.955] -- 0:00:14
      756500 -- (-319.300) (-317.034) [-316.262] (-315.998) * [-316.788] (-317.059) (-315.790) (-318.861) -- 0:00:14
      757000 -- (-326.139) (-315.826) [-317.711] (-318.242) * [-317.982] (-316.349) (-316.760) (-319.202) -- 0:00:14
      757500 -- [-318.427] (-322.104) (-318.421) (-318.286) * (-315.933) [-318.535] (-316.090) (-317.808) -- 0:00:14
      758000 -- [-317.555] (-316.348) (-322.121) (-315.483) * [-318.164] (-321.898) (-317.068) (-318.084) -- 0:00:14
      758500 -- (-316.120) (-321.082) [-319.563] (-317.903) * [-317.789] (-318.756) (-316.231) (-319.144) -- 0:00:14
      759000 -- (-317.285) (-317.307) [-316.042] (-315.947) * (-323.846) [-315.712] (-316.810) (-320.336) -- 0:00:14
      759500 -- [-318.662] (-318.409) (-316.348) (-315.158) * (-315.804) (-317.430) [-318.605] (-319.311) -- 0:00:14
      760000 -- (-320.365) [-318.825] (-318.719) (-319.381) * (-316.264) [-315.801] (-317.290) (-315.850) -- 0:00:14

      Average standard deviation of split frequencies: 0.007630

      760500 -- (-318.110) (-316.376) (-318.227) [-316.333] * [-319.979] (-316.844) (-317.149) (-317.025) -- 0:00:14
      761000 -- [-320.489] (-318.987) (-316.759) (-317.005) * (-318.710) [-316.002] (-317.060) (-317.888) -- 0:00:14
      761500 -- [-316.020] (-317.937) (-316.921) (-316.255) * (-318.585) (-316.250) [-315.768] (-317.546) -- 0:00:14
      762000 -- (-315.933) (-316.245) (-317.830) [-317.103] * [-318.874] (-317.216) (-316.303) (-319.070) -- 0:00:14
      762500 -- (-315.863) (-316.695) [-320.287] (-319.179) * [-315.614] (-317.014) (-316.327) (-315.571) -- 0:00:14
      763000 -- (-316.028) (-321.520) (-318.658) [-319.467] * (-315.871) [-317.382] (-317.106) (-316.187) -- 0:00:13
      763500 -- (-319.281) [-315.971] (-318.852) (-318.463) * [-316.456] (-317.493) (-316.436) (-320.469) -- 0:00:13
      764000 -- [-316.936] (-317.508) (-317.788) (-317.046) * (-318.260) [-319.154] (-317.517) (-320.032) -- 0:00:13
      764500 -- (-317.359) (-325.605) (-317.855) [-315.455] * [-318.990] (-315.723) (-317.246) (-320.660) -- 0:00:13
      765000 -- (-317.365) (-316.414) (-316.057) [-316.197] * [-316.244] (-317.169) (-316.064) (-323.827) -- 0:00:13

      Average standard deviation of split frequencies: 0.007577

      765500 -- (-315.790) (-323.067) [-316.856] (-315.543) * (-315.663) (-318.115) (-315.590) [-318.747] -- 0:00:13
      766000 -- [-317.649] (-318.508) (-317.744) (-316.512) * (-317.891) [-318.622] (-315.547) (-318.351) -- 0:00:13
      766500 -- (-317.112) (-319.681) [-316.989] (-316.303) * [-316.979] (-320.141) (-316.119) (-321.216) -- 0:00:13
      767000 -- (-318.350) (-317.249) (-317.817) [-316.695] * (-318.361) (-319.753) (-318.803) [-316.203] -- 0:00:13
      767500 -- (-318.720) (-319.107) (-318.778) [-317.822] * [-315.776] (-321.538) (-316.927) (-317.141) -- 0:00:13
      768000 -- [-317.825] (-322.118) (-319.174) (-317.093) * (-319.374) (-316.958) [-317.762] (-317.134) -- 0:00:13
      768500 -- (-320.015) [-317.298] (-318.092) (-318.804) * (-315.674) (-315.976) (-316.638) [-316.379] -- 0:00:13
      769000 -- (-318.647) (-319.829) [-316.786] (-315.411) * (-316.382) [-318.255] (-317.695) (-316.028) -- 0:00:13
      769500 -- [-316.523] (-317.425) (-317.524) (-317.867) * (-317.194) (-318.894) (-316.702) [-318.978] -- 0:00:13
      770000 -- [-318.314] (-320.947) (-316.807) (-318.517) * (-320.414) [-317.789] (-315.833) (-316.625) -- 0:00:13

      Average standard deviation of split frequencies: 0.007226

      770500 -- (-317.585) [-317.355] (-315.346) (-318.070) * (-317.172) (-319.158) (-316.997) [-317.088] -- 0:00:13
      771000 -- (-316.950) (-315.237) [-315.100] (-317.568) * (-322.454) (-317.833) [-318.840] (-316.569) -- 0:00:13
      771500 -- [-317.475] (-322.448) (-321.143) (-318.212) * [-315.442] (-318.739) (-316.072) (-325.855) -- 0:00:13
      772000 -- [-316.781] (-318.916) (-319.014) (-316.430) * (-316.286) (-318.069) [-316.271] (-317.981) -- 0:00:13
      772500 -- (-315.154) [-316.391] (-316.326) (-317.382) * (-316.001) (-324.275) (-316.830) [-322.324] -- 0:00:13
      773000 -- (-316.555) (-316.681) [-315.250] (-317.383) * (-316.500) (-320.495) [-317.382] (-318.532) -- 0:00:13
      773500 -- (-316.226) [-317.241] (-315.173) (-315.222) * (-320.353) [-318.706] (-317.329) (-317.178) -- 0:00:13
      774000 -- [-316.800] (-317.211) (-316.290) (-315.546) * (-322.582) (-320.772) (-315.523) [-316.300] -- 0:00:13
      774500 -- (-316.863) [-316.407] (-318.970) (-315.048) * (-315.816) (-317.168) [-315.635] (-324.660) -- 0:00:13
      775000 -- (-315.241) [-315.955] (-318.985) (-316.442) * [-315.492] (-316.179) (-316.281) (-315.556) -- 0:00:13

      Average standard deviation of split frequencies: 0.007783

      775500 -- (-315.561) (-316.985) (-316.263) [-315.517] * [-315.996] (-316.604) (-315.284) (-316.677) -- 0:00:13
      776000 -- [-317.998] (-317.190) (-315.489) (-316.141) * (-315.783) (-319.420) [-317.131] (-319.014) -- 0:00:13
      776500 -- (-318.787) [-316.456] (-318.456) (-316.531) * (-319.264) (-317.198) (-317.077) [-319.133] -- 0:00:13
      777000 -- [-316.301] (-317.253) (-317.810) (-316.341) * (-316.852) (-317.686) [-316.387] (-316.685) -- 0:00:13
      777500 -- (-318.904) (-317.702) (-316.623) [-316.471] * (-317.559) (-319.246) (-316.790) [-318.892] -- 0:00:13
      778000 -- (-316.576) (-317.341) (-319.260) [-316.042] * (-319.721) [-317.588] (-316.972) (-317.234) -- 0:00:13
      778500 -- (-315.291) (-315.368) [-320.999] (-318.207) * (-320.811) (-317.762) [-316.766] (-319.218) -- 0:00:13
      779000 -- [-315.758] (-315.584) (-317.559) (-320.950) * (-317.854) (-318.735) (-316.846) [-317.926] -- 0:00:13
      779500 -- [-316.961] (-317.547) (-315.135) (-320.249) * [-316.493] (-315.684) (-317.006) (-316.578) -- 0:00:13
      780000 -- (-317.250) [-319.694] (-315.296) (-318.604) * [-315.582] (-317.256) (-316.955) (-316.091) -- 0:00:12

      Average standard deviation of split frequencies: 0.007850

      780500 -- (-319.004) (-318.638) [-317.111] (-316.430) * (-316.668) (-318.074) [-318.812] (-316.830) -- 0:00:12
      781000 -- (-316.802) [-316.028] (-320.802) (-318.012) * (-316.342) (-317.726) [-317.031] (-315.253) -- 0:00:12
      781500 -- (-317.179) [-321.711] (-320.237) (-318.669) * [-317.893] (-316.671) (-317.887) (-317.072) -- 0:00:12
      782000 -- [-315.056] (-318.021) (-316.650) (-318.217) * (-316.099) (-316.172) (-316.445) [-316.737] -- 0:00:12
      782500 -- (-318.107) (-317.982) [-316.462] (-319.218) * [-316.695] (-317.112) (-318.257) (-325.592) -- 0:00:12
      783000 -- (-315.483) (-319.048) (-316.225) [-316.719] * (-316.330) (-320.804) (-316.853) [-316.035] -- 0:00:12
      783500 -- (-315.686) (-315.353) (-317.854) [-319.453] * [-316.707] (-319.820) (-318.773) (-319.109) -- 0:00:12
      784000 -- (-315.936) (-318.745) [-317.210] (-318.017) * [-316.612] (-318.671) (-317.288) (-316.288) -- 0:00:12
      784500 -- [-316.431] (-315.229) (-318.549) (-317.865) * (-315.690) (-317.222) [-316.994] (-317.457) -- 0:00:12
      785000 -- (-316.849) (-320.101) [-316.826] (-316.862) * [-316.632] (-317.237) (-316.060) (-316.735) -- 0:00:12

      Average standard deviation of split frequencies: 0.008397

      785500 -- (-319.110) (-317.452) [-315.786] (-317.992) * (-316.519) (-319.763) [-315.441] (-318.954) -- 0:00:12
      786000 -- (-318.031) (-317.524) [-317.002] (-320.171) * (-317.634) (-319.727) [-317.452] (-317.518) -- 0:00:12
      786500 -- (-315.876) (-317.595) [-317.802] (-316.796) * (-322.336) [-316.708] (-317.200) (-318.087) -- 0:00:12
      787000 -- [-316.529] (-317.280) (-317.802) (-317.599) * (-316.925) (-315.532) [-317.932] (-316.164) -- 0:00:12
      787500 -- (-317.110) [-315.719] (-316.623) (-316.365) * (-318.025) (-317.280) [-318.675] (-316.212) -- 0:00:12
      788000 -- [-315.820] (-315.741) (-316.798) (-316.934) * (-317.471) (-315.794) [-318.488] (-318.505) -- 0:00:12
      788500 -- (-316.171) [-315.174] (-317.482) (-317.034) * (-317.248) (-317.932) (-316.490) [-316.691] -- 0:00:12
      789000 -- (-318.956) (-321.982) (-317.417)