--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 16:19:41 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/4res/ML0211/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1860.17         -1863.13
2      -1860.13         -1863.65
--------------------------------------
TOTAL    -1860.15         -1863.42
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896702    0.091972    0.365200    1.502041    0.860333   1450.75   1475.87    1.000
r(A<->C){all}   0.167601    0.021255    0.000016    0.470325    0.127988    139.91    250.90    1.000
r(A<->G){all}   0.171666    0.020234    0.000003    0.453830    0.133190    197.29    290.20    1.005
r(A<->T){all}   0.163370    0.019029    0.000014    0.430699    0.129544    252.53    339.45    1.000
r(C<->G){all}   0.170310    0.020860    0.000009    0.457221    0.128813     31.43    156.52    1.001
r(C<->T){all}   0.165893    0.021385    0.000066    0.452739    0.124725    105.14    223.16    1.007
r(G<->T){all}   0.161161    0.017928    0.000005    0.429605    0.130659    169.53    286.29    1.014
pi(A){all}      0.165818    0.000098    0.146870    0.185243    0.165744   1390.52   1393.66    1.000
pi(C){all}      0.302981    0.000148    0.278917    0.325802    0.302812   1179.27   1250.77    1.000
pi(G){all}      0.337873    0.000158    0.314596    0.363010    0.337905   1277.79   1320.65    1.000
pi(T){all}      0.193328    0.000110    0.173013    0.213270    0.193106   1234.03   1273.33    1.000
alpha{1,2}      0.426940    0.238362    0.000152    1.407929    0.255708   1198.29   1270.94    1.001
alpha{3}        0.475450    0.252759    0.000100    1.459165    0.309931   1190.39   1345.70    1.000
pinvar{all}     0.998956    0.000001    0.996634    0.999998    0.999324   1178.79   1192.97    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1799.534793
Model 2: PositiveSelection	-1799.534498
Model 0: one-ratio	-1799.534499
Model 7: beta	-1799.534793
Model 8: beta&w>1	-1799.534641


Model 0 vs 1	5.879999998796848E-4

Model 2 vs 1	5.900000001020089E-4

Model 8 vs 7	3.040000001419685E-4
>C1
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C2
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C3
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C4
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C5
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C6
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=461 

C1              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C2              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C3              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C4              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C5              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C6              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
                **************************************************

C1              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C2              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C3              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C4              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C5              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C6              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
                **************************************************

C1              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C2              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C3              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C4              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C5              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C6              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
                **************************************************

C1              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C2              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C3              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C4              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C5              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C6              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
                **************************************************

C1              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C2              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C3              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C4              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C5              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C6              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
                **************************************************

C1              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C2              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C3              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C4              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C5              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C6              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
                **************************************************

C1              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C2              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C3              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C4              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C5              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C6              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
                **************************************************

C1              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C2              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C3              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C4              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C5              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C6              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
                **************************************************

C1              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C2              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C3              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C4              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C5              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C6              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
                **************************************************

C1              ATRLWMCGCAT
C2              ATRLWMCGCAT
C3              ATRLWMCGCAT
C4              ATRLWMCGCAT
C5              ATRLWMCGCAT
C6              ATRLWMCGCAT
                ***********




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  461 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  461 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [13830]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [13830]--->[13830]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.550 Mb, Max= 31.053 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C2              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C3              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C4              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C5              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
C6              LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
                **************************************************

C1              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C2              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C3              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C4              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C5              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
C6              STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
                **************************************************

C1              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C2              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C3              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C4              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C5              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
C6              LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
                **************************************************

C1              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C2              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C3              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C4              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C5              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
C6              LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
                **************************************************

C1              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C2              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C3              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C4              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C5              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
C6              TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
                **************************************************

C1              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C2              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C3              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C4              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C5              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
C6              RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
                **************************************************

C1              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C2              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C3              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C4              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C5              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
C6              ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
                **************************************************

C1              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C2              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C3              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C4              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C5              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
C6              RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
                **************************************************

C1              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C2              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C3              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C4              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C5              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
C6              PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
                **************************************************

C1              ATRLWMCGCAT
C2              ATRLWMCGCAT
C3              ATRLWMCGCAT
C4              ATRLWMCGCAT
C5              ATRLWMCGCAT
C6              ATRLWMCGCAT
                ***********




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
C2              TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
C3              TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
C4              TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
C5              TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
C6              TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
                **************************************************

C1              GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
C2              GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
C3              GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
C4              GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
C5              GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
C6              GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
                **************************************************

C1              GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
C2              GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
C3              GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
C4              GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
C5              GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
C6              GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
                **************************************************

C1              TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
C2              TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
C3              TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
C4              TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
C5              TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
C6              TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
                **************************************************

C1              CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
C2              CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
C3              CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
C4              CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
C5              CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
C6              CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
                **************************************************

C1              GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
C2              GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
C3              GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
C4              GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
C5              GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
C6              GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
                **************************************************

C1              CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
C2              CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
C3              CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
C4              CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
C5              CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
C6              CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
                **************************************************

C1              GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
C2              GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
C3              GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
C4              GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
C5              GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
C6              GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
                **************************************************

C1              TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
C2              TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
C3              TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
C4              TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
C5              TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
C6              TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
                **************************************************

C1              CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
C2              CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
C3              CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
C4              CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
C5              CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
C6              CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
                **************************************************

C1              CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
C2              CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
C3              CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
C4              CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
C5              CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
C6              CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
                **************************************************

C1              GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
C2              GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
C3              GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
C4              GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
C5              GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
C6              GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
                **************************************************

C1              ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
C2              ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
C3              ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
C4              ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
C5              ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
C6              ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
                **************************************************

C1              CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
C2              CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
C3              CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
C4              CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
C5              CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
C6              CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
                **************************************************

C1              CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
C2              CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
C3              CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
C4              CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
C5              CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
C6              CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
                **************************************************

C1              CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
C2              CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
C3              CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
C4              CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
C5              CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
C6              CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
                **************************************************

C1              CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
C2              CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
C3              CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
C4              CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
C5              CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
C6              CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
                **************************************************

C1              TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
C2              TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
C3              TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
C4              TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
C5              TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
C6              TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
                **************************************************

C1              GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
C2              GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
C3              GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
C4              GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
C5              GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
C6              GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
                **************************************************

C1              TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
C2              TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
C3              TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
C4              TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
C5              TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
C6              TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
                **************************************************

C1              ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
C2              ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
C3              ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
C4              ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
C5              ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
C6              ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
                **************************************************

C1              CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
C2              CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
C3              CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
C4              CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
C5              CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
C6              CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
                **************************************************

C1              GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
C2              GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
C3              GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
C4              GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
C5              GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
C6              GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
                **************************************************

C1              GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
C2              GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
C3              GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
C4              GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
C5              GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
C6              GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
                **************************************************

C1              CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
C2              CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
C3              CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
C4              CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
C5              CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
C6              CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
                **************************************************

C1              TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
C2              TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
C3              TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
C4              TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
C5              TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
C6              TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
                **************************************************

C1              TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
C2              TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
C3              TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
C4              TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
C5              TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
C6              TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
                **************************************************

C1              GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
C2              GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
C3              GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
C4              GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
C5              GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
C6              GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
                *********************************



>C1
TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
>C2
TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
>C3
TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
>C4
TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
>C5
TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
>C6
TTGAATCCTATTCGCTGGCAGAAATCTTACGTAGTTGTCGGATTGGCCAT
GCTGGCGTTCATCATCGCCGCGGTGAAGGCGGCAACCGTCTTCACCACGG
GCGGCCACAGCACGAATGGAGCACGGTCCGCGGTACCGCCTCCGCGGGCG
TCTACGGTCAAGCCGGCATTGGTTCCGGTAACCGAAACCGCCGTGGTACC
CAGCGTTGGCGGACTGGCTGCCGCGCTGGCGTCGGCTTTGGCAGATCCCA
GTTTGGGTAGTTTTGGGGGACGGATCACCGATGCGATGACTGCCAAGGAA
CTCTGGCAGCAACAAGATGACATGCCGTTGGTGCCAGCGTCGGCCAATAA
GCTCTTGACCGCAGCTGCGGCGCTGTTGACACTGGACCGCCAGACTCGGA
TCAGCACCCGGGTGGTGGCTGCAGGCCCGAATGCCCAAGGGCCTGTCGTT
CTGGTGGGTGCTGGGGATCCGACCCTGTCGGCCGCATCGCCCGACCAGAG
CACCTGGTATAGGGGTGCGCCGCGGATCAGTGACCTTGTCGAACAGGTTC
GTCGCAGCGGCGTGACGCCTACGGCTGTTCAGGTGGATACCTCGCTGTTC
ACCGGTCCGACGATGGCGCAGGGCTGGGATCCTGCCGATGTGGACAACGG
CTACACTGCCCCGATCGAGTCGGCGATGATCGACGCTGGGCGTATCCAGC
CGACAACCGTCAAATCACGACGGTCACGTACCCCAGCTCTGGACGCCGGG
CGGGAATTGGCCAAGGCCCTGGGGGTCGCTCCCGATGCGGTTACAATCGT
CAAGGCATCGTCTGGGGCGCGGCAGCTGGCTGTGGTGCAGTCAGCGCCGC
TGGTCCAGCGGTTATCCGAGATGATGGACAACTCCGACAACGTGCTGGCC
GAATGCATCGGCCGCGAGGTAGCGGCCGCCATAAACCGGCCTTTGAGCTT
TGCCGGCGCGGTCGACGCGGTGACCAACCGGTTAGGTACAGCGCATATCG
ACACCACCGGCGCTGCTCTGGTGGATTCTAGCGGGTTGTCGGTCAACAAC
CGCTTGACCGCCAAGACACTCGGCGGTGCGGTGCAGGCGGCGGCGGGGCC
GGATCAACCGGTGTTGCGTGCGCTGCTGGATCTGCTCCCGATCGCCGGCG
GCAGCGGCACGTTATCGGACCGCTTTCTCAGTTCGGCGACCCACCAGGGT
CCGGCCGGCTGGTTACGTGCCAAGACCGGCTCGTTGACCGCTATTAATTC
TTTGGTCGGGGTCGTCACTGACCGCAGCGGTCGGGTGTTGACATTCGCGT
TCATCTCCAACGACGCTGGCCCGACCGGTCGTGCCGCGATGGACGAGCTT
GCTACTAGGCTGTGGATGTGCGGGTGCGCTACG
>C1
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C2
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C3
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C4
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C5
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT
>C6
LNPIRWQKSYVVVGLAMLAFIIAAVKAATVFTTGGHSTNGARSAVPPPRA
STVKPALVPVTETAVVPSVGGLAAALASALADPSLGSFGGRITDAMTAKE
LWQQQDDMPLVPASANKLLTAAAALLTLDRQTRISTRVVAAGPNAQGPVV
LVGAGDPTLSAASPDQSTWYRGAPRISDLVEQVRRSGVTPTAVQVDTSLF
TGPTMAQGWDPADVDNGYTAPIESAMIDAGRIQPTTVKSRRSRTPALDAG
RELAKALGVAPDAVTIVKASSGARQLAVVQSAPLVQRLSEMMDNSDNVLA
ECIGREVAAAINRPLSFAGAVDAVTNRLGTAHIDTTGAALVDSSGLSVNN
RLTAKTLGGAVQAAAGPDQPVLRALLDLLPIAGGSGTLSDRFLSSATHQG
PAGWLRAKTGSLTAINSLVGVVTDRSGRVLTFAFISNDAGPTGRAAMDEL
ATRLWMCGCAT


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1383 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579796303
      Setting output file names to "/data/4res/ML0211/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1175301873
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0457007954
      Seed = 146281471
      Swapseed = 1579796303
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -3095.220119 -- -24.965149
         Chain 2 -- -3095.220119 -- -24.965149
         Chain 3 -- -3095.220298 -- -24.965149
         Chain 4 -- -3095.220298 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -3095.220298 -- -24.965149
         Chain 2 -- -3095.220119 -- -24.965149
         Chain 3 -- -3095.219827 -- -24.965149
         Chain 4 -- -3095.220119 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-3095.220] (-3095.220) (-3095.220) (-3095.220) * [-3095.220] (-3095.220) (-3095.220) (-3095.220) 
        500 -- (-1882.030) (-1912.827) [-1883.865] (-1925.650) * [-1878.594] (-1892.634) (-1865.904) (-1891.000) -- 0:00:00
       1000 -- [-1865.266] (-1901.068) (-1884.147) (-1874.251) * (-1874.631) (-1874.577) (-1869.859) [-1867.178] -- 0:00:00
       1500 -- (-1872.976) [-1871.673] (-1879.397) (-1876.441) * (-1870.379) [-1866.106] (-1879.068) (-1874.746) -- 0:00:00
       2000 -- [-1866.427] (-1870.372) (-1878.306) (-1870.529) * (-1865.009) [-1872.355] (-1881.182) (-1871.993) -- 0:00:00
       2500 -- (-1870.536) (-1865.921) [-1869.280] (-1879.343) * [-1866.867] (-1875.546) (-1869.311) (-1870.179) -- 0:00:00
       3000 -- (-1869.522) [-1871.440] (-1865.180) (-1868.640) * (-1871.223) [-1867.084] (-1868.052) (-1871.267) -- 0:00:00
       3500 -- (-1869.911) (-1870.249) [-1862.151] (-1867.710) * (-1870.597) (-1874.603) [-1865.768] (-1874.635) -- 0:00:00
       4000 -- (-1879.439) (-1875.596) [-1870.546] (-1874.939) * (-1872.785) [-1869.199] (-1866.342) (-1868.183) -- 0:00:00
       4500 -- (-1869.629) (-1862.962) [-1865.492] (-1866.972) * [-1862.728] (-1874.350) (-1869.753) (-1877.890) -- 0:00:00
       5000 -- (-1871.846) (-1878.938) [-1874.237] (-1873.498) * (-1869.504) [-1867.855] (-1869.192) (-1870.051) -- 0:00:00

      Average standard deviation of split frequencies: 0.065473

       5500 -- [-1866.915] (-1880.375) (-1875.096) (-1868.159) * (-1877.510) (-1866.447) [-1870.326] (-1870.885) -- 0:00:00
       6000 -- [-1864.195] (-1867.352) (-1875.299) (-1869.701) * (-1869.510) (-1868.962) [-1870.542] (-1876.687) -- 0:00:00
       6500 -- (-1879.101) (-1868.506) (-1870.174) [-1867.322] * (-1871.088) [-1866.178] (-1873.031) (-1872.632) -- 0:00:00
       7000 -- (-1874.784) (-1862.773) [-1863.527] (-1871.362) * (-1866.275) [-1872.960] (-1872.780) (-1866.590) -- 0:00:00
       7500 -- (-1867.871) (-1864.757) [-1859.112] (-1870.263) * [-1863.628] (-1871.464) (-1868.127) (-1877.523) -- 0:00:00
       8000 -- (-1863.048) (-1870.497) (-1859.932) [-1869.983] * (-1869.783) (-1870.132) (-1870.233) [-1869.647] -- 0:02:04
       8500 -- (-1872.625) [-1865.006] (-1859.932) (-1875.881) * [-1869.195] (-1881.714) (-1872.269) (-1874.239) -- 0:01:56
       9000 -- (-1870.728) (-1868.051) [-1859.854] (-1864.045) * (-1873.336) (-1862.702) (-1867.946) [-1869.975] -- 0:01:50
       9500 -- (-1867.458) [-1866.563] (-1863.067) (-1862.045) * (-1870.954) [-1870.399] (-1868.972) (-1867.681) -- 0:01:44
      10000 -- [-1868.744] (-1874.439) (-1860.970) (-1873.670) * (-1874.395) (-1869.213) (-1875.168) [-1865.967] -- 0:01:39

      Average standard deviation of split frequencies: 0.082075

      10500 -- (-1865.772) (-1876.250) (-1862.665) [-1872.087] * (-1871.187) [-1869.632] (-1868.187) (-1873.964) -- 0:01:34
      11000 -- (-1873.690) (-1878.625) [-1861.795] (-1863.268) * (-1879.023) [-1869.025] (-1871.660) (-1869.468) -- 0:01:29
      11500 -- (-1871.897) (-1873.066) (-1861.901) [-1872.916] * [-1873.479] (-1866.347) (-1866.040) (-1876.401) -- 0:01:25
      12000 -- (-1876.307) (-1869.115) (-1862.081) [-1868.919] * (-1874.653) [-1871.645] (-1882.126) (-1868.575) -- 0:01:22
      12500 -- [-1866.349] (-1869.768) (-1861.809) (-1863.548) * (-1864.186) (-1864.758) (-1869.379) [-1872.938] -- 0:01:19
      13000 -- (-1872.061) [-1869.232] (-1861.514) (-1871.131) * [-1870.625] (-1864.804) (-1869.520) (-1876.559) -- 0:01:15
      13500 -- (-1872.444) [-1866.990] (-1861.530) (-1868.136) * (-1878.478) (-1869.430) [-1864.104] (-1871.733) -- 0:01:13
      14000 -- [-1869.606] (-1867.558) (-1861.082) (-1871.172) * (-1877.687) (-1863.915) (-1870.230) [-1870.185] -- 0:01:10
      14500 -- (-1872.907) (-1872.026) (-1861.461) [-1866.620] * [-1867.544] (-1866.299) (-1873.428) (-1860.733) -- 0:01:07
      15000 -- [-1867.923] (-1876.130) (-1862.227) (-1881.814) * (-1871.906) [-1875.783] (-1872.242) (-1860.266) -- 0:01:05

      Average standard deviation of split frequencies: 0.054506

      15500 -- [-1870.298] (-1875.629) (-1860.370) (-1866.936) * [-1870.143] (-1871.188) (-1882.667) (-1864.219) -- 0:01:03
      16000 -- (-1868.951) (-1877.882) [-1860.062] (-1875.465) * (-1872.834) (-1872.754) (-1875.721) [-1863.223] -- 0:01:01
      16500 -- [-1867.831] (-1874.427) (-1861.548) (-1870.268) * [-1873.592] (-1863.855) (-1870.944) (-1861.144) -- 0:00:59
      17000 -- (-1872.728) (-1884.345) (-1860.358) [-1872.172] * [-1868.889] (-1874.448) (-1877.058) (-1861.063) -- 0:00:57
      17500 -- (-1872.588) (-1870.162) (-1863.717) [-1868.711] * [-1867.886] (-1869.712) (-1872.903) (-1862.706) -- 0:00:56
      18000 -- (-1868.112) [-1867.941] (-1865.055) (-1874.091) * (-1868.783) [-1870.861] (-1876.338) (-1861.601) -- 0:00:54
      18500 -- [-1870.013] (-1868.181) (-1861.472) (-1873.315) * [-1867.676] (-1866.264) (-1870.875) (-1861.588) -- 0:00:53
      19000 -- (-1880.600) (-1871.784) [-1861.455] (-1879.386) * (-1863.950) [-1865.659] (-1876.684) (-1860.478) -- 0:00:51
      19500 -- (-1867.721) (-1875.013) [-1861.927] (-1875.943) * (-1876.244) [-1869.314] (-1869.163) (-1861.276) -- 0:00:50
      20000 -- (-1875.466) (-1869.037) [-1861.395] (-1879.124) * [-1866.556] (-1865.539) (-1873.141) (-1860.880) -- 0:00:49

      Average standard deviation of split frequencies: 0.058292

      20500 -- (-1870.030) (-1869.514) (-1860.937) [-1865.359] * (-1870.299) (-1872.338) [-1870.419] (-1865.695) -- 0:00:47
      21000 -- (-1862.844) (-1868.985) (-1861.213) [-1864.356] * (-1869.413) (-1877.314) (-1878.877) [-1865.517] -- 0:00:46
      21500 -- (-1861.859) (-1871.814) (-1859.984) [-1874.839] * (-1872.985) [-1868.955] (-1876.457) (-1862.939) -- 0:00:45
      22000 -- (-1861.859) (-1868.105) (-1860.351) [-1866.574] * (-1865.528) (-1879.001) (-1868.988) [-1863.206] -- 0:00:44
      22500 -- (-1860.382) (-1869.297) (-1863.005) [-1871.484] * (-1866.644) (-1867.162) [-1866.797] (-1862.181) -- 0:00:43
      23000 -- (-1861.461) (-1869.892) (-1863.164) [-1868.469] * (-1870.935) (-1868.055) (-1864.506) [-1859.038] -- 0:01:24
      23500 -- (-1862.471) (-1868.118) (-1863.779) [-1867.563] * (-1872.427) [-1866.658] (-1874.765) (-1858.780) -- 0:01:23
      24000 -- (-1860.544) (-1874.451) (-1859.288) [-1871.741] * (-1877.036) (-1872.065) (-1865.808) [-1863.470] -- 0:01:21
      24500 -- (-1861.136) (-1865.410) (-1859.746) [-1868.920] * (-1878.167) [-1875.675] (-1873.959) (-1860.901) -- 0:01:19
      25000 -- (-1860.648) (-1878.071) (-1862.347) [-1870.318] * (-1872.261) (-1872.514) (-1879.562) [-1863.547] -- 0:01:18

      Average standard deviation of split frequencies: 0.045722

      25500 -- (-1860.534) [-1869.802] (-1860.118) (-1866.233) * (-1867.905) [-1859.932] (-1872.487) (-1860.864) -- 0:01:16
      26000 -- [-1860.420] (-1871.172) (-1859.719) (-1866.592) * [-1864.933] (-1860.142) (-1870.586) (-1861.706) -- 0:01:14
      26500 -- (-1861.917) [-1866.406] (-1859.619) (-1874.727) * (-1880.727) (-1860.043) (-1866.897) [-1860.802] -- 0:01:13
      27000 -- [-1859.788] (-1874.728) (-1859.964) (-1879.286) * (-1868.879) (-1860.400) (-1865.937) [-1860.094] -- 0:01:12
      27500 -- (-1860.451) (-1880.855) (-1860.649) [-1868.003] * (-1871.026) [-1860.253] (-1867.980) (-1860.256) -- 0:01:10
      28000 -- (-1860.100) (-1867.049) (-1862.043) [-1870.512] * (-1869.133) (-1861.816) (-1869.560) [-1860.578] -- 0:01:09
      28500 -- (-1861.933) [-1869.093] (-1860.752) (-1878.810) * (-1874.600) (-1859.917) [-1868.317] (-1860.432) -- 0:01:08
      29000 -- (-1861.906) (-1864.130) (-1861.809) [-1872.352] * [-1866.950] (-1860.315) (-1876.403) (-1859.318) -- 0:01:06
      29500 -- [-1860.344] (-1859.538) (-1862.668) (-1875.039) * [-1866.127] (-1859.754) (-1870.456) (-1859.389) -- 0:01:05
      30000 -- [-1861.270] (-1862.441) (-1864.551) (-1871.476) * (-1872.822) [-1862.111] (-1869.515) (-1864.159) -- 0:01:04

      Average standard deviation of split frequencies: 0.032940

      30500 -- (-1861.394) [-1861.724] (-1863.953) (-1872.749) * (-1866.601) [-1860.178] (-1871.907) (-1865.464) -- 0:01:03
      31000 -- (-1862.350) [-1860.100] (-1864.775) (-1873.022) * (-1874.548) [-1859.723] (-1868.132) (-1865.538) -- 0:01:02
      31500 -- [-1863.746] (-1862.611) (-1863.832) (-1871.339) * (-1867.152) (-1859.290) [-1869.101] (-1860.880) -- 0:01:01
      32000 -- (-1862.984) (-1860.566) (-1871.425) [-1869.247] * (-1871.586) [-1859.458] (-1872.496) (-1860.864) -- 0:01:00
      32500 -- (-1862.134) (-1861.405) (-1865.521) [-1867.051] * [-1866.401] (-1859.367) (-1869.356) (-1860.236) -- 0:00:59
      33000 -- [-1862.969] (-1860.957) (-1863.468) (-1867.695) * (-1874.753) [-1861.154] (-1887.410) (-1860.068) -- 0:00:58
      33500 -- (-1863.238) (-1861.720) (-1861.105) [-1867.764] * [-1868.945] (-1859.131) (-1875.733) (-1861.775) -- 0:00:57
      34000 -- (-1859.418) (-1863.284) (-1862.127) [-1871.879] * (-1864.044) (-1860.352) (-1868.892) [-1860.593] -- 0:00:56
      34500 -- (-1860.049) [-1866.169] (-1861.041) (-1870.271) * (-1865.296) (-1860.776) [-1868.998] (-1862.403) -- 0:00:55
      35000 -- (-1859.855) (-1863.824) (-1860.510) [-1864.723] * (-1868.782) (-1860.704) [-1872.201] (-1861.436) -- 0:00:55

      Average standard deviation of split frequencies: 0.037101

      35500 -- (-1859.616) (-1861.206) (-1859.941) [-1866.164] * (-1876.303) [-1862.770] (-1870.306) (-1859.179) -- 0:00:54
      36000 -- (-1861.064) (-1862.029) (-1859.943) [-1872.268] * [-1869.556] (-1860.494) (-1867.364) (-1860.149) -- 0:00:53
      36500 -- (-1859.718) (-1863.049) (-1860.436) [-1867.593] * (-1873.930) [-1860.363] (-1870.794) (-1863.460) -- 0:00:52
      37000 -- [-1859.773] (-1862.437) (-1862.405) (-1860.804) * (-1874.605) (-1858.718) (-1869.561) [-1860.619] -- 0:00:52
      37500 -- (-1862.391) (-1860.141) (-1862.202) [-1867.384] * (-1870.053) (-1861.040) [-1868.214] (-1867.969) -- 0:00:51
      38000 -- (-1860.349) (-1858.970) [-1862.736] (-1866.346) * (-1865.540) (-1860.479) [-1867.830] (-1862.084) -- 0:01:15
      38500 -- [-1859.282] (-1860.612) (-1862.020) (-1872.465) * [-1866.175] (-1859.977) (-1874.874) (-1861.241) -- 0:01:14
      39000 -- (-1861.572) (-1859.131) (-1863.379) [-1866.692] * (-1872.932) (-1859.312) [-1859.243] (-1864.616) -- 0:01:13
      39500 -- [-1861.058] (-1860.565) (-1861.919) (-1875.752) * (-1866.798) (-1861.030) (-1859.330) [-1864.856] -- 0:01:12
      40000 -- (-1862.186) (-1859.511) [-1865.428] (-1868.160) * (-1868.819) (-1861.991) (-1859.299) [-1860.699] -- 0:01:12

      Average standard deviation of split frequencies: 0.039847

      40500 -- (-1861.921) (-1859.657) [-1861.309] (-1868.306) * (-1867.347) [-1861.714] (-1869.154) (-1862.024) -- 0:01:11
      41000 -- (-1864.483) (-1859.007) [-1860.356] (-1870.851) * [-1878.824] (-1864.178) (-1869.971) (-1861.186) -- 0:01:10
      41500 -- (-1861.355) (-1863.440) (-1861.623) [-1865.218] * (-1882.084) (-1858.761) (-1865.716) [-1861.161] -- 0:01:09
      42000 -- (-1862.297) (-1859.842) (-1861.623) [-1872.540] * [-1866.502] (-1859.339) (-1863.230) (-1861.489) -- 0:01:08
      42500 -- (-1861.134) (-1861.433) (-1860.580) [-1866.334] * (-1868.501) (-1862.384) (-1863.414) [-1861.114] -- 0:01:07
      43000 -- (-1865.817) [-1860.429] (-1860.024) (-1869.362) * (-1879.150) [-1858.905] (-1865.004) (-1861.615) -- 0:01:06
      43500 -- (-1863.125) [-1859.671] (-1859.872) (-1865.772) * (-1870.534) (-1860.697) (-1865.781) [-1860.160] -- 0:01:05
      44000 -- (-1862.404) (-1860.368) (-1859.308) [-1870.525] * [-1865.294] (-1860.173) (-1862.706) (-1860.761) -- 0:01:05
      44500 -- (-1864.035) [-1861.479] (-1859.295) (-1872.118) * (-1876.719) (-1859.593) [-1861.159] (-1860.242) -- 0:01:04
      45000 -- (-1865.220) (-1862.732) (-1859.416) [-1868.041] * (-1867.684) (-1860.841) (-1860.077) [-1864.804] -- 0:01:03

      Average standard deviation of split frequencies: 0.034331

      45500 -- (-1863.206) (-1866.197) [-1859.583] (-1868.899) * (-1872.607) (-1860.773) (-1860.503) [-1859.752] -- 0:01:02
      46000 -- (-1860.030) (-1862.421) (-1859.187) [-1864.345] * (-1869.328) (-1860.660) [-1859.354] (-1860.339) -- 0:01:02
      46500 -- (-1861.007) (-1860.171) (-1860.409) [-1870.535] * (-1869.404) (-1860.809) [-1859.514] (-1860.336) -- 0:01:01
      47000 -- [-1862.867] (-1864.410) (-1860.401) (-1876.275) * (-1869.707) (-1862.446) (-1859.542) [-1860.706] -- 0:01:00
      47500 -- (-1863.043) [-1859.997] (-1860.228) (-1875.568) * [-1862.227] (-1863.393) (-1862.453) (-1859.638) -- 0:01:00
      48000 -- [-1861.216] (-1860.141) (-1871.929) (-1868.634) * [-1864.559] (-1861.767) (-1862.451) (-1859.334) -- 0:00:59
      48500 -- (-1860.803) [-1860.224] (-1861.377) (-1872.179) * (-1873.358) (-1860.515) (-1859.711) [-1863.337] -- 0:00:58
      49000 -- (-1862.317) (-1862.418) [-1861.388] (-1886.756) * (-1871.984) (-1858.864) [-1863.241] (-1859.529) -- 0:00:58
      49500 -- (-1870.651) (-1859.560) [-1860.550] (-1861.391) * (-1874.679) (-1858.794) (-1866.336) [-1861.342] -- 0:00:57
      50000 -- (-1861.742) [-1859.807] (-1860.363) (-1860.520) * (-1875.629) (-1863.309) (-1861.892) [-1858.834] -- 0:00:57

      Average standard deviation of split frequencies: 0.036699

      50500 -- (-1859.514) (-1859.327) [-1860.321] (-1859.905) * [-1876.649] (-1862.625) (-1861.142) (-1858.875) -- 0:00:56
      51000 -- [-1859.374] (-1859.912) (-1860.240) (-1863.377) * [-1864.835] (-1859.228) (-1861.108) (-1858.994) -- 0:00:55
      51500 -- [-1859.381] (-1860.732) (-1862.365) (-1858.838) * (-1868.402) (-1859.305) (-1861.363) [-1859.851] -- 0:00:55
      52000 -- (-1859.386) [-1863.313] (-1862.136) (-1859.825) * (-1873.777) (-1861.382) [-1861.861] (-1859.894) -- 0:00:54
      52500 -- (-1862.277) (-1861.351) [-1861.378] (-1859.695) * (-1870.453) (-1860.642) (-1861.165) [-1860.290] -- 0:00:54
      53000 -- (-1861.979) [-1858.868] (-1860.176) (-1859.432) * [-1870.769] (-1859.788) (-1862.115) (-1860.129) -- 0:01:11
      53500 -- [-1859.334] (-1860.452) (-1863.211) (-1859.621) * (-1868.214) [-1861.931] (-1861.261) (-1860.248) -- 0:01:10
      54000 -- [-1859.927] (-1860.235) (-1862.820) (-1859.174) * (-1866.204) (-1860.344) (-1860.113) [-1859.830] -- 0:01:10
      54500 -- [-1860.880] (-1863.316) (-1863.365) (-1860.381) * (-1864.632) (-1860.093) (-1861.509) [-1860.455] -- 0:01:09
      55000 -- (-1862.393) (-1862.517) [-1860.608] (-1863.498) * [-1868.622] (-1860.270) (-1865.090) (-1863.003) -- 0:01:08

      Average standard deviation of split frequencies: 0.040219

      55500 -- (-1861.707) [-1863.365] (-1860.864) (-1866.483) * [-1864.689] (-1861.909) (-1862.084) (-1861.521) -- 0:01:08
      56000 -- (-1861.366) (-1861.491) [-1863.334] (-1860.001) * (-1874.582) [-1860.543] (-1860.681) (-1861.521) -- 0:01:07
      56500 -- (-1862.731) (-1860.185) [-1863.285] (-1859.193) * (-1873.424) [-1862.428] (-1861.281) (-1862.949) -- 0:01:06
      57000 -- [-1862.361] (-1862.116) (-1861.328) (-1862.022) * [-1866.392] (-1865.810) (-1860.147) (-1862.362) -- 0:01:06
      57500 -- (-1862.025) (-1862.061) [-1860.621] (-1864.541) * (-1868.438) [-1860.578] (-1863.156) (-1863.521) -- 0:01:05
      58000 -- (-1862.005) (-1861.111) [-1861.661] (-1863.021) * (-1868.792) (-1861.366) [-1859.780] (-1862.020) -- 0:01:04
      58500 -- [-1860.552] (-1860.828) (-1860.468) (-1862.826) * (-1871.331) (-1862.238) (-1860.253) [-1859.610] -- 0:01:04
      59000 -- (-1860.218) [-1860.242] (-1860.514) (-1863.744) * (-1865.710) [-1861.609] (-1862.726) (-1865.044) -- 0:01:03
      59500 -- (-1860.976) (-1860.388) (-1859.607) [-1864.242] * (-1867.891) (-1862.710) [-1860.582] (-1862.308) -- 0:01:03
      60000 -- (-1860.411) (-1862.619) [-1859.218] (-1861.156) * (-1869.631) [-1862.571] (-1863.098) (-1861.556) -- 0:01:02

      Average standard deviation of split frequencies: 0.036807

      60500 -- (-1862.228) [-1862.244] (-1859.149) (-1860.289) * (-1871.230) [-1863.763] (-1862.213) (-1860.468) -- 0:01:02
      61000 -- (-1866.712) [-1863.642] (-1860.287) (-1862.552) * [-1868.966] (-1862.268) (-1860.046) (-1862.656) -- 0:01:01
      61500 -- [-1860.600] (-1862.983) (-1860.635) (-1861.905) * [-1867.897] (-1859.852) (-1860.257) (-1864.121) -- 0:01:01
      62000 -- (-1859.503) (-1862.940) (-1863.292) [-1861.991] * (-1872.472) (-1859.035) (-1862.592) [-1861.333] -- 0:01:00
      62500 -- [-1859.757] (-1861.359) (-1862.516) (-1858.726) * (-1875.511) [-1859.339] (-1862.592) (-1859.983) -- 0:01:00
      63000 -- (-1862.492) (-1861.631) (-1859.505) [-1864.057] * (-1871.921) (-1860.069) (-1862.928) [-1859.856] -- 0:00:59
      63500 -- (-1862.360) (-1860.498) (-1861.151) [-1863.730] * (-1864.369) [-1858.731] (-1866.935) (-1860.687) -- 0:00:58
      64000 -- (-1861.415) (-1859.307) (-1866.549) [-1863.203] * (-1874.191) [-1859.429] (-1860.381) (-1860.659) -- 0:00:58
      64500 -- (-1859.405) [-1862.061] (-1859.780) (-1863.932) * (-1867.055) [-1861.510] (-1859.654) (-1859.620) -- 0:00:58
      65000 -- (-1859.415) (-1860.127) (-1859.643) [-1866.691] * (-1875.388) [-1861.277] (-1859.597) (-1859.956) -- 0:00:57

      Average standard deviation of split frequencies: 0.036088

      65500 -- (-1859.997) (-1862.632) (-1859.239) [-1861.639] * (-1865.596) (-1859.965) (-1859.617) [-1860.342] -- 0:00:57
      66000 -- (-1861.119) (-1864.223) [-1860.442] (-1861.609) * (-1874.897) [-1859.250] (-1860.680) (-1859.274) -- 0:00:56
      66500 -- (-1860.961) (-1861.137) [-1865.893] (-1859.687) * [-1870.693] (-1859.196) (-1862.478) (-1859.321) -- 0:00:56
      67000 -- (-1860.943) (-1860.889) [-1859.261] (-1859.741) * (-1868.317) (-1859.581) (-1864.799) [-1861.783] -- 0:00:55
      67500 -- (-1862.567) (-1862.547) (-1859.793) [-1864.803] * (-1872.753) (-1861.328) [-1859.665] (-1864.563) -- 0:00:55
      68000 -- [-1859.801] (-1861.066) (-1859.891) (-1863.352) * [-1871.315] (-1862.179) (-1859.662) (-1865.548) -- 0:01:08
      68500 -- [-1859.199] (-1858.932) (-1859.665) (-1859.431) * [-1865.334] (-1860.244) (-1859.296) (-1863.967) -- 0:01:07
      69000 -- (-1860.173) (-1860.537) (-1860.222) [-1859.969] * [-1868.503] (-1860.131) (-1862.470) (-1861.540) -- 0:01:07
      69500 -- (-1860.168) (-1860.216) (-1858.944) [-1859.960] * [-1869.075] (-1859.585) (-1860.147) (-1861.820) -- 0:01:06
      70000 -- [-1859.320] (-1859.949) (-1859.657) (-1859.686) * (-1868.687) (-1859.998) [-1860.914] (-1862.061) -- 0:01:06

      Average standard deviation of split frequencies: 0.037918

      70500 -- (-1859.636) (-1861.938) [-1861.001] (-1861.641) * (-1871.143) (-1860.234) (-1865.553) [-1861.404] -- 0:01:05
      71000 -- (-1859.963) [-1860.747] (-1860.867) (-1861.454) * [-1865.363] (-1859.950) (-1865.139) (-1861.372) -- 0:01:05
      71500 -- (-1861.961) (-1861.127) [-1859.113] (-1863.852) * (-1874.799) (-1859.901) (-1862.200) [-1860.527] -- 0:01:04
      72000 -- (-1861.529) (-1864.706) [-1860.285] (-1860.731) * (-1868.009) [-1859.469] (-1862.291) (-1861.563) -- 0:01:04
      72500 -- (-1860.615) [-1860.739] (-1861.775) (-1861.900) * (-1862.762) [-1859.084] (-1866.890) (-1862.789) -- 0:01:03
      73000 -- (-1860.148) (-1862.102) (-1859.244) [-1861.906] * (-1876.799) [-1859.741] (-1863.847) (-1859.948) -- 0:01:03
      73500 -- (-1864.095) [-1862.209] (-1860.250) (-1861.709) * (-1869.167) (-1861.387) [-1859.848] (-1862.831) -- 0:01:03
      74000 -- (-1860.777) [-1861.016] (-1858.674) (-1861.627) * [-1865.457] (-1858.901) (-1860.567) (-1861.597) -- 0:01:02
      74500 -- (-1862.556) (-1861.925) (-1858.913) [-1860.732] * [-1875.342] (-1858.901) (-1861.247) (-1862.436) -- 0:01:02
      75000 -- (-1861.438) (-1860.315) (-1858.865) [-1860.974] * (-1873.986) (-1859.853) [-1860.995] (-1863.288) -- 0:01:01

      Average standard deviation of split frequencies: 0.035355

      75500 -- (-1860.202) [-1858.843] (-1860.358) (-1860.974) * (-1859.643) [-1859.037] (-1859.618) (-1863.575) -- 0:01:01
      76000 -- (-1864.770) (-1858.622) [-1859.980] (-1865.260) * (-1860.747) (-1859.971) (-1859.652) [-1862.399] -- 0:01:00
      76500 -- (-1863.561) (-1859.861) (-1861.376) [-1863.158] * (-1861.678) [-1859.730] (-1859.514) (-1863.287) -- 0:01:00
      77000 -- (-1862.172) (-1859.808) [-1859.540] (-1864.177) * [-1859.665] (-1861.093) (-1860.270) (-1859.188) -- 0:00:59
      77500 -- (-1860.249) (-1858.830) [-1859.691] (-1861.771) * (-1861.032) (-1860.813) [-1861.287] (-1859.795) -- 0:00:59
      78000 -- (-1859.846) (-1861.253) (-1863.313) [-1861.764] * (-1860.951) (-1859.381) [-1864.888] (-1860.755) -- 0:00:59
      78500 -- [-1859.791] (-1860.013) (-1861.577) (-1862.677) * [-1860.323] (-1859.839) (-1865.847) (-1859.176) -- 0:00:58
      79000 -- (-1858.929) [-1860.056] (-1862.563) (-1862.654) * (-1861.095) (-1862.486) (-1861.585) [-1858.884] -- 0:00:58
      79500 -- (-1859.047) [-1860.029] (-1860.654) (-1860.727) * (-1859.446) (-1862.129) [-1861.151] (-1858.972) -- 0:00:57
      80000 -- (-1861.497) (-1860.174) [-1860.654] (-1860.473) * (-1859.005) (-1862.365) (-1860.476) [-1861.182] -- 0:00:57

      Average standard deviation of split frequencies: 0.031987

      80500 -- (-1860.889) (-1859.281) (-1861.479) [-1859.617] * (-1859.201) [-1861.799] (-1864.529) (-1860.479) -- 0:00:57
      81000 -- [-1860.408] (-1859.727) (-1864.632) (-1859.191) * (-1866.396) (-1860.048) (-1862.726) [-1860.283] -- 0:00:56
      81500 -- [-1858.994] (-1860.210) (-1861.627) (-1859.286) * [-1860.317] (-1859.336) (-1864.078) (-1860.699) -- 0:00:56
      82000 -- (-1860.043) [-1859.328] (-1861.697) (-1858.797) * (-1859.053) (-1859.066) [-1861.551] (-1858.687) -- 0:00:55
      82500 -- [-1860.500] (-1860.145) (-1862.425) (-1860.735) * [-1861.345] (-1860.562) (-1867.168) (-1861.428) -- 0:00:55
      83000 -- [-1861.632] (-1860.705) (-1862.185) (-1862.370) * (-1861.702) (-1862.099) [-1863.502] (-1864.365) -- 0:01:06
      83500 -- (-1862.299) [-1862.129] (-1866.263) (-1860.648) * (-1860.122) [-1861.043] (-1861.896) (-1863.357) -- 0:01:05
      84000 -- (-1864.625) (-1858.939) (-1863.526) [-1860.062] * (-1860.404) (-1860.329) (-1859.923) [-1859.392] -- 0:01:05
      84500 -- (-1861.946) (-1859.328) (-1860.327) [-1860.656] * (-1860.976) (-1860.457) [-1860.272] (-1859.891) -- 0:01:05
      85000 -- (-1863.055) [-1858.857] (-1860.499) (-1858.548) * (-1859.534) (-1861.010) (-1860.250) [-1860.005] -- 0:01:04

      Average standard deviation of split frequencies: 0.033163

      85500 -- (-1862.827) [-1859.306] (-1860.492) (-1860.223) * (-1859.844) (-1860.525) [-1860.641] (-1859.770) -- 0:01:04
      86000 -- (-1860.578) [-1861.124] (-1860.070) (-1861.617) * [-1860.780] (-1865.482) (-1859.482) (-1860.358) -- 0:01:03
      86500 -- [-1862.117] (-1859.128) (-1860.864) (-1860.319) * (-1859.100) (-1863.419) [-1860.129] (-1861.986) -- 0:01:03
      87000 -- [-1862.117] (-1863.144) (-1861.282) (-1859.991) * (-1860.361) [-1861.806] (-1861.308) (-1859.735) -- 0:01:02
      87500 -- [-1866.106] (-1861.657) (-1863.048) (-1859.989) * [-1860.838] (-1862.586) (-1859.220) (-1861.522) -- 0:01:02
      88000 -- (-1864.841) (-1861.110) [-1860.348] (-1859.359) * (-1860.286) (-1862.606) [-1858.624] (-1862.383) -- 0:01:02
      88500 -- (-1865.274) (-1859.256) [-1860.401] (-1858.683) * (-1860.316) [-1861.501] (-1859.632) (-1859.906) -- 0:01:01
      89000 -- (-1861.396) (-1860.380) [-1860.978] (-1859.193) * [-1860.915] (-1861.681) (-1862.267) (-1862.104) -- 0:01:01
      89500 -- [-1860.943] (-1860.354) (-1860.124) (-1863.328) * [-1861.134] (-1861.032) (-1863.376) (-1861.337) -- 0:01:01
      90000 -- (-1861.000) (-1860.266) [-1859.139] (-1859.019) * (-1861.694) [-1862.396] (-1860.261) (-1859.196) -- 0:01:00

      Average standard deviation of split frequencies: 0.030948

      90500 -- (-1860.961) (-1860.622) [-1860.125] (-1859.278) * (-1862.222) [-1860.053] (-1859.199) (-1859.304) -- 0:01:00
      91000 -- [-1860.806] (-1860.896) (-1859.552) (-1859.511) * (-1861.527) (-1861.526) [-1861.287] (-1860.360) -- 0:00:59
      91500 -- (-1861.103) (-1865.977) [-1859.280] (-1862.658) * (-1861.850) (-1860.450) [-1859.674] (-1860.151) -- 0:00:59
      92000 -- (-1862.448) [-1861.084] (-1859.796) (-1863.768) * (-1862.360) (-1863.758) [-1861.085] (-1859.976) -- 0:00:59
      92500 -- (-1866.174) (-1859.799) (-1859.795) [-1864.135] * [-1861.473] (-1860.956) (-1859.870) (-1864.394) -- 0:00:58
      93000 -- (-1863.372) (-1861.046) [-1861.455] (-1859.623) * [-1861.176] (-1860.667) (-1861.210) (-1866.405) -- 0:00:58
      93500 -- (-1861.217) (-1860.469) (-1861.179) [-1859.467] * (-1861.905) [-1861.725] (-1860.702) (-1867.680) -- 0:00:58
      94000 -- (-1864.403) (-1860.982) [-1860.266] (-1865.953) * (-1863.422) (-1861.784) (-1860.235) [-1859.318] -- 0:00:57
      94500 -- (-1863.102) (-1859.982) (-1859.975) [-1860.487] * (-1860.931) [-1859.990] (-1863.365) (-1860.915) -- 0:00:57
      95000 -- (-1860.973) [-1860.764] (-1860.792) (-1862.672) * (-1860.147) (-1860.376) (-1859.627) [-1863.383] -- 0:00:57

      Average standard deviation of split frequencies: 0.029463

      95500 -- [-1860.834] (-1860.190) (-1860.070) (-1863.168) * [-1860.194] (-1860.511) (-1859.004) (-1863.606) -- 0:00:56
      96000 -- (-1861.195) (-1862.950) (-1861.223) [-1859.114] * (-1860.127) [-1859.724] (-1861.101) (-1867.351) -- 0:00:56
      96500 -- (-1863.368) (-1859.897) (-1862.638) [-1859.289] * [-1859.734] (-1859.587) (-1860.941) (-1861.650) -- 0:00:56
      97000 -- [-1859.751] (-1859.956) (-1861.076) (-1863.673) * (-1859.886) (-1859.501) (-1861.050) [-1861.797] -- 0:00:55
      97500 -- (-1859.849) (-1861.621) (-1863.605) [-1862.933] * [-1862.103] (-1860.494) (-1863.435) (-1864.710) -- 0:00:55
      98000 -- [-1859.264] (-1865.932) (-1862.309) (-1860.815) * [-1862.379] (-1861.329) (-1863.137) (-1864.741) -- 0:00:55
      98500 -- [-1861.102] (-1861.611) (-1860.650) (-1861.806) * (-1861.845) (-1862.043) [-1864.105] (-1860.807) -- 0:01:04
      99000 -- (-1863.834) (-1866.323) [-1860.974] (-1861.567) * (-1862.221) (-1860.453) (-1861.369) [-1862.835] -- 0:01:03
      99500 -- (-1863.672) (-1861.951) [-1860.280] (-1859.900) * (-1865.894) [-1863.667] (-1861.107) (-1860.144) -- 0:01:03
      100000 -- (-1860.221) [-1860.086] (-1862.111) (-1859.448) * (-1861.058) (-1865.502) [-1864.823] (-1860.273) -- 0:01:02

      Average standard deviation of split frequencies: 0.029822

      100500 -- (-1859.901) (-1859.923) [-1860.165] (-1859.288) * (-1860.162) [-1862.474] (-1861.975) (-1860.703) -- 0:01:02
      101000 -- (-1862.554) [-1860.404] (-1861.175) (-1859.613) * (-1859.208) (-1863.290) [-1862.148] (-1863.255) -- 0:01:02
      101500 -- (-1864.032) (-1860.503) [-1860.544] (-1861.951) * (-1861.145) (-1861.978) (-1860.826) [-1860.798] -- 0:01:01
      102000 -- (-1861.343) (-1860.506) [-1860.589] (-1861.708) * (-1861.200) [-1862.517] (-1860.135) (-1860.066) -- 0:01:01
      102500 -- (-1859.305) [-1859.513] (-1860.589) (-1862.419) * (-1860.976) (-1860.114) [-1862.892] (-1859.365) -- 0:01:01
      103000 -- (-1859.421) (-1860.330) (-1861.759) [-1864.353] * (-1861.836) (-1862.386) [-1866.253] (-1858.931) -- 0:01:00
      103500 -- (-1858.736) [-1860.531] (-1865.784) (-1862.239) * (-1860.780) (-1861.760) (-1864.144) [-1858.676] -- 0:01:00
      104000 -- (-1859.293) (-1862.982) (-1863.856) [-1859.519] * [-1860.603] (-1864.451) (-1863.808) (-1860.372) -- 0:01:00
      104500 -- (-1861.088) (-1862.137) (-1862.320) [-1861.111] * (-1862.702) (-1861.793) (-1863.334) [-1860.249] -- 0:00:59
      105000 -- [-1861.733] (-1860.639) (-1863.125) (-1860.206) * (-1861.004) (-1864.744) (-1860.308) [-1858.927] -- 0:00:59

      Average standard deviation of split frequencies: 0.028556

      105500 -- (-1860.261) (-1861.765) (-1860.559) [-1859.515] * (-1860.320) [-1863.184] (-1861.030) (-1863.850) -- 0:00:59
      106000 -- (-1859.984) (-1862.883) (-1860.192) [-1858.664] * [-1860.383] (-1860.459) (-1860.611) (-1862.659) -- 0:00:59
      106500 -- [-1861.001] (-1859.283) (-1860.195) (-1859.965) * (-1860.451) [-1860.060] (-1868.007) (-1864.952) -- 0:00:58
      107000 -- (-1861.315) (-1862.677) [-1863.877] (-1859.866) * (-1860.129) (-1860.038) (-1862.961) [-1860.014] -- 0:00:58
      107500 -- (-1862.508) (-1861.989) (-1862.999) [-1859.276] * (-1861.416) [-1861.058] (-1860.518) (-1859.041) -- 0:00:58
      108000 -- (-1866.269) (-1860.235) (-1863.397) [-1858.927] * (-1860.995) (-1861.051) [-1862.235] (-1858.755) -- 0:00:57
      108500 -- (-1865.947) (-1860.092) (-1863.385) [-1859.741] * [-1861.157] (-1861.752) (-1864.627) (-1869.768) -- 0:00:57
      109000 -- [-1865.781] (-1860.092) (-1863.569) (-1862.253) * (-1860.566) (-1863.176) (-1864.626) [-1864.807] -- 0:00:57
      109500 -- (-1860.766) (-1859.601) [-1863.945] (-1863.334) * [-1860.404] (-1860.013) (-1861.695) (-1861.189) -- 0:00:56
      110000 -- (-1860.258) (-1867.424) (-1861.334) [-1861.014] * (-1859.907) (-1860.157) (-1859.635) [-1859.108] -- 0:00:56

      Average standard deviation of split frequencies: 0.027925

      110500 -- [-1860.939] (-1861.455) (-1866.172) (-1860.173) * (-1861.547) (-1860.281) (-1860.475) [-1864.199] -- 0:00:56
      111000 -- [-1863.287] (-1863.309) (-1866.780) (-1860.949) * (-1863.124) [-1860.829] (-1861.681) (-1859.714) -- 0:00:56
      111500 -- (-1859.641) [-1862.024] (-1860.091) (-1860.167) * (-1863.666) (-1860.008) (-1861.930) [-1861.714] -- 0:00:55
      112000 -- (-1861.091) [-1863.010] (-1860.428) (-1858.811) * (-1860.776) (-1862.571) (-1860.040) [-1862.485] -- 0:00:55
      112500 -- (-1861.980) [-1859.380] (-1860.237) (-1860.852) * (-1860.243) [-1864.624] (-1864.664) (-1859.378) -- 0:00:55
      113000 -- (-1861.248) [-1859.333] (-1860.384) (-1870.305) * (-1861.284) (-1862.283) (-1863.352) [-1859.964] -- 0:00:54
      113500 -- (-1860.018) (-1860.876) (-1864.114) [-1859.481] * (-1863.864) [-1860.256] (-1860.100) (-1861.387) -- 0:01:02
      114000 -- [-1859.193] (-1862.776) (-1862.404) (-1858.954) * (-1862.046) (-1859.471) [-1860.625] (-1862.022) -- 0:01:02
      114500 -- [-1859.159] (-1863.438) (-1863.809) (-1858.597) * (-1862.047) (-1860.756) (-1859.681) [-1862.125] -- 0:01:01
      115000 -- [-1861.751] (-1862.218) (-1862.161) (-1858.596) * [-1859.971] (-1861.312) (-1861.723) (-1862.495) -- 0:01:01

      Average standard deviation of split frequencies: 0.029944

      115500 -- (-1860.897) (-1859.247) (-1861.452) [-1859.279] * (-1859.939) (-1859.074) (-1859.640) [-1861.733] -- 0:01:01
      116000 -- (-1861.284) [-1859.035] (-1861.101) (-1859.832) * (-1860.454) (-1859.310) [-1860.429] (-1862.526) -- 0:01:00
      116500 -- (-1860.364) (-1859.747) (-1861.851) [-1861.762] * (-1860.887) (-1861.151) [-1861.639] (-1863.388) -- 0:01:00
      117000 -- (-1861.007) (-1859.747) [-1861.430] (-1860.955) * (-1860.415) (-1863.635) (-1861.283) [-1863.363] -- 0:01:00
      117500 -- [-1860.210] (-1861.067) (-1860.070) (-1860.350) * (-1860.130) (-1859.263) [-1860.515] (-1863.519) -- 0:01:00
      118000 -- (-1860.411) (-1860.833) [-1860.658] (-1859.799) * (-1860.005) (-1859.705) (-1861.301) [-1859.835] -- 0:00:59
      118500 -- [-1860.353] (-1866.844) (-1859.428) (-1859.784) * (-1860.158) (-1860.759) [-1860.199] (-1860.989) -- 0:00:59
      119000 -- (-1861.046) (-1870.610) (-1860.626) [-1862.901] * [-1864.402] (-1861.070) (-1861.860) (-1863.287) -- 0:00:59
      119500 -- [-1865.110] (-1861.284) (-1864.156) (-1864.564) * (-1863.104) [-1859.452] (-1865.262) (-1862.226) -- 0:00:58
      120000 -- [-1862.102] (-1859.183) (-1863.182) (-1862.771) * (-1861.025) (-1861.251) (-1861.804) [-1859.476] -- 0:00:58

      Average standard deviation of split frequencies: 0.032281

      120500 -- (-1860.536) (-1861.370) [-1862.032] (-1860.111) * (-1860.592) (-1862.372) (-1861.398) [-1860.915] -- 0:00:58
      121000 -- [-1860.603] (-1868.617) (-1861.141) (-1859.844) * (-1861.965) (-1860.282) (-1860.685) [-1858.791] -- 0:00:58
      121500 -- (-1859.930) (-1867.554) [-1859.967] (-1859.148) * [-1861.169] (-1862.386) (-1861.156) (-1859.889) -- 0:00:57
      122000 -- (-1861.290) (-1861.535) [-1861.358] (-1859.153) * (-1863.031) (-1863.091) [-1860.403] (-1860.222) -- 0:00:57
      122500 -- [-1860.771] (-1861.534) (-1861.414) (-1860.595) * (-1860.957) (-1863.186) (-1863.622) [-1859.062] -- 0:00:57
      123000 -- (-1861.573) (-1861.405) (-1860.367) [-1860.126] * (-1860.184) (-1859.871) [-1861.476] (-1858.703) -- 0:00:57
      123500 -- (-1863.361) (-1861.452) [-1859.951] (-1859.700) * (-1860.526) (-1859.438) [-1860.291] (-1862.235) -- 0:00:56
      124000 -- (-1861.886) (-1862.583) (-1859.792) [-1859.727] * (-1860.527) [-1861.545] (-1860.243) (-1862.277) -- 0:00:56
      124500 -- (-1861.583) [-1859.755] (-1860.077) (-1860.895) * [-1860.938] (-1862.014) (-1860.472) (-1861.064) -- 0:00:56
      125000 -- (-1861.892) (-1861.134) (-1862.542) [-1860.675] * (-1859.349) (-1863.296) [-1861.089] (-1860.307) -- 0:00:56

      Average standard deviation of split frequencies: 0.031240

      125500 -- (-1861.864) (-1861.831) (-1864.251) [-1859.581] * (-1866.248) [-1862.321] (-1861.631) (-1862.726) -- 0:00:55
      126000 -- (-1861.630) [-1860.721] (-1862.006) (-1860.543) * (-1863.848) [-1862.132] (-1861.607) (-1861.581) -- 0:00:55
      126500 -- [-1863.213] (-1860.452) (-1864.530) (-1862.073) * [-1860.208] (-1861.443) (-1860.236) (-1862.373) -- 0:00:55
      127000 -- (-1862.897) [-1860.857] (-1861.263) (-1859.464) * (-1861.552) (-1866.549) [-1861.244] (-1860.151) -- 0:00:54
      127500 -- (-1861.783) (-1860.176) [-1859.406] (-1861.108) * (-1859.830) (-1866.760) (-1859.809) [-1860.018] -- 0:00:54
      128000 -- (-1860.676) [-1860.117] (-1859.582) (-1863.151) * (-1859.174) [-1865.063] (-1860.479) (-1859.742) -- 0:00:54
      128500 -- (-1863.571) (-1860.442) (-1859.309) [-1859.268] * (-1861.723) [-1862.084] (-1865.393) (-1860.625) -- 0:01:01
      129000 -- (-1860.829) (-1860.358) (-1859.679) [-1859.335] * (-1861.629) (-1862.415) [-1863.599] (-1859.540) -- 0:01:00
      129500 -- [-1860.446] (-1861.484) (-1860.370) (-1859.584) * (-1859.940) (-1862.376) (-1861.641) [-1859.714] -- 0:01:00
      130000 -- [-1861.811] (-1860.972) (-1861.314) (-1861.601) * (-1859.397) (-1864.618) [-1862.165] (-1861.204) -- 0:01:00

      Average standard deviation of split frequencies: 0.031140

      130500 -- (-1862.530) (-1860.972) (-1860.013) [-1859.723] * [-1860.310] (-1862.493) (-1862.911) (-1862.545) -- 0:00:59
      131000 -- (-1861.913) (-1860.829) [-1860.318] (-1859.876) * (-1860.561) (-1860.510) (-1862.153) [-1860.491] -- 0:00:59
      131500 -- (-1862.898) (-1860.770) (-1860.229) [-1859.978] * (-1859.143) (-1860.351) [-1861.855] (-1861.748) -- 0:00:59
      132000 -- (-1861.891) [-1860.835] (-1860.279) (-1859.904) * (-1862.663) (-1858.959) (-1859.373) [-1861.909] -- 0:00:59
      132500 -- (-1863.750) (-1860.033) (-1860.187) [-1863.468] * (-1862.128) [-1860.395] (-1859.210) (-1859.461) -- 0:00:58
      133000 -- [-1861.470] (-1861.185) (-1863.517) (-1860.176) * (-1860.179) [-1862.607] (-1860.307) (-1864.337) -- 0:00:58
      133500 -- [-1860.379] (-1859.152) (-1860.494) (-1861.660) * (-1861.678) (-1863.243) [-1860.191] (-1861.494) -- 0:00:58
      134000 -- [-1862.726] (-1861.927) (-1860.751) (-1859.077) * (-1858.888) (-1861.131) [-1859.702] (-1864.874) -- 0:00:58
      134500 -- (-1862.327) (-1861.929) [-1862.828] (-1859.411) * (-1861.496) (-1860.993) (-1861.260) [-1859.903] -- 0:00:57
      135000 -- (-1861.428) (-1861.683) (-1861.949) [-1859.444] * [-1859.679] (-1863.738) (-1862.034) (-1860.393) -- 0:00:57

      Average standard deviation of split frequencies: 0.030831

      135500 -- (-1859.637) (-1860.130) (-1862.510) [-1859.680] * (-1861.405) (-1860.114) (-1862.139) [-1859.662] -- 0:00:57
      136000 -- (-1860.194) [-1862.782] (-1862.416) (-1860.227) * (-1864.518) [-1859.937] (-1863.914) (-1858.725) -- 0:00:57
      136500 -- (-1860.134) [-1859.692] (-1866.822) (-1861.924) * (-1860.786) [-1860.073] (-1861.177) (-1859.959) -- 0:00:56
      137000 -- (-1860.659) (-1859.512) (-1861.322) [-1859.648] * (-1860.436) (-1862.325) (-1858.883) [-1858.713] -- 0:00:56
      137500 -- (-1860.670) (-1859.503) (-1861.885) [-1860.481] * (-1861.495) (-1862.185) [-1859.454] (-1858.713) -- 0:00:56
      138000 -- (-1862.186) (-1860.299) (-1861.614) [-1862.668] * (-1861.305) (-1861.441) (-1860.194) [-1860.390] -- 0:00:56
      138500 -- [-1861.170] (-1860.135) (-1860.976) (-1859.342) * (-1861.909) (-1859.916) [-1860.947] (-1859.380) -- 0:00:55
      139000 -- (-1860.937) (-1860.811) [-1859.271] (-1860.258) * [-1861.405] (-1858.823) (-1859.966) (-1862.527) -- 0:00:55
      139500 -- (-1861.507) (-1860.192) (-1862.512) [-1860.269] * (-1861.141) (-1858.781) [-1859.907] (-1861.116) -- 0:00:55
      140000 -- [-1862.814] (-1860.108) (-1861.178) (-1860.163) * [-1861.696] (-1860.594) (-1859.974) (-1860.884) -- 0:00:55

      Average standard deviation of split frequencies: 0.028485

      140500 -- (-1860.095) [-1861.076] (-1863.055) (-1859.363) * (-1860.292) [-1860.229] (-1861.918) (-1861.667) -- 0:00:55
      141000 -- (-1861.701) (-1860.560) [-1863.217] (-1859.363) * (-1859.965) (-1864.200) (-1862.567) [-1862.553] -- 0:00:54
      141500 -- (-1861.841) (-1863.759) (-1861.584) [-1859.532] * (-1860.142) (-1861.006) [-1861.137] (-1860.620) -- 0:00:54
      142000 -- (-1861.312) (-1862.968) (-1858.746) [-1859.286] * [-1859.951] (-1861.163) (-1863.194) (-1866.687) -- 0:00:54
      142500 -- (-1859.818) (-1862.852) (-1858.479) [-1859.201] * (-1859.647) (-1861.832) [-1861.482] (-1865.422) -- 0:00:54
      143000 -- (-1860.288) [-1859.159] (-1858.439) (-1861.275) * [-1860.124] (-1861.609) (-1862.184) (-1860.987) -- 0:00:53
      143500 -- (-1860.269) [-1861.762] (-1859.524) (-1861.705) * (-1859.477) [-1861.021] (-1859.911) (-1860.307) -- 0:00:59
      144000 -- (-1862.656) (-1860.619) (-1859.526) [-1859.491] * (-1865.611) (-1861.852) (-1859.859) [-1860.237] -- 0:00:59
      144500 -- (-1861.018) [-1861.473] (-1859.161) (-1860.631) * (-1863.721) (-1860.509) [-1859.651] (-1861.238) -- 0:00:59
      145000 -- [-1860.253] (-1859.650) (-1860.055) (-1862.196) * [-1861.820] (-1861.086) (-1860.463) (-1860.360) -- 0:00:58

      Average standard deviation of split frequencies: 0.027870

      145500 -- [-1862.205] (-1861.696) (-1859.940) (-1864.066) * (-1861.697) (-1860.899) [-1859.768] (-1862.843) -- 0:00:58
      146000 -- (-1860.710) (-1860.740) [-1859.577] (-1862.456) * (-1862.664) [-1858.956] (-1860.828) (-1861.146) -- 0:00:58
      146500 -- [-1861.490] (-1860.524) (-1860.524) (-1859.693) * (-1861.443) [-1859.034] (-1861.495) (-1861.254) -- 0:00:58
      147000 -- [-1861.277] (-1861.621) (-1862.453) (-1861.150) * (-1861.174) (-1859.329) [-1861.295] (-1862.206) -- 0:00:58
      147500 -- (-1862.877) (-1862.467) (-1861.506) [-1860.452] * (-1860.729) (-1861.023) [-1860.428] (-1860.374) -- 0:00:57
      148000 -- [-1860.345] (-1862.170) (-1863.720) (-1860.584) * (-1861.486) [-1859.533] (-1861.183) (-1859.590) -- 0:00:57
      148500 -- (-1860.153) [-1860.908] (-1861.344) (-1862.035) * (-1863.269) (-1859.272) [-1860.138] (-1859.247) -- 0:00:57
      149000 -- (-1862.025) (-1861.807) (-1861.240) [-1860.236] * (-1863.408) (-1859.175) (-1859.469) [-1859.549] -- 0:00:57
      149500 -- (-1862.065) (-1860.951) [-1862.681] (-1859.446) * (-1861.380) (-1859.730) [-1859.645] (-1859.892) -- 0:00:56
      150000 -- (-1863.418) (-1861.798) (-1862.783) [-1859.537] * (-1863.297) (-1859.730) (-1860.187) [-1859.619] -- 0:00:56

      Average standard deviation of split frequencies: 0.029028

      150500 -- (-1865.136) (-1860.392) (-1865.224) [-1862.782] * (-1860.044) (-1859.993) (-1859.499) [-1859.452] -- 0:00:56
      151000 -- (-1859.894) (-1861.551) (-1862.775) [-1861.854] * (-1860.190) (-1859.143) [-1859.183] (-1859.510) -- 0:00:56
      151500 -- [-1862.144] (-1859.354) (-1864.721) (-1860.833) * (-1859.648) (-1861.507) (-1859.901) [-1861.162] -- 0:00:56
      152000 -- [-1861.747] (-1860.574) (-1864.260) (-1860.504) * (-1863.886) [-1861.677] (-1861.266) (-1861.878) -- 0:00:55
      152500 -- (-1861.491) (-1863.769) [-1861.353] (-1860.073) * (-1860.955) (-1863.475) [-1861.542] (-1861.709) -- 0:00:55
      153000 -- [-1860.092] (-1865.873) (-1859.448) (-1860.673) * [-1860.995] (-1860.393) (-1863.187) (-1861.529) -- 0:00:55
      153500 -- (-1861.064) (-1867.536) [-1859.530] (-1863.074) * (-1859.191) [-1859.943] (-1860.686) (-1861.769) -- 0:00:55
      154000 -- (-1860.488) (-1862.609) (-1861.225) [-1860.710] * (-1859.258) [-1859.906] (-1860.011) (-1860.875) -- 0:00:54
      154500 -- (-1861.012) (-1863.179) [-1861.849] (-1861.468) * (-1859.645) [-1859.149] (-1860.084) (-1861.665) -- 0:00:54
      155000 -- [-1862.909] (-1862.500) (-1861.137) (-1864.010) * (-1860.567) (-1859.714) (-1861.233) [-1864.082] -- 0:00:54

      Average standard deviation of split frequencies: 0.028372

      155500 -- [-1863.505] (-1863.278) (-1860.607) (-1861.643) * (-1862.897) [-1861.027] (-1861.571) (-1864.326) -- 0:00:54
      156000 -- (-1865.898) [-1863.629] (-1859.244) (-1861.614) * (-1863.297) [-1858.724] (-1862.269) (-1862.792) -- 0:00:54
      156500 -- (-1871.206) [-1859.847] (-1859.361) (-1865.515) * (-1863.352) [-1858.724] (-1860.417) (-1860.682) -- 0:00:53
      157000 -- (-1861.309) (-1860.719) (-1859.381) [-1864.336] * (-1862.785) (-1858.574) [-1861.293] (-1860.286) -- 0:00:53
      157500 -- (-1860.437) [-1861.656] (-1859.298) (-1860.220) * (-1861.194) [-1858.579] (-1860.159) (-1859.935) -- 0:00:53
      158000 -- (-1861.826) [-1860.917] (-1860.713) (-1859.423) * (-1860.691) (-1858.562) (-1859.920) [-1859.286] -- 0:00:58
      158500 -- (-1859.671) (-1861.385) (-1859.276) [-1859.584] * (-1860.745) (-1858.882) [-1862.639] (-1858.965) -- 0:00:58
      159000 -- (-1861.829) (-1861.629) (-1859.200) [-1859.850] * (-1862.434) [-1859.263] (-1859.344) (-1862.273) -- 0:00:58
      159500 -- (-1861.676) (-1861.208) [-1859.007] (-1861.963) * (-1860.886) [-1859.949] (-1859.741) (-1865.032) -- 0:00:57
      160000 -- (-1860.566) [-1860.980] (-1860.352) (-1859.414) * (-1864.918) [-1859.993] (-1860.080) (-1867.589) -- 0:00:57

      Average standard deviation of split frequencies: 0.026895

      160500 -- (-1860.566) (-1861.103) [-1860.970] (-1859.390) * (-1862.327) (-1861.550) (-1865.711) [-1861.131] -- 0:00:57
      161000 -- (-1862.008) [-1860.516] (-1862.389) (-1860.027) * (-1862.364) [-1861.590] (-1860.380) (-1861.139) -- 0:00:57
      161500 -- (-1860.505) [-1860.524] (-1861.776) (-1860.677) * (-1859.116) [-1860.713] (-1860.940) (-1862.717) -- 0:00:57
      162000 -- [-1862.168] (-1861.492) (-1859.622) (-1860.677) * [-1860.315] (-1859.341) (-1860.233) (-1862.581) -- 0:00:56
      162500 -- (-1862.243) (-1861.565) [-1859.337] (-1861.409) * (-1862.121) (-1860.993) (-1862.221) [-1860.293] -- 0:00:56
      163000 -- (-1863.157) (-1861.859) (-1859.341) [-1859.000] * (-1861.478) [-1862.752] (-1860.705) (-1861.987) -- 0:00:56
      163500 -- (-1859.171) (-1861.526) [-1860.668] (-1858.838) * [-1862.027] (-1861.520) (-1860.353) (-1860.755) -- 0:00:56
      164000 -- (-1864.203) [-1860.473] (-1861.105) (-1865.388) * (-1863.125) [-1861.968] (-1861.027) (-1860.931) -- 0:00:56
      164500 -- [-1860.006] (-1860.505) (-1861.340) (-1867.361) * (-1861.373) (-1859.434) [-1863.755] (-1861.233) -- 0:00:55
      165000 -- [-1860.159] (-1862.150) (-1860.474) (-1865.176) * (-1862.200) (-1860.064) (-1861.031) [-1862.614] -- 0:00:55

      Average standard deviation of split frequencies: 0.027767

      165500 -- (-1859.951) [-1865.607] (-1862.168) (-1864.909) * (-1861.719) [-1859.817] (-1862.501) (-1868.231) -- 0:00:55
      166000 -- [-1862.382] (-1863.071) (-1862.828) (-1863.011) * (-1859.985) [-1863.902] (-1859.138) (-1859.305) -- 0:00:55
      166500 -- (-1869.380) (-1860.331) (-1862.330) [-1861.311] * (-1860.463) (-1862.943) [-1859.046] (-1867.214) -- 0:00:55
      167000 -- (-1862.032) [-1859.524] (-1859.358) (-1861.020) * (-1861.526) (-1862.258) [-1859.025] (-1866.520) -- 0:00:54
      167500 -- [-1860.127] (-1861.963) (-1860.446) (-1863.231) * (-1863.061) [-1860.955] (-1860.018) (-1859.262) -- 0:00:54
      168000 -- (-1860.528) (-1861.926) [-1859.441] (-1861.253) * (-1860.917) (-1861.936) [-1861.608] (-1859.360) -- 0:00:54
      168500 -- (-1859.914) [-1862.488] (-1862.487) (-1859.190) * [-1859.719] (-1861.040) (-1859.807) (-1859.440) -- 0:00:54
      169000 -- [-1861.963] (-1863.355) (-1860.540) (-1860.428) * (-1860.857) (-1861.978) [-1862.338] (-1860.217) -- 0:00:54
      169500 -- (-1865.827) (-1865.348) [-1860.041] (-1859.234) * (-1858.755) [-1859.230] (-1859.691) (-1860.060) -- 0:00:53
      170000 -- (-1866.069) (-1861.006) [-1861.640] (-1859.810) * [-1859.119] (-1860.644) (-1860.681) (-1863.603) -- 0:00:53

      Average standard deviation of split frequencies: 0.024568

      170500 -- (-1860.668) [-1861.654] (-1860.664) (-1864.722) * (-1862.354) (-1860.571) [-1859.650] (-1863.400) -- 0:00:53
      171000 -- (-1859.340) (-1862.885) [-1863.245] (-1863.215) * (-1861.735) (-1861.133) [-1860.941] (-1866.349) -- 0:00:53
      171500 -- (-1859.914) (-1864.239) [-1862.115] (-1860.550) * [-1862.681] (-1861.461) (-1862.493) (-1864.651) -- 0:00:53
      172000 -- (-1860.826) (-1867.327) [-1863.370] (-1859.123) * (-1861.551) (-1861.872) [-1860.370] (-1862.408) -- 0:00:52
      172500 -- [-1860.758] (-1867.544) (-1859.263) (-1859.799) * (-1860.116) (-1859.739) (-1860.674) [-1863.429] -- 0:00:52
      173000 -- (-1860.404) (-1864.723) (-1859.442) [-1860.222] * (-1862.329) (-1859.823) [-1860.415] (-1867.042) -- 0:00:57
      173500 -- (-1860.586) (-1862.962) [-1858.517] (-1861.800) * (-1864.932) [-1859.788] (-1861.565) (-1860.631) -- 0:00:57
      174000 -- (-1859.428) [-1860.117] (-1858.785) (-1861.103) * (-1861.973) [-1859.271] (-1860.957) (-1860.049) -- 0:00:56
      174500 -- [-1859.926] (-1860.029) (-1860.128) (-1869.676) * [-1861.757] (-1862.745) (-1863.748) (-1860.340) -- 0:00:56
      175000 -- (-1861.833) (-1860.185) [-1859.303] (-1869.867) * (-1859.613) [-1859.477] (-1859.444) (-1861.180) -- 0:00:56

      Average standard deviation of split frequencies: 0.026784

      175500 -- (-1859.213) [-1864.633] (-1862.657) (-1869.121) * (-1860.341) (-1859.489) (-1860.227) [-1859.977] -- 0:00:56
      176000 -- (-1859.474) [-1862.616] (-1861.904) (-1862.842) * (-1863.476) (-1862.734) [-1860.268] (-1862.643) -- 0:00:56
      176500 -- [-1858.979] (-1861.529) (-1864.406) (-1863.670) * (-1860.018) (-1861.659) [-1860.194] (-1861.469) -- 0:00:55
      177000 -- (-1858.914) [-1863.298] (-1864.671) (-1862.402) * (-1860.342) [-1860.946] (-1860.426) (-1861.542) -- 0:00:55
      177500 -- (-1858.623) (-1860.092) (-1865.105) [-1865.031] * [-1860.195] (-1863.489) (-1862.796) (-1859.745) -- 0:00:55
      178000 -- (-1860.129) (-1860.828) (-1863.243) [-1863.539] * [-1861.928] (-1861.791) (-1864.125) (-1864.096) -- 0:00:55
      178500 -- (-1869.526) (-1861.742) [-1859.863] (-1863.451) * (-1860.700) [-1859.245] (-1866.019) (-1861.022) -- 0:00:55
      179000 -- (-1871.433) (-1860.004) (-1859.848) [-1862.207] * (-1861.868) (-1863.345) [-1860.488] (-1861.537) -- 0:00:55
      179500 -- (-1871.432) (-1862.780) (-1859.171) [-1861.759] * (-1861.333) (-1859.175) [-1860.520] (-1865.435) -- 0:00:54
      180000 -- (-1859.883) [-1859.409] (-1860.340) (-1866.116) * (-1862.484) (-1858.905) (-1862.804) [-1864.558] -- 0:00:54

      Average standard deviation of split frequencies: 0.027013

      180500 -- [-1859.276] (-1859.283) (-1860.415) (-1863.207) * (-1863.272) [-1862.102] (-1864.431) (-1864.564) -- 0:00:54
      181000 -- (-1859.030) [-1860.074] (-1859.981) (-1860.682) * (-1865.292) (-1862.581) (-1864.186) [-1859.885] -- 0:00:54
      181500 -- (-1860.588) [-1859.558] (-1861.763) (-1861.292) * (-1863.655) (-1861.792) [-1862.516] (-1858.925) -- 0:00:54
      182000 -- [-1863.498] (-1860.019) (-1860.455) (-1861.135) * (-1863.422) (-1862.836) [-1860.092] (-1860.445) -- 0:00:53
      182500 -- (-1866.378) (-1860.252) (-1862.802) [-1861.120] * (-1864.113) (-1859.510) [-1861.335] (-1861.291) -- 0:00:53
      183000 -- (-1864.440) [-1859.221] (-1862.299) (-1860.116) * (-1860.939) [-1859.587] (-1860.731) (-1859.402) -- 0:00:53
      183500 -- (-1860.211) [-1859.969] (-1860.598) (-1862.277) * [-1860.117] (-1859.742) (-1860.768) (-1860.849) -- 0:00:53
      184000 -- (-1860.938) (-1861.320) (-1862.567) [-1860.925] * (-1862.253) [-1860.896] (-1862.927) (-1862.134) -- 0:00:53
      184500 -- (-1860.070) (-1861.548) [-1860.812] (-1860.364) * (-1862.064) (-1860.435) [-1860.169] (-1860.320) -- 0:00:53
      185000 -- (-1864.312) (-1859.019) (-1861.039) [-1859.735] * (-1862.387) (-1862.087) [-1859.962] (-1859.143) -- 0:00:52

      Average standard deviation of split frequencies: 0.023108

      185500 -- (-1864.207) (-1864.081) [-1860.661] (-1860.233) * (-1862.514) (-1863.913) [-1866.123] (-1859.842) -- 0:00:52
      186000 -- (-1860.717) [-1861.536] (-1859.519) (-1861.439) * (-1866.760) [-1859.078] (-1864.130) (-1860.306) -- 0:00:52
      186500 -- (-1860.715) [-1861.676] (-1862.131) (-1860.089) * (-1864.274) (-1862.278) [-1862.900] (-1859.240) -- 0:00:52
      187000 -- (-1859.965) (-1860.393) (-1862.527) [-1859.978] * (-1867.661) (-1860.762) [-1861.305] (-1861.142) -- 0:00:52
      187500 -- (-1861.599) (-1860.081) (-1858.928) [-1861.383] * (-1863.432) (-1859.870) (-1861.177) [-1859.911] -- 0:00:52
      188000 -- (-1863.373) (-1859.677) [-1858.911] (-1861.651) * (-1862.690) (-1859.024) (-1861.826) [-1860.555] -- 0:00:56
      188500 -- (-1864.465) [-1860.180] (-1862.702) (-1859.589) * (-1866.125) [-1863.864] (-1860.454) (-1860.958) -- 0:00:55
      189000 -- (-1861.731) (-1860.410) (-1860.351) [-1861.817] * (-1860.370) [-1863.644] (-1863.027) (-1861.392) -- 0:00:55
      189500 -- (-1859.639) [-1860.414] (-1861.393) (-1859.093) * [-1860.296] (-1863.441) (-1861.549) (-1862.676) -- 0:00:55
      190000 -- (-1860.978) [-1861.483] (-1867.864) (-1860.468) * (-1860.901) (-1858.979) (-1862.731) [-1862.667] -- 0:00:55

      Average standard deviation of split frequencies: 0.022526

      190500 -- (-1860.894) [-1861.180] (-1860.825) (-1861.039) * (-1859.450) (-1859.040) (-1867.936) [-1861.089] -- 0:00:55
      191000 -- (-1860.070) [-1861.268] (-1862.500) (-1863.256) * (-1862.867) (-1858.926) (-1862.084) [-1860.518] -- 0:00:55
      191500 -- [-1859.830] (-1859.127) (-1862.044) (-1860.314) * [-1861.491] (-1864.712) (-1862.212) (-1861.084) -- 0:00:54
      192000 -- (-1861.225) (-1859.138) [-1860.094] (-1866.453) * (-1860.595) (-1864.822) (-1859.124) [-1860.771] -- 0:00:54
      192500 -- [-1861.137] (-1861.156) (-1860.821) (-1864.310) * [-1859.655] (-1865.404) (-1859.079) (-1860.922) -- 0:00:54
      193000 -- [-1859.985] (-1861.973) (-1866.244) (-1862.496) * (-1862.841) (-1860.253) [-1860.683] (-1861.439) -- 0:00:54
      193500 -- (-1859.537) [-1862.095] (-1859.393) (-1862.664) * (-1861.261) (-1859.896) [-1859.917] (-1861.041) -- 0:00:54
      194000 -- (-1859.620) (-1866.223) [-1859.870] (-1863.994) * (-1861.291) (-1864.856) [-1861.834] (-1861.394) -- 0:00:54
      194500 -- (-1858.527) (-1863.299) (-1860.246) [-1866.257] * (-1861.552) [-1859.315] (-1862.905) (-1863.495) -- 0:00:53
      195000 -- [-1860.844] (-1862.158) (-1859.744) (-1859.098) * (-1861.351) [-1861.510] (-1860.284) (-1863.506) -- 0:00:53

      Average standard deviation of split frequencies: 0.023901

      195500 -- (-1859.135) (-1862.112) [-1862.444] (-1858.942) * (-1860.730) (-1859.953) [-1859.559] (-1862.264) -- 0:00:53
      196000 -- [-1860.920] (-1861.982) (-1860.745) (-1860.779) * [-1863.453] (-1859.492) (-1861.849) (-1858.677) -- 0:00:53
      196500 -- (-1859.275) (-1859.405) (-1860.544) [-1859.061] * [-1862.417] (-1861.756) (-1862.022) (-1860.220) -- 0:00:53
      197000 -- (-1860.384) (-1859.405) [-1861.591] (-1861.824) * (-1862.230) (-1858.738) [-1861.199] (-1860.614) -- 0:00:52
      197500 -- (-1859.723) (-1861.490) [-1859.881] (-1865.432) * (-1860.724) [-1859.486] (-1859.956) (-1861.804) -- 0:00:52
      198000 -- [-1860.153] (-1861.303) (-1863.949) (-1863.204) * (-1861.460) (-1860.186) (-1858.736) [-1862.809] -- 0:00:52
      198500 -- (-1860.101) (-1863.179) [-1860.468] (-1862.567) * [-1863.510] (-1859.854) (-1859.735) (-1861.253) -- 0:00:52
      199000 -- (-1863.391) (-1860.479) (-1859.973) [-1862.042] * (-1859.563) (-1862.584) [-1859.886] (-1861.106) -- 0:00:52
      199500 -- [-1863.658] (-1865.809) (-1859.899) (-1864.038) * (-1859.518) (-1861.152) (-1859.886) [-1859.348] -- 0:00:52
      200000 -- [-1859.509] (-1861.157) (-1861.574) (-1862.299) * [-1859.519] (-1860.206) (-1859.656) (-1860.589) -- 0:00:51

      Average standard deviation of split frequencies: 0.021290

      200500 -- (-1860.097) [-1859.827] (-1864.525) (-1861.376) * (-1859.199) [-1859.939] (-1859.980) (-1862.941) -- 0:00:51
      201000 -- (-1863.296) (-1859.605) [-1861.910] (-1860.764) * [-1858.959] (-1859.908) (-1858.926) (-1862.320) -- 0:00:51
      201500 -- (-1861.388) (-1859.251) (-1861.862) [-1861.087] * (-1860.480) (-1860.023) [-1858.818] (-1861.324) -- 0:00:51
      202000 -- (-1864.769) [-1859.070] (-1861.924) (-1860.690) * (-1858.836) [-1862.963] (-1858.757) (-1861.813) -- 0:00:51
      202500 -- (-1863.615) [-1859.888] (-1865.188) (-1860.333) * (-1859.076) (-1862.340) [-1861.619] (-1860.947) -- 0:00:51
      203000 -- [-1859.519] (-1859.626) (-1863.846) (-1861.360) * (-1859.256) (-1861.352) (-1862.745) [-1858.979] -- 0:00:54
      203500 -- (-1859.364) (-1861.274) (-1863.293) [-1860.427] * (-1861.193) (-1860.088) (-1860.153) [-1858.734] -- 0:00:54
      204000 -- (-1858.866) (-1859.279) [-1862.500] (-1860.477) * (-1859.369) [-1859.857] (-1862.680) (-1864.595) -- 0:00:54
      204500 -- [-1859.065] (-1860.614) (-1862.434) (-1860.344) * (-1859.078) (-1858.687) (-1862.748) [-1859.901] -- 0:00:54
      205000 -- (-1861.404) (-1860.164) [-1863.452] (-1860.757) * (-1858.779) (-1859.011) (-1860.297) [-1861.164] -- 0:00:54

      Average standard deviation of split frequencies: 0.021403

      205500 -- (-1860.737) [-1860.836] (-1860.070) (-1863.558) * (-1860.797) [-1858.740] (-1861.117) (-1862.304) -- 0:00:54
      206000 -- [-1860.345] (-1862.700) (-1860.598) (-1865.052) * (-1862.423) (-1858.834) (-1862.938) [-1861.067] -- 0:00:53
      206500 -- (-1861.217) [-1869.055] (-1861.519) (-1863.230) * (-1861.009) [-1860.245] (-1862.084) (-1859.609) -- 0:00:53
      207000 -- (-1861.984) (-1862.529) (-1861.764) [-1863.903] * (-1862.288) (-1862.801) (-1861.415) [-1859.608] -- 0:00:53
      207500 -- (-1862.461) [-1861.344] (-1861.422) (-1861.017) * (-1861.762) (-1867.501) (-1861.345) [-1861.581] -- 0:00:53
      208000 -- (-1860.744) (-1861.480) [-1859.695] (-1860.239) * (-1862.178) (-1860.613) (-1859.276) [-1859.787] -- 0:00:53
      208500 -- (-1864.431) (-1859.842) [-1859.593] (-1860.870) * (-1860.803) (-1860.735) (-1859.344) [-1860.062] -- 0:00:53
      209000 -- (-1859.473) (-1861.209) (-1859.914) [-1864.052] * (-1859.831) (-1860.644) (-1859.470) [-1859.375] -- 0:00:52
      209500 -- (-1862.225) (-1859.492) [-1860.865] (-1863.509) * (-1859.252) (-1862.741) (-1859.489) [-1861.638] -- 0:00:52
      210000 -- [-1860.231] (-1860.225) (-1865.371) (-1862.568) * [-1859.777] (-1864.215) (-1861.591) (-1861.274) -- 0:00:52

      Average standard deviation of split frequencies: 0.022640

      210500 -- (-1860.478) (-1862.610) (-1861.058) [-1864.695] * (-1859.679) (-1863.214) (-1860.067) [-1860.697] -- 0:00:52
      211000 -- (-1862.840) (-1861.713) (-1860.859) [-1862.573] * [-1860.225] (-1863.780) (-1859.989) (-1860.696) -- 0:00:52
      211500 -- (-1862.800) (-1861.713) (-1860.943) [-1862.134] * [-1859.123] (-1864.392) (-1860.989) (-1861.391) -- 0:00:52
      212000 -- (-1861.835) (-1861.066) [-1860.792] (-1859.664) * (-1859.182) (-1860.562) [-1860.056] (-1861.121) -- 0:00:52
      212500 -- (-1864.040) (-1860.879) (-1861.726) [-1859.660] * (-1859.480) [-1862.463] (-1860.354) (-1860.709) -- 0:00:51
      213000 -- (-1864.441) (-1862.085) [-1860.476] (-1859.340) * [-1862.266] (-1862.323) (-1860.059) (-1859.579) -- 0:00:51
      213500 -- (-1861.452) (-1860.298) (-1864.163) [-1859.465] * (-1862.883) [-1861.961] (-1860.066) (-1862.501) -- 0:00:51
      214000 -- [-1861.319] (-1864.962) (-1861.815) (-1860.961) * (-1864.710) [-1863.204] (-1861.974) (-1860.466) -- 0:00:51
      214500 -- [-1862.106] (-1866.582) (-1862.037) (-1860.406) * (-1863.307) (-1863.124) [-1861.786] (-1859.363) -- 0:00:51
      215000 -- (-1860.582) (-1860.274) (-1862.942) [-1860.553] * (-1863.734) [-1862.089] (-1865.448) (-1859.415) -- 0:00:51

      Average standard deviation of split frequencies: 0.020155

      215500 -- [-1860.183] (-1860.718) (-1863.574) (-1860.376) * (-1867.933) [-1863.925] (-1863.509) (-1858.851) -- 0:00:50
      216000 -- [-1859.363] (-1861.810) (-1863.938) (-1859.523) * (-1867.315) [-1862.075] (-1861.576) (-1858.854) -- 0:00:50
      216500 -- (-1862.856) (-1860.613) (-1862.323) [-1859.520] * (-1865.866) [-1861.937] (-1862.801) (-1861.089) -- 0:00:50
      217000 -- (-1862.152) (-1860.702) (-1861.703) [-1859.618] * (-1863.722) [-1860.191] (-1862.610) (-1863.051) -- 0:00:50
      217500 -- [-1861.187] (-1860.253) (-1863.273) (-1859.719) * (-1860.262) [-1860.884] (-1863.294) (-1863.094) -- 0:00:50
      218000 -- (-1860.502) (-1858.939) [-1861.433] (-1859.763) * [-1860.013] (-1863.368) (-1863.562) (-1860.504) -- 0:00:50
      218500 -- (-1860.689) [-1862.288] (-1859.669) (-1859.592) * (-1863.529) (-1861.765) [-1858.938] (-1862.469) -- 0:00:53
      219000 -- (-1860.377) (-1863.326) (-1860.868) [-1862.724] * (-1861.026) (-1864.654) (-1860.111) [-1862.654] -- 0:00:53
      219500 -- (-1860.055) (-1865.981) (-1859.880) [-1859.859] * (-1861.702) (-1860.812) [-1859.481] (-1859.945) -- 0:00:53
      220000 -- (-1860.420) (-1861.619) (-1859.199) [-1859.797] * [-1863.762] (-1861.562) (-1859.366) (-1861.692) -- 0:00:53

      Average standard deviation of split frequencies: 0.020734

      220500 -- (-1861.566) (-1863.171) (-1864.205) [-1860.271] * [-1863.729] (-1861.234) (-1859.481) (-1862.483) -- 0:00:53
      221000 -- (-1859.662) (-1859.784) [-1863.487] (-1861.533) * (-1862.709) (-1859.335) (-1860.645) [-1860.960] -- 0:00:52
      221500 -- (-1863.522) (-1863.001) (-1863.000) [-1859.461] * [-1861.199] (-1861.698) (-1860.947) (-1863.844) -- 0:00:52
      222000 -- (-1863.626) [-1862.405] (-1863.260) (-1860.626) * (-1859.642) (-1860.853) [-1859.669] (-1865.672) -- 0:00:52
      222500 -- (-1860.593) (-1864.916) (-1863.262) [-1860.944] * (-1863.735) (-1859.867) [-1859.669] (-1865.892) -- 0:00:52
      223000 -- (-1861.021) [-1864.411] (-1861.308) (-1858.994) * (-1860.469) (-1863.043) [-1861.326] (-1862.893) -- 0:00:52
      223500 -- [-1861.346] (-1862.040) (-1861.252) (-1859.116) * (-1863.543) [-1862.133] (-1861.029) (-1860.838) -- 0:00:52
      224000 -- (-1860.007) (-1862.105) (-1862.206) [-1860.659] * (-1859.226) (-1862.133) (-1862.517) [-1860.189] -- 0:00:51
      224500 -- [-1859.834] (-1861.522) (-1861.048) (-1863.086) * (-1859.187) [-1859.618] (-1861.048) (-1860.571) -- 0:00:51
      225000 -- [-1861.087] (-1862.907) (-1867.737) (-1863.098) * [-1859.192] (-1861.070) (-1861.396) (-1865.011) -- 0:00:51

      Average standard deviation of split frequencies: 0.020859

      225500 -- (-1862.583) (-1861.887) [-1862.511] (-1864.091) * [-1864.090] (-1859.755) (-1859.594) (-1859.406) -- 0:00:51
      226000 -- [-1862.065] (-1860.648) (-1862.302) (-1864.033) * (-1860.324) (-1860.191) (-1859.582) [-1859.809] -- 0:00:51
      226500 -- (-1861.492) [-1860.872] (-1862.749) (-1859.511) * (-1861.141) (-1861.180) [-1859.783] (-1859.365) -- 0:00:51
      227000 -- (-1860.842) (-1860.708) [-1863.820] (-1859.147) * (-1862.370) [-1860.740] (-1860.312) (-1859.245) -- 0:00:51
      227500 -- (-1860.571) (-1860.893) (-1863.767) [-1862.196] * (-1864.880) [-1860.248] (-1860.570) (-1860.355) -- 0:00:50
      228000 -- [-1862.084] (-1861.715) (-1859.542) (-1859.832) * (-1863.300) (-1860.872) (-1860.496) [-1860.521] -- 0:00:50
      228500 -- (-1862.084) (-1860.866) (-1860.600) [-1859.559] * [-1861.446] (-1863.615) (-1859.308) (-1861.730) -- 0:00:50
      229000 -- (-1864.431) (-1858.666) (-1861.286) [-1861.140] * (-1860.893) (-1861.897) (-1858.826) [-1860.020] -- 0:00:50
      229500 -- (-1859.864) [-1858.666] (-1862.127) (-1868.277) * (-1860.303) [-1861.761] (-1859.890) (-1861.431) -- 0:00:50
      230000 -- (-1860.073) [-1859.815] (-1860.450) (-1862.775) * (-1860.629) [-1858.943] (-1859.890) (-1860.013) -- 0:00:50

      Average standard deviation of split frequencies: 0.020196

      230500 -- (-1864.336) [-1861.288] (-1861.709) (-1863.598) * (-1860.537) (-1860.436) [-1859.840] (-1859.812) -- 0:00:50
      231000 -- (-1861.590) [-1859.445] (-1859.124) (-1860.594) * (-1862.010) [-1860.837] (-1858.943) (-1861.776) -- 0:00:49
      231500 -- (-1862.835) (-1859.286) (-1859.728) [-1860.609] * (-1862.773) (-1861.512) [-1858.827] (-1861.386) -- 0:00:49
      232000 -- (-1864.601) [-1859.131] (-1863.267) (-1858.923) * (-1861.733) [-1862.483] (-1858.935) (-1866.040) -- 0:00:49
      232500 -- (-1860.293) (-1859.631) (-1863.158) [-1861.921] * (-1863.237) (-1861.678) [-1859.929] (-1860.590) -- 0:00:49
      233000 -- (-1859.541) [-1861.050] (-1859.542) (-1861.015) * (-1863.056) (-1860.323) [-1860.637] (-1860.864) -- 0:00:52
      233500 -- (-1860.288) (-1860.446) (-1862.235) [-1861.004] * (-1863.251) [-1860.208] (-1860.545) (-1859.210) -- 0:00:52
      234000 -- (-1861.664) (-1860.660) (-1859.520) [-1860.382] * (-1867.633) [-1862.416] (-1865.396) (-1862.493) -- 0:00:52
      234500 -- (-1864.461) (-1866.954) [-1859.788] (-1862.365) * (-1864.796) (-1864.240) [-1858.994] (-1860.683) -- 0:00:52
      235000 -- (-1861.168) (-1859.294) [-1860.258] (-1863.076) * (-1863.540) (-1860.607) (-1858.962) [-1861.092] -- 0:00:52

      Average standard deviation of split frequencies: 0.019622

      235500 -- (-1863.713) (-1860.301) [-1859.879] (-1860.241) * (-1862.647) [-1859.168] (-1860.165) (-1860.700) -- 0:00:51
      236000 -- (-1867.006) (-1859.622) [-1859.743] (-1861.186) * (-1861.398) [-1858.775] (-1859.872) (-1860.061) -- 0:00:51
      236500 -- (-1861.495) (-1859.732) (-1859.218) [-1861.690] * (-1862.279) (-1860.729) (-1863.681) [-1859.926] -- 0:00:51
      237000 -- (-1866.922) [-1860.222] (-1859.217) (-1862.378) * (-1862.170) (-1861.729) [-1865.022] (-1860.626) -- 0:00:51
      237500 -- (-1864.854) [-1859.528] (-1859.843) (-1862.679) * (-1863.118) (-1859.411) (-1867.441) [-1859.745] -- 0:00:51
      238000 -- (-1864.392) (-1860.556) (-1861.274) [-1861.575] * (-1861.173) [-1859.068] (-1863.598) (-1860.874) -- 0:00:51
      238500 -- (-1860.799) [-1860.841] (-1862.675) (-1859.296) * (-1859.088) (-1859.604) [-1859.724] (-1860.597) -- 0:00:51
      239000 -- (-1860.956) [-1860.240] (-1863.423) (-1860.075) * (-1862.171) [-1859.022] (-1859.700) (-1860.432) -- 0:00:50
      239500 -- (-1862.433) (-1860.921) (-1862.837) [-1859.394] * [-1863.119] (-1859.734) (-1861.139) (-1860.042) -- 0:00:50
      240000 -- (-1860.747) (-1861.218) (-1862.131) [-1861.226] * (-1861.049) (-1860.194) (-1862.580) [-1860.460] -- 0:00:50

      Average standard deviation of split frequencies: 0.019696

      240500 -- [-1860.327] (-1858.850) (-1862.702) (-1861.360) * (-1860.098) [-1860.681] (-1861.556) (-1860.224) -- 0:00:50
      241000 -- (-1861.970) [-1859.225] (-1860.460) (-1859.263) * (-1859.384) (-1862.901) (-1860.994) [-1862.700] -- 0:00:50
      241500 -- [-1862.975] (-1863.655) (-1860.754) (-1859.912) * (-1862.073) [-1861.725] (-1860.789) (-1862.843) -- 0:00:50
      242000 -- (-1861.863) [-1858.811] (-1858.823) (-1863.499) * (-1863.351) [-1862.038] (-1859.452) (-1859.120) -- 0:00:50
      242500 -- [-1864.211] (-1858.980) (-1861.896) (-1866.804) * (-1861.243) [-1860.746] (-1861.898) (-1862.771) -- 0:00:49
      243000 -- [-1860.570] (-1858.768) (-1860.103) (-1864.799) * (-1860.635) [-1860.350] (-1859.812) (-1861.771) -- 0:00:49
      243500 -- (-1859.417) (-1861.682) [-1859.876] (-1861.096) * [-1860.259] (-1861.248) (-1859.558) (-1861.139) -- 0:00:49
      244000 -- (-1861.130) (-1860.583) (-1863.812) [-1862.722] * (-1860.137) (-1860.213) (-1859.612) [-1859.231] -- 0:00:49
      244500 -- (-1860.643) (-1859.416) (-1862.214) [-1860.123] * [-1861.848] (-1860.167) (-1860.911) (-1859.291) -- 0:00:49
      245000 -- (-1860.082) (-1859.382) (-1861.428) [-1863.238] * (-1862.472) (-1861.058) [-1862.484] (-1860.247) -- 0:00:49

      Average standard deviation of split frequencies: 0.020515

      245500 -- (-1860.060) (-1859.862) [-1862.684] (-1860.398) * (-1859.673) (-1860.847) [-1862.429] (-1863.068) -- 0:00:49
      246000 -- (-1859.734) (-1858.565) [-1863.112] (-1860.273) * [-1860.323] (-1860.179) (-1861.010) (-1858.918) -- 0:00:49
      246500 -- (-1860.150) (-1858.815) (-1865.142) [-1860.408] * [-1862.919] (-1860.559) (-1860.598) (-1859.035) -- 0:00:48
      247000 -- (-1860.707) [-1858.898] (-1862.335) (-1860.091) * (-1863.924) (-1860.909) (-1861.651) [-1861.655] -- 0:00:48
      247500 -- [-1860.707] (-1858.797) (-1864.296) (-1861.547) * (-1859.878) (-1862.571) (-1861.331) [-1862.492] -- 0:00:48
      248000 -- (-1860.435) [-1859.125] (-1862.413) (-1859.647) * (-1861.102) [-1861.354] (-1861.735) (-1867.300) -- 0:00:51
      248500 -- [-1859.037] (-1861.616) (-1859.049) (-1862.273) * (-1861.510) [-1859.931] (-1862.917) (-1865.073) -- 0:00:51
      249000 -- (-1860.309) (-1859.553) (-1859.136) [-1860.790] * (-1860.700) [-1860.110] (-1862.745) (-1865.605) -- 0:00:51
      249500 -- [-1860.940] (-1860.932) (-1859.081) (-1862.937) * [-1859.386] (-1860.087) (-1863.998) (-1862.454) -- 0:00:51
      250000 -- (-1859.746) (-1861.822) (-1859.576) [-1862.514] * (-1862.925) [-1863.254] (-1868.603) (-1862.978) -- 0:00:51

      Average standard deviation of split frequencies: 0.021019

      250500 -- [-1859.449] (-1860.938) (-1859.862) (-1865.018) * [-1862.925] (-1865.959) (-1860.895) (-1863.017) -- 0:00:50
      251000 -- (-1859.369) [-1860.835] (-1861.319) (-1871.013) * (-1865.401) [-1865.814] (-1858.965) (-1860.493) -- 0:00:50
      251500 -- [-1862.418] (-1861.358) (-1861.336) (-1859.950) * (-1865.367) (-1859.510) [-1859.068] (-1861.743) -- 0:00:50
      252000 -- (-1859.929) [-1859.596] (-1860.698) (-1861.018) * (-1863.404) (-1859.549) [-1861.044] (-1861.219) -- 0:00:50
      252500 -- [-1859.053] (-1861.072) (-1862.879) (-1860.637) * (-1862.732) (-1860.775) [-1860.457] (-1860.102) -- 0:00:50
      253000 -- [-1859.191] (-1862.965) (-1859.582) (-1861.928) * [-1863.169] (-1859.904) (-1860.138) (-1862.535) -- 0:00:50
      253500 -- (-1859.745) [-1859.233] (-1858.755) (-1861.236) * (-1862.660) [-1861.044] (-1859.299) (-1859.737) -- 0:00:50
      254000 -- (-1861.530) [-1859.377] (-1862.250) (-1862.864) * (-1859.940) [-1861.803] (-1859.316) (-1859.362) -- 0:00:49
      254500 -- (-1861.712) (-1859.546) (-1860.726) [-1861.027] * [-1861.106] (-1860.858) (-1859.986) (-1859.258) -- 0:00:49
      255000 -- (-1861.879) (-1859.589) (-1861.388) [-1861.183] * (-1861.711) (-1862.566) (-1860.459) [-1861.111] -- 0:00:49

      Average standard deviation of split frequencies: 0.019714

      255500 -- (-1862.901) [-1859.466] (-1861.855) (-1863.252) * [-1861.845] (-1862.770) (-1862.769) (-1859.708) -- 0:00:49
      256000 -- (-1859.676) (-1859.668) [-1862.001] (-1860.088) * (-1860.577) (-1862.624) [-1861.128] (-1859.799) -- 0:00:49
      256500 -- (-1859.317) (-1859.200) (-1864.228) [-1861.336] * (-1860.068) (-1862.977) [-1859.384] (-1860.335) -- 0:00:49
      257000 -- (-1859.076) (-1861.745) [-1860.574] (-1861.419) * (-1860.201) [-1860.986] (-1859.945) (-1860.016) -- 0:00:49
      257500 -- (-1859.203) [-1861.372] (-1861.912) (-1860.380) * (-1860.727) (-1864.840) [-1860.635] (-1860.069) -- 0:00:49
      258000 -- [-1861.154] (-1861.492) (-1859.184) (-1861.011) * (-1859.673) [-1862.110] (-1859.810) (-1859.456) -- 0:00:48
      258500 -- (-1863.310) (-1864.937) (-1861.040) [-1860.077] * [-1859.673] (-1861.542) (-1861.503) (-1859.541) -- 0:00:48
      259000 -- (-1861.232) (-1866.539) [-1859.935] (-1860.654) * (-1859.424) [-1861.735] (-1861.148) (-1862.216) -- 0:00:48
      259500 -- (-1860.682) (-1864.922) (-1861.172) [-1860.397] * (-1859.500) (-1861.616) [-1860.385] (-1861.047) -- 0:00:48
      260000 -- (-1860.059) (-1859.479) [-1860.727] (-1859.941) * (-1861.072) (-1861.073) [-1861.012] (-1859.932) -- 0:00:48

      Average standard deviation of split frequencies: 0.018404

      260500 -- (-1861.074) (-1859.579) (-1859.280) [-1858.842] * (-1861.432) (-1860.461) [-1860.326] (-1859.692) -- 0:00:48
      261000 -- (-1860.704) (-1860.592) [-1866.106] (-1861.304) * (-1860.429) (-1862.597) (-1863.849) [-1860.495] -- 0:00:48
      261500 -- (-1860.923) (-1861.222) (-1860.525) [-1860.469] * [-1863.803] (-1862.834) (-1861.968) (-1860.991) -- 0:00:48
      262000 -- (-1861.727) [-1860.088] (-1859.925) (-1860.192) * (-1861.549) [-1866.357] (-1863.803) (-1861.533) -- 0:00:47
      262500 -- (-1860.516) (-1860.617) (-1861.546) [-1860.009] * [-1861.977] (-1860.999) (-1859.993) (-1859.979) -- 0:00:47
      263000 -- (-1860.235) (-1861.795) [-1859.883] (-1859.713) * (-1863.770) (-1862.796) [-1860.562] (-1860.331) -- 0:00:47
      263500 -- (-1859.642) [-1862.795] (-1861.608) (-1860.857) * (-1863.646) (-1862.410) [-1861.136] (-1863.431) -- 0:00:50
      264000 -- (-1859.290) (-1862.322) [-1863.607] (-1865.558) * (-1861.495) [-1861.537] (-1861.624) (-1863.001) -- 0:00:50
      264500 -- [-1859.905] (-1859.679) (-1860.254) (-1860.056) * (-1862.816) (-1861.155) (-1861.373) [-1861.323] -- 0:00:50
      265000 -- [-1859.968] (-1860.591) (-1860.360) (-1862.931) * (-1865.239) (-1859.261) (-1862.528) [-1859.954] -- 0:00:49

      Average standard deviation of split frequencies: 0.018347

      265500 -- (-1860.975) [-1860.548] (-1862.303) (-1861.184) * (-1860.209) [-1863.699] (-1859.532) (-1859.779) -- 0:00:49
      266000 -- [-1860.587] (-1863.066) (-1861.530) (-1863.543) * (-1861.610) [-1863.107] (-1860.518) (-1861.065) -- 0:00:49
      266500 -- (-1860.084) (-1863.609) [-1860.923] (-1859.299) * (-1861.041) (-1862.917) [-1859.915] (-1859.585) -- 0:00:49
      267000 -- (-1859.053) [-1862.599] (-1860.459) (-1860.910) * (-1860.163) (-1863.339) (-1860.561) [-1859.588] -- 0:00:49
      267500 -- (-1863.375) [-1865.240] (-1864.802) (-1859.477) * (-1862.682) [-1863.880] (-1862.851) (-1860.037) -- 0:00:49
      268000 -- [-1862.117] (-1863.257) (-1860.095) (-1859.401) * (-1863.495) [-1862.068] (-1861.336) (-1859.291) -- 0:00:49
      268500 -- (-1862.033) [-1863.041] (-1860.282) (-1860.150) * (-1862.967) (-1862.467) (-1864.830) [-1859.122] -- 0:00:49
      269000 -- [-1862.028] (-1865.195) (-1861.150) (-1862.194) * (-1863.337) (-1868.186) [-1861.066] (-1860.950) -- 0:00:48
      269500 -- (-1863.145) (-1866.343) (-1860.715) [-1862.839] * (-1863.222) (-1862.714) [-1860.620] (-1860.000) -- 0:00:48
      270000 -- [-1861.684] (-1864.344) (-1864.400) (-1862.533) * (-1863.826) (-1861.416) [-1859.477] (-1863.134) -- 0:00:48

      Average standard deviation of split frequencies: 0.019465

      270500 -- (-1861.703) (-1862.275) [-1860.827] (-1861.558) * (-1867.025) [-1860.912] (-1861.892) (-1860.466) -- 0:00:48
      271000 -- (-1867.082) [-1859.408] (-1860.457) (-1862.601) * (-1859.134) (-1863.747) [-1862.085] (-1861.430) -- 0:00:48
      271500 -- [-1863.196] (-1859.423) (-1860.133) (-1860.954) * (-1858.965) (-1864.500) (-1859.075) [-1860.475] -- 0:00:48
      272000 -- (-1864.506) (-1862.138) [-1863.738] (-1859.460) * (-1861.505) [-1860.330] (-1859.428) (-1861.510) -- 0:00:48
      272500 -- (-1860.121) (-1860.505) (-1859.889) [-1860.951] * [-1859.563] (-1860.982) (-1862.871) (-1860.622) -- 0:00:48
      273000 -- [-1860.824] (-1858.972) (-1859.733) (-1859.614) * [-1858.886] (-1859.761) (-1862.963) (-1860.445) -- 0:00:47
      273500 -- (-1860.841) (-1858.883) [-1860.144] (-1859.288) * (-1862.336) (-1861.009) (-1861.147) [-1860.728] -- 0:00:47
      274000 -- (-1861.013) (-1861.353) [-1860.377] (-1859.289) * (-1864.631) (-1861.256) (-1861.432) [-1861.272] -- 0:00:47
      274500 -- (-1860.569) (-1860.077) [-1860.418] (-1861.331) * (-1864.290) (-1861.172) [-1861.418] (-1860.764) -- 0:00:47
      275000 -- (-1860.364) (-1861.610) [-1859.716] (-1866.205) * (-1861.409) (-1862.831) [-1863.678] (-1860.745) -- 0:00:47

      Average standard deviation of split frequencies: 0.017884

      275500 -- (-1860.096) [-1860.887] (-1861.081) (-1860.038) * [-1860.234] (-1860.426) (-1863.566) (-1860.541) -- 0:00:47
      276000 -- (-1860.810) (-1860.768) (-1863.026) [-1859.765] * (-1860.222) (-1860.348) (-1862.385) [-1860.857] -- 0:00:47
      276500 -- [-1859.041] (-1861.885) (-1860.928) (-1859.408) * [-1860.327] (-1862.695) (-1862.056) (-1860.620) -- 0:00:47
      277000 -- [-1859.373] (-1861.703) (-1862.780) (-1860.432) * (-1862.476) (-1863.272) [-1861.424] (-1863.465) -- 0:00:46
      277500 -- (-1859.759) (-1861.249) [-1859.754] (-1862.529) * (-1860.953) [-1859.979] (-1860.395) (-1863.345) -- 0:00:46
      278000 -- (-1860.804) (-1863.776) [-1861.547] (-1859.423) * [-1861.212] (-1859.789) (-1858.598) (-1860.414) -- 0:00:46
      278500 -- [-1859.564] (-1862.102) (-1861.276) (-1860.237) * (-1861.538) (-1861.986) [-1865.213] (-1861.580) -- 0:00:49
      279000 -- (-1859.849) (-1860.413) (-1861.010) [-1861.195] * (-1861.533) (-1862.399) (-1862.518) [-1859.897] -- 0:00:49
      279500 -- (-1859.977) (-1862.766) (-1865.286) [-1860.745] * (-1860.537) (-1861.657) (-1858.877) [-1859.178] -- 0:00:48
      280000 -- (-1859.730) [-1862.967] (-1861.776) (-1862.391) * (-1861.506) (-1861.170) (-1858.650) [-1859.944] -- 0:00:48

      Average standard deviation of split frequencies: 0.017981

      280500 -- [-1859.882] (-1864.128) (-1862.279) (-1861.094) * (-1859.973) [-1861.423] (-1858.643) (-1863.034) -- 0:00:48
      281000 -- [-1858.941] (-1863.044) (-1860.649) (-1860.924) * (-1861.179) (-1861.145) [-1859.260] (-1863.330) -- 0:00:48
      281500 -- [-1859.049] (-1863.500) (-1861.516) (-1859.904) * (-1861.286) (-1863.640) (-1859.265) [-1863.322] -- 0:00:48
      282000 -- (-1859.912) (-1860.474) (-1859.229) [-1860.288] * (-1859.379) (-1863.188) (-1858.975) [-1862.846] -- 0:00:48
      282500 -- (-1858.652) (-1860.542) [-1861.099] (-1860.085) * [-1859.651] (-1863.285) (-1858.550) (-1863.070) -- 0:00:48
      283000 -- (-1862.511) [-1859.534] (-1860.834) (-1859.691) * (-1861.823) [-1862.105] (-1858.562) (-1863.253) -- 0:00:48
      283500 -- (-1861.293) (-1861.573) (-1860.014) [-1863.319] * (-1860.931) [-1860.431] (-1860.005) (-1864.680) -- 0:00:48
      284000 -- (-1862.299) (-1860.441) (-1860.314) [-1860.153] * (-1859.064) [-1860.868] (-1859.063) (-1863.086) -- 0:00:47
      284500 -- (-1859.580) (-1860.304) [-1859.497] (-1859.631) * (-1861.581) [-1860.506] (-1859.675) (-1863.760) -- 0:00:47
      285000 -- (-1859.528) (-1861.856) (-1861.407) [-1859.692] * (-1861.249) [-1860.285] (-1859.042) (-1864.667) -- 0:00:47

      Average standard deviation of split frequencies: 0.018651

      285500 -- (-1859.807) (-1860.562) (-1859.870) [-1861.431] * (-1861.302) [-1862.458] (-1859.013) (-1865.131) -- 0:00:47
      286000 -- [-1859.841] (-1862.162) (-1861.104) (-1859.510) * [-1859.944] (-1860.243) (-1860.348) (-1859.920) -- 0:00:47
      286500 -- (-1860.112) (-1863.369) (-1863.206) [-1859.211] * (-1861.089) [-1861.366] (-1859.262) (-1859.112) -- 0:00:47
      287000 -- [-1859.545] (-1862.389) (-1859.883) (-1860.435) * (-1861.507) (-1862.023) [-1860.270] (-1858.530) -- 0:00:47
      287500 -- (-1860.190) (-1863.569) (-1859.739) [-1860.165] * [-1862.221] (-1862.888) (-1860.553) (-1862.962) -- 0:00:47
      288000 -- [-1860.775] (-1864.272) (-1860.144) (-1862.463) * (-1863.851) (-1861.204) [-1862.080] (-1862.542) -- 0:00:46
      288500 -- (-1860.773) [-1865.902] (-1868.044) (-1860.116) * [-1862.157] (-1861.048) (-1859.655) (-1864.172) -- 0:00:46
      289000 -- (-1862.620) (-1861.537) (-1866.278) [-1863.077] * (-1859.720) (-1860.788) (-1862.601) [-1864.981] -- 0:00:46
      289500 -- (-1863.128) (-1860.460) [-1859.827] (-1862.396) * (-1860.249) (-1862.117) (-1862.602) [-1862.034] -- 0:00:46
      290000 -- (-1859.560) (-1859.415) (-1861.143) [-1865.565] * (-1859.768) (-1860.042) [-1861.191] (-1861.773) -- 0:00:46

      Average standard deviation of split frequencies: 0.017029

      290500 -- (-1863.860) (-1859.987) (-1861.272) [-1862.106] * (-1863.327) (-1859.349) [-1864.175] (-1862.260) -- 0:00:46
      291000 -- (-1862.052) (-1862.777) [-1861.627] (-1861.144) * (-1865.171) (-1864.180) (-1867.704) [-1859.987] -- 0:00:46
      291500 -- (-1860.791) [-1861.608] (-1861.454) (-1861.279) * (-1860.746) (-1859.416) (-1864.571) [-1860.106] -- 0:00:46
      292000 -- (-1859.661) [-1861.749] (-1860.633) (-1860.506) * [-1860.112] (-1862.204) (-1864.128) (-1860.352) -- 0:00:46
      292500 -- (-1861.176) (-1860.948) [-1860.760] (-1862.353) * (-1860.968) [-1860.463] (-1862.265) (-1860.237) -- 0:00:45
      293000 -- (-1859.819) [-1862.102] (-1862.843) (-1860.023) * (-1862.847) [-1859.983] (-1861.459) (-1860.736) -- 0:00:45
      293500 -- [-1861.631] (-1861.644) (-1862.961) (-1859.532) * [-1859.905] (-1860.428) (-1861.579) (-1859.519) -- 0:00:48
      294000 -- [-1860.555] (-1865.184) (-1860.882) (-1858.728) * (-1859.874) (-1860.428) (-1862.909) [-1861.134] -- 0:00:48
      294500 -- (-1861.928) (-1865.026) (-1860.812) [-1861.750] * [-1861.000] (-1860.291) (-1860.399) (-1860.325) -- 0:00:47
      295000 -- [-1859.154] (-1863.198) (-1860.494) (-1862.633) * (-1861.984) [-1860.321] (-1863.469) (-1864.357) -- 0:00:47

      Average standard deviation of split frequencies: 0.015837

      295500 -- (-1863.458) [-1860.595] (-1861.920) (-1862.609) * [-1861.695] (-1862.862) (-1864.580) (-1861.069) -- 0:00:47
      296000 -- (-1860.549) (-1861.299) [-1864.375] (-1860.764) * (-1865.980) (-1861.873) (-1865.943) [-1860.852] -- 0:00:47
      296500 -- [-1860.678] (-1859.741) (-1865.728) (-1862.219) * (-1863.309) [-1865.226] (-1866.064) (-1863.873) -- 0:00:47
      297000 -- [-1864.538] (-1860.408) (-1866.447) (-1861.422) * (-1861.531) (-1868.734) [-1860.279] (-1859.506) -- 0:00:47
      297500 -- [-1859.517] (-1860.131) (-1860.085) (-1861.718) * (-1861.613) [-1859.342] (-1860.494) (-1860.829) -- 0:00:47
      298000 -- [-1860.600] (-1861.649) (-1861.311) (-1862.567) * [-1859.201] (-1860.758) (-1862.452) (-1860.598) -- 0:00:47
      298500 -- (-1863.144) (-1859.758) (-1863.455) [-1861.084] * [-1861.566] (-1860.702) (-1861.549) (-1860.280) -- 0:00:47
      299000 -- (-1862.608) (-1859.665) [-1862.989] (-1862.473) * (-1860.058) (-1862.984) [-1862.562] (-1862.834) -- 0:00:46
      299500 -- (-1861.664) (-1859.498) (-1859.538) [-1862.848] * (-1860.030) (-1864.535) (-1861.481) [-1861.883] -- 0:00:46
      300000 -- [-1860.591] (-1861.648) (-1862.111) (-1861.690) * (-1860.830) (-1860.728) [-1859.711] (-1859.492) -- 0:00:46

      Average standard deviation of split frequencies: 0.015940

      300500 -- (-1859.591) (-1860.917) [-1861.702] (-1859.708) * [-1860.419] (-1860.398) (-1859.271) (-1861.277) -- 0:00:46
      301000 -- (-1859.846) (-1859.771) [-1862.455] (-1859.901) * (-1858.754) (-1860.670) (-1859.689) [-1861.352] -- 0:00:46
      301500 -- [-1859.564] (-1859.847) (-1861.671) (-1861.907) * (-1862.654) (-1860.317) [-1859.096] (-1862.994) -- 0:00:46
      302000 -- [-1861.483] (-1859.224) (-1858.660) (-1860.677) * (-1858.995) (-1861.036) (-1861.584) [-1859.018] -- 0:00:46
      302500 -- (-1860.184) (-1860.861) [-1859.629] (-1860.208) * (-1860.060) [-1860.256] (-1861.463) (-1860.803) -- 0:00:46
      303000 -- [-1859.852] (-1859.383) (-1860.218) (-1862.032) * (-1859.842) (-1860.194) (-1859.744) [-1860.052] -- 0:00:46
      303500 -- [-1860.397] (-1859.191) (-1861.623) (-1860.541) * (-1862.681) (-1865.021) (-1860.998) [-1865.525] -- 0:00:45
      304000 -- (-1863.906) (-1861.769) [-1860.568] (-1862.635) * (-1861.048) (-1861.903) (-1858.782) [-1860.448] -- 0:00:45
      304500 -- [-1861.887] (-1862.291) (-1860.044) (-1862.730) * (-1861.285) (-1861.072) [-1861.038] (-1862.877) -- 0:00:45
      305000 -- (-1863.230) [-1862.684] (-1861.952) (-1865.030) * (-1861.955) (-1861.054) [-1863.036] (-1863.198) -- 0:00:45

      Average standard deviation of split frequencies: 0.015833

      305500 -- (-1868.277) (-1860.492) [-1860.941] (-1860.242) * [-1866.197] (-1867.248) (-1863.036) (-1862.827) -- 0:00:45
      306000 -- (-1861.341) [-1860.190] (-1862.849) (-1861.189) * [-1859.492] (-1859.939) (-1859.925) (-1861.015) -- 0:00:45
      306500 -- (-1863.769) (-1864.073) [-1864.316] (-1864.951) * (-1859.489) (-1859.907) [-1861.882] (-1867.716) -- 0:00:45
      307000 -- (-1861.329) [-1859.527] (-1859.721) (-1862.978) * (-1860.145) (-1862.595) (-1865.174) [-1859.879] -- 0:00:45
      307500 -- (-1863.282) [-1863.567] (-1862.575) (-1861.935) * (-1860.146) (-1865.553) [-1860.827] (-1860.682) -- 0:00:45
      308000 -- (-1861.860) (-1861.105) (-1862.689) [-1859.943] * (-1859.930) (-1860.991) [-1862.206] (-1859.930) -- 0:00:44
      308500 -- [-1860.646] (-1861.255) (-1862.992) (-1862.303) * [-1861.089] (-1860.985) (-1861.683) (-1862.493) -- 0:00:47
      309000 -- (-1862.436) (-1864.553) (-1863.153) [-1859.395] * (-1862.787) (-1861.542) [-1863.906] (-1860.705) -- 0:00:46
      309500 -- (-1862.656) (-1859.500) [-1861.155] (-1861.502) * (-1859.492) [-1861.128] (-1861.918) (-1862.031) -- 0:00:46
      310000 -- (-1859.922) (-1860.058) (-1861.505) [-1861.521] * (-1859.373) [-1862.550] (-1863.005) (-1860.893) -- 0:00:46

      Average standard deviation of split frequencies: 0.015680

      310500 -- (-1860.650) [-1860.274] (-1860.903) (-1861.873) * [-1861.040] (-1860.802) (-1864.694) (-1860.675) -- 0:00:46
      311000 -- (-1864.036) (-1860.147) (-1860.471) [-1862.240] * (-1861.179) (-1859.872) [-1864.656] (-1860.217) -- 0:00:46
      311500 -- (-1869.066) (-1860.055) (-1860.920) [-1862.783] * [-1860.526] (-1861.706) (-1861.627) (-1860.822) -- 0:00:46
      312000 -- (-1862.123) [-1863.561] (-1860.234) (-1859.954) * (-1860.826) (-1860.125) [-1863.876] (-1861.817) -- 0:00:46
      312500 -- (-1861.924) [-1861.782] (-1860.383) (-1860.744) * [-1860.770] (-1861.056) (-1859.438) (-1861.426) -- 0:00:46
      313000 -- (-1862.414) (-1863.972) [-1858.815] (-1862.008) * (-1863.954) (-1859.885) (-1859.708) [-1860.270] -- 0:00:46
      313500 -- (-1861.709) (-1866.822) [-1860.142] (-1861.695) * [-1858.870] (-1867.267) (-1860.013) (-1862.705) -- 0:00:45
      314000 -- [-1862.180] (-1859.151) (-1859.322) (-1861.154) * (-1863.590) (-1862.608) [-1862.468] (-1859.618) -- 0:00:45
      314500 -- (-1862.264) (-1860.901) (-1862.698) [-1859.921] * (-1860.762) (-1860.352) [-1860.725] (-1860.304) -- 0:00:45
      315000 -- (-1861.743) [-1860.434] (-1862.971) (-1859.438) * (-1861.964) (-1859.985) (-1859.818) [-1862.605] -- 0:00:45

      Average standard deviation of split frequencies: 0.016824

      315500 -- (-1862.705) (-1861.241) [-1859.568] (-1861.123) * (-1859.859) [-1859.475] (-1860.895) (-1860.360) -- 0:00:45
      316000 -- (-1863.099) (-1861.241) (-1861.386) [-1861.441] * [-1861.163] (-1861.086) (-1860.364) (-1859.931) -- 0:00:45
      316500 -- [-1861.819] (-1861.659) (-1861.448) (-1859.866) * (-1859.383) (-1860.141) (-1860.374) [-1864.920] -- 0:00:45
      317000 -- (-1860.334) (-1860.108) (-1860.603) [-1860.300] * (-1859.109) [-1859.528] (-1860.858) (-1869.110) -- 0:00:45
      317500 -- (-1861.180) (-1861.001) (-1859.271) [-1859.655] * (-1859.799) [-1859.596] (-1863.814) (-1865.351) -- 0:00:45
      318000 -- (-1860.352) (-1862.375) [-1860.239] (-1862.334) * (-1859.042) (-1861.608) [-1865.992] (-1861.098) -- 0:00:45
      318500 -- (-1859.519) (-1863.194) [-1859.333] (-1861.206) * [-1862.304] (-1862.622) (-1862.401) (-1861.856) -- 0:00:44
      319000 -- (-1860.508) (-1863.517) [-1858.905] (-1861.421) * (-1860.968) [-1859.830] (-1863.033) (-1860.597) -- 0:00:44
      319500 -- (-1859.499) (-1858.618) [-1859.707] (-1859.640) * (-1864.150) (-1861.334) (-1859.831) [-1863.152] -- 0:00:44
      320000 -- (-1859.770) (-1859.494) (-1860.289) [-1859.793] * (-1862.041) (-1861.043) [-1860.178] (-1862.156) -- 0:00:44

      Average standard deviation of split frequencies: 0.017069

      320500 -- (-1860.513) [-1861.104] (-1860.404) (-1860.686) * (-1861.013) (-1860.583) [-1862.384] (-1861.765) -- 0:00:44
      321000 -- [-1863.534] (-1860.400) (-1861.210) (-1862.147) * (-1860.399) (-1862.368) (-1862.237) [-1859.610] -- 0:00:44
      321500 -- [-1862.004] (-1859.417) (-1859.682) (-1861.826) * [-1859.283] (-1864.549) (-1861.719) (-1860.855) -- 0:00:44
      322000 -- (-1861.013) [-1859.953] (-1859.508) (-1861.824) * [-1859.991] (-1863.678) (-1864.213) (-1861.453) -- 0:00:44
      322500 -- (-1866.601) [-1860.322] (-1861.396) (-1860.936) * (-1859.387) (-1860.703) [-1864.128] (-1861.196) -- 0:00:44
      323000 -- (-1865.018) [-1859.820] (-1861.871) (-1861.250) * (-1859.741) [-1861.339] (-1861.264) (-1859.241) -- 0:00:44
      323500 -- (-1859.822) (-1865.780) (-1862.207) [-1860.856] * (-1861.686) (-1860.771) [-1859.663] (-1860.412) -- 0:00:46
      324000 -- (-1861.249) [-1860.992] (-1861.343) (-1861.718) * (-1862.342) (-1864.491) (-1858.673) [-1859.109] -- 0:00:45
      324500 -- [-1861.457] (-1862.345) (-1862.141) (-1861.719) * (-1861.607) (-1865.628) [-1858.774] (-1861.630) -- 0:00:45
      325000 -- (-1859.124) (-1860.682) [-1860.485] (-1861.720) * (-1864.216) (-1867.428) (-1859.020) [-1861.644] -- 0:00:45

      Average standard deviation of split frequencies: 0.017513

      325500 -- [-1859.127] (-1859.666) (-1862.233) (-1859.698) * [-1862.468] (-1859.332) (-1863.030) (-1861.634) -- 0:00:45
      326000 -- (-1859.830) [-1860.859] (-1862.707) (-1861.263) * (-1863.930) [-1862.416] (-1861.804) (-1860.449) -- 0:00:45
      326500 -- [-1860.217] (-1860.426) (-1864.850) (-1864.759) * (-1861.775) (-1859.984) [-1860.233] (-1860.129) -- 0:00:45
      327000 -- (-1860.593) (-1859.433) [-1862.830] (-1862.598) * [-1865.865] (-1859.087) (-1860.733) (-1861.594) -- 0:00:45
      327500 -- [-1861.854] (-1860.478) (-1860.136) (-1862.551) * [-1865.560] (-1860.030) (-1862.692) (-1861.765) -- 0:00:45
      328000 -- [-1860.300] (-1859.468) (-1860.671) (-1863.248) * (-1863.676) (-1860.292) (-1864.036) [-1861.327] -- 0:00:45
      328500 -- (-1864.104) (-1860.133) (-1859.301) [-1860.488] * (-1864.710) [-1860.129] (-1860.895) (-1859.884) -- 0:00:44
      329000 -- (-1865.360) (-1860.064) [-1860.897] (-1870.550) * (-1859.726) (-1861.421) [-1859.960] (-1865.221) -- 0:00:44
      329500 -- (-1863.414) [-1859.356] (-1859.693) (-1862.358) * [-1859.919] (-1864.081) (-1864.850) (-1864.400) -- 0:00:44
      330000 -- (-1863.972) [-1861.770] (-1860.997) (-1861.028) * (-1863.559) (-1859.557) [-1860.641] (-1860.812) -- 0:00:44

      Average standard deviation of split frequencies: 0.017946

      330500 -- (-1860.950) (-1861.455) (-1862.419) [-1860.287] * (-1860.540) [-1859.992] (-1860.787) (-1861.302) -- 0:00:44
      331000 -- (-1863.500) (-1860.906) (-1862.327) [-1860.028] * [-1863.625] (-1859.340) (-1861.402) (-1859.128) -- 0:00:44
      331500 -- (-1860.945) (-1861.953) (-1867.032) [-1861.952] * (-1873.138) (-1859.960) [-1861.985] (-1862.817) -- 0:00:44
      332000 -- (-1859.596) (-1862.702) [-1862.055] (-1859.840) * (-1863.204) (-1859.232) (-1860.385) [-1859.341] -- 0:00:44
      332500 -- (-1860.276) (-1862.700) (-1860.821) [-1858.554] * (-1861.390) (-1859.009) [-1860.350] (-1862.320) -- 0:00:44
      333000 -- (-1860.187) (-1860.265) [-1861.354] (-1860.036) * (-1861.133) [-1859.010] (-1859.767) (-1865.481) -- 0:00:44
      333500 -- (-1862.340) (-1859.187) [-1861.628] (-1859.987) * (-1868.921) (-1858.959) [-1860.074] (-1861.347) -- 0:00:43
      334000 -- (-1862.189) (-1859.211) [-1861.039] (-1860.757) * [-1859.999] (-1859.496) (-1860.561) (-1864.251) -- 0:00:43
      334500 -- [-1860.476] (-1859.443) (-1860.624) (-1862.190) * (-1860.226) [-1859.496] (-1861.747) (-1864.237) -- 0:00:43
      335000 -- (-1858.647) [-1860.497] (-1862.853) (-1859.335) * [-1860.080] (-1861.144) (-1860.096) (-1862.332) -- 0:00:43

      Average standard deviation of split frequencies: 0.017661

      335500 -- (-1859.749) (-1859.315) (-1861.270) [-1859.378] * (-1860.113) (-1859.628) (-1859.526) [-1860.595] -- 0:00:43
      336000 -- [-1861.378] (-1859.368) (-1863.069) (-1859.835) * (-1859.829) (-1860.517) [-1859.915] (-1860.526) -- 0:00:43
      336500 -- (-1862.437) (-1860.803) (-1861.357) [-1861.371] * (-1859.811) (-1860.171) (-1859.804) [-1861.665] -- 0:00:43
      337000 -- (-1861.343) (-1860.823) (-1862.480) [-1860.275] * (-1861.709) (-1863.298) (-1860.774) [-1860.643] -- 0:00:43
      337500 -- (-1861.183) (-1862.235) (-1860.693) [-1861.913] * (-1859.275) (-1860.090) [-1858.959] (-1862.896) -- 0:00:43
      338000 -- [-1860.895] (-1864.098) (-1861.534) (-1862.322) * (-1861.072) (-1861.283) [-1858.958] (-1862.996) -- 0:00:43
      338500 -- (-1860.603) (-1863.587) [-1860.431] (-1860.881) * (-1863.639) [-1859.055] (-1861.388) (-1866.638) -- 0:00:44
      339000 -- (-1860.473) (-1862.563) (-1860.471) [-1860.228] * (-1864.019) [-1861.153] (-1858.775) (-1860.751) -- 0:00:44
      339500 -- [-1861.132] (-1861.188) (-1868.042) (-1859.755) * (-1864.753) [-1860.129] (-1860.329) (-1861.715) -- 0:00:44
      340000 -- (-1862.056) (-1863.178) (-1863.333) [-1859.393] * (-1865.450) (-1860.129) [-1860.044] (-1862.008) -- 0:00:44

      Average standard deviation of split frequencies: 0.017419

      340500 -- [-1859.687] (-1860.735) (-1865.078) (-1859.605) * (-1861.307) [-1859.834] (-1860.069) (-1864.944) -- 0:00:44
      341000 -- (-1859.183) (-1858.822) [-1861.028] (-1860.141) * (-1859.693) [-1862.274] (-1860.989) (-1865.289) -- 0:00:44
      341500 -- (-1862.186) (-1863.624) (-1860.355) [-1861.214] * (-1861.334) [-1859.071] (-1861.012) (-1864.092) -- 0:00:44
      342000 -- (-1860.581) [-1862.233] (-1863.561) (-1861.333) * (-1861.210) [-1859.065] (-1861.011) (-1861.918) -- 0:00:44
      342500 -- (-1859.200) (-1862.169) (-1863.396) [-1862.082] * [-1858.663] (-1861.452) (-1860.402) (-1861.114) -- 0:00:44
      343000 -- [-1860.306] (-1863.331) (-1861.581) (-1863.044) * [-1858.663] (-1860.693) (-1859.666) (-1861.107) -- 0:00:44
      343500 -- (-1861.536) (-1866.114) [-1860.626] (-1860.462) * (-1860.017) (-1859.144) (-1860.282) [-1865.004] -- 0:00:43
      344000 -- (-1859.655) (-1860.773) [-1861.920] (-1859.828) * (-1860.217) (-1860.991) [-1858.732] (-1859.964) -- 0:00:43
      344500 -- (-1860.187) (-1860.899) [-1863.298] (-1859.559) * (-1860.726) (-1863.611) (-1858.766) [-1859.813] -- 0:00:43
      345000 -- [-1859.608] (-1860.864) (-1863.467) (-1859.892) * (-1860.434) (-1860.013) [-1860.086] (-1861.668) -- 0:00:43

      Average standard deviation of split frequencies: 0.016670

      345500 -- (-1859.572) [-1860.975] (-1861.284) (-1861.424) * [-1861.249] (-1859.877) (-1864.965) (-1858.959) -- 0:00:43
      346000 -- [-1861.866] (-1860.024) (-1861.284) (-1859.318) * (-1860.153) (-1861.811) (-1866.226) [-1863.097] -- 0:00:43
      346500 -- (-1859.798) [-1860.201] (-1860.697) (-1859.607) * (-1860.127) [-1859.816] (-1862.684) (-1863.573) -- 0:00:43
      347000 -- (-1859.075) (-1861.229) (-1858.545) [-1860.485] * (-1862.936) (-1862.610) (-1863.452) [-1861.389] -- 0:00:43
      347500 -- [-1859.714] (-1862.383) (-1858.519) (-1861.363) * (-1864.144) [-1862.364] (-1860.660) (-1859.415) -- 0:00:43
      348000 -- (-1863.394) [-1859.184] (-1859.989) (-1861.170) * [-1864.466] (-1860.608) (-1861.578) (-1864.363) -- 0:00:43
      348500 -- (-1860.585) [-1859.582] (-1859.581) (-1860.358) * (-1866.159) [-1860.209] (-1862.606) (-1861.128) -- 0:00:42
      349000 -- (-1860.802) [-1861.572] (-1861.535) (-1859.271) * (-1860.267) (-1859.665) [-1859.067] (-1862.813) -- 0:00:42
      349500 -- [-1860.143] (-1862.773) (-1863.591) (-1859.209) * (-1860.099) (-1859.642) [-1860.557] (-1860.141) -- 0:00:42
      350000 -- [-1861.013] (-1859.503) (-1860.994) (-1860.814) * (-1860.736) [-1859.089] (-1863.133) (-1861.138) -- 0:00:42

      Average standard deviation of split frequencies: 0.016053

      350500 -- (-1860.565) (-1863.025) [-1860.896] (-1860.727) * (-1861.970) (-1859.381) (-1865.203) [-1858.949] -- 0:00:42
      351000 -- (-1861.071) (-1861.987) (-1861.336) [-1860.124] * (-1861.396) (-1861.231) (-1860.324) [-1859.871] -- 0:00:42
      351500 -- (-1859.843) [-1859.832] (-1864.538) (-1860.124) * (-1862.418) (-1861.231) [-1860.688] (-1860.210) -- 0:00:42
      352000 -- (-1861.788) (-1861.739) [-1863.121] (-1862.507) * (-1862.611) (-1864.372) (-1859.293) [-1859.731] -- 0:00:42
      352500 -- (-1861.757) (-1859.587) [-1862.457] (-1863.029) * (-1862.608) (-1863.397) (-1863.347) [-1859.949] -- 0:00:42
      353000 -- (-1861.447) (-1862.794) [-1861.913] (-1860.712) * (-1862.200) (-1862.346) [-1862.494] (-1861.308) -- 0:00:42
      353500 -- (-1861.171) [-1860.638] (-1860.871) (-1859.639) * (-1863.593) (-1861.233) (-1865.747) [-1859.777] -- 0:00:42
      354000 -- (-1860.348) [-1860.900] (-1860.126) (-1860.098) * (-1860.992) (-1861.460) (-1859.850) [-1859.870] -- 0:00:43
      354500 -- (-1860.379) (-1860.914) [-1861.195] (-1861.974) * (-1860.838) (-1861.231) [-1859.068] (-1861.920) -- 0:00:43
      355000 -- (-1861.242) (-1864.048) (-1860.260) [-1860.916] * [-1860.722] (-1864.949) (-1859.173) (-1860.361) -- 0:00:43

      Average standard deviation of split frequencies: 0.015812

      355500 -- (-1859.951) (-1863.881) [-1860.454] (-1861.151) * (-1860.748) [-1863.951] (-1859.021) (-1860.642) -- 0:00:43
      356000 -- (-1860.151) (-1860.159) [-1860.054] (-1861.857) * (-1866.071) (-1860.539) [-1861.701] (-1859.665) -- 0:00:43
      356500 -- (-1863.460) (-1860.159) (-1859.549) [-1860.613] * (-1863.825) (-1861.723) [-1865.602] (-1861.242) -- 0:00:43
      357000 -- (-1863.728) (-1859.452) (-1860.743) [-1860.795] * [-1860.919] (-1860.275) (-1864.327) (-1860.562) -- 0:00:43
      357500 -- [-1863.229] (-1859.410) (-1860.084) (-1860.126) * [-1862.419] (-1861.624) (-1861.843) (-1859.693) -- 0:00:43
      358000 -- (-1863.353) (-1859.625) (-1860.165) [-1861.961] * [-1859.741] (-1860.301) (-1861.093) (-1860.358) -- 0:00:43
      358500 -- [-1859.729] (-1863.300) (-1860.334) (-1861.414) * (-1860.064) (-1862.066) (-1859.673) [-1863.365] -- 0:00:42
      359000 -- (-1860.319) (-1859.359) [-1859.565] (-1862.690) * (-1860.139) (-1860.445) [-1862.968] (-1861.279) -- 0:00:42
      359500 -- [-1861.135] (-1860.285) (-1860.633) (-1866.107) * (-1862.735) (-1861.499) [-1861.858] (-1863.401) -- 0:00:42
      360000 -- [-1859.566] (-1861.777) (-1860.050) (-1862.946) * (-1865.498) [-1858.958] (-1861.265) (-1861.368) -- 0:00:42

      Average standard deviation of split frequencies: 0.015223

      360500 -- (-1859.209) (-1862.628) (-1859.715) [-1861.513] * (-1860.850) (-1859.026) [-1861.578] (-1862.013) -- 0:00:42
      361000 -- (-1865.102) [-1860.710] (-1861.789) (-1861.759) * (-1862.046) [-1859.096] (-1861.972) (-1861.325) -- 0:00:42
      361500 -- [-1860.195] (-1860.602) (-1862.169) (-1862.066) * (-1861.728) [-1859.646] (-1860.374) (-1861.043) -- 0:00:42
      362000 -- (-1862.232) [-1860.714] (-1860.217) (-1863.586) * (-1865.529) [-1859.642] (-1860.976) (-1859.302) -- 0:00:42
      362500 -- [-1862.663] (-1859.499) (-1861.079) (-1864.996) * (-1866.236) (-1861.608) [-1860.562] (-1859.325) -- 0:00:42
      363000 -- [-1863.389] (-1859.211) (-1861.314) (-1862.873) * [-1862.080] (-1862.974) (-1861.332) (-1864.612) -- 0:00:42
      363500 -- (-1864.577) [-1861.886] (-1862.402) (-1859.859) * (-1859.987) (-1860.601) (-1862.027) [-1862.364] -- 0:00:42
      364000 -- [-1861.063] (-1859.819) (-1867.691) (-1864.261) * (-1864.194) (-1863.008) [-1862.842] (-1860.089) -- 0:00:41
      364500 -- (-1860.765) (-1863.093) (-1867.201) [-1859.431] * (-1861.904) [-1860.254] (-1862.891) (-1860.448) -- 0:00:41
      365000 -- [-1860.662] (-1862.556) (-1860.214) (-1861.447) * [-1859.488] (-1861.294) (-1860.531) (-1858.653) -- 0:00:41

      Average standard deviation of split frequencies: 0.015077

      365500 -- [-1860.905] (-1864.153) (-1862.651) (-1861.189) * [-1859.460] (-1860.556) (-1860.728) (-1860.631) -- 0:00:41
      366000 -- (-1861.580) (-1864.567) (-1860.963) [-1861.712] * [-1859.781] (-1861.249) (-1862.411) (-1859.088) -- 0:00:41
      366500 -- (-1860.635) (-1862.797) (-1862.334) [-1860.914] * (-1860.688) [-1860.399] (-1862.850) (-1862.847) -- 0:00:41
      367000 -- (-1862.151) (-1860.429) [-1862.317] (-1861.416) * [-1860.556] (-1864.533) (-1859.053) (-1865.555) -- 0:00:41
      367500 -- (-1861.766) [-1861.018] (-1862.802) (-1862.695) * (-1860.744) (-1861.793) [-1859.469] (-1864.642) -- 0:00:41
      368000 -- (-1861.341) (-1861.498) [-1862.120] (-1860.822) * (-1863.009) (-1861.829) [-1859.616] (-1863.782) -- 0:00:41
      368500 -- (-1859.798) (-1860.375) [-1862.422] (-1862.265) * (-1863.089) (-1863.632) [-1859.378] (-1862.959) -- 0:00:41
      369000 -- (-1863.203) (-1860.422) [-1860.088] (-1861.119) * (-1860.742) (-1860.312) [-1861.236] (-1864.596) -- 0:00:42
      369500 -- (-1862.304) [-1860.469] (-1860.452) (-1865.209) * (-1859.846) [-1860.251] (-1861.072) (-1864.591) -- 0:00:42
      370000 -- (-1862.625) (-1867.857) [-1860.209] (-1868.520) * [-1859.277] (-1862.613) (-1859.140) (-1862.668) -- 0:00:42

      Average standard deviation of split frequencies: 0.015785

      370500 -- (-1861.757) (-1862.186) [-1861.326] (-1869.990) * (-1862.600) (-1860.321) [-1859.403] (-1861.897) -- 0:00:42
      371000 -- (-1865.677) [-1862.543] (-1861.752) (-1860.830) * (-1862.100) [-1863.398] (-1860.970) (-1861.457) -- 0:00:42
      371500 -- (-1862.040) [-1860.133] (-1862.246) (-1861.013) * (-1860.673) (-1862.767) [-1860.999] (-1862.477) -- 0:00:42
      372000 -- [-1860.430] (-1860.673) (-1860.954) (-1862.822) * (-1862.394) (-1859.915) (-1859.833) [-1861.386] -- 0:00:42
      372500 -- [-1860.031] (-1860.421) (-1862.285) (-1858.970) * (-1864.818) (-1861.716) [-1860.171] (-1859.679) -- 0:00:42
      373000 -- (-1862.618) [-1860.083] (-1859.656) (-1862.424) * (-1864.391) (-1861.354) (-1862.861) [-1860.456] -- 0:00:42
      373500 -- (-1861.740) [-1860.118] (-1859.316) (-1863.023) * (-1864.679) (-1859.528) [-1862.337] (-1862.954) -- 0:00:41
      374000 -- (-1863.869) (-1861.665) (-1860.657) [-1862.402] * (-1867.074) [-1859.660] (-1863.810) (-1859.033) -- 0:00:41
      374500 -- (-1862.818) (-1860.256) [-1861.345] (-1860.947) * (-1863.360) (-1862.390) (-1861.661) [-1859.033] -- 0:00:41
      375000 -- [-1860.138] (-1859.397) (-1861.268) (-1859.657) * (-1863.928) [-1861.750] (-1863.840) (-1859.429) -- 0:00:41

      Average standard deviation of split frequencies: 0.015192

      375500 -- (-1861.718) (-1859.375) [-1860.859] (-1865.748) * [-1862.520] (-1860.694) (-1863.167) (-1858.930) -- 0:00:41
      376000 -- (-1860.930) (-1859.866) [-1859.897] (-1859.180) * (-1859.193) (-1861.959) [-1863.302] (-1859.391) -- 0:00:41
      376500 -- [-1866.235] (-1859.850) (-1858.969) (-1860.363) * (-1858.627) (-1861.426) (-1859.503) [-1862.350] -- 0:00:41
      377000 -- (-1861.580) [-1860.391] (-1860.258) (-1859.924) * (-1859.034) (-1868.496) [-1859.523] (-1861.919) -- 0:00:41
      377500 -- [-1862.513] (-1859.048) (-1863.849) (-1861.296) * (-1858.896) (-1861.520) [-1859.577] (-1860.303) -- 0:00:41
      378000 -- (-1863.853) [-1859.059] (-1859.992) (-1860.657) * (-1858.896) [-1859.379] (-1863.074) (-1864.463) -- 0:00:41
      378500 -- [-1864.450] (-1861.636) (-1859.989) (-1859.547) * (-1861.078) (-1859.437) [-1865.710] (-1866.596) -- 0:00:41
      379000 -- (-1861.947) [-1859.384] (-1860.684) (-1859.902) * [-1859.407] (-1862.373) (-1862.586) (-1863.165) -- 0:00:40
      379500 -- [-1862.903] (-1865.454) (-1859.528) (-1859.931) * (-1861.455) (-1861.373) [-1860.377] (-1861.683) -- 0:00:40
      380000 -- (-1861.212) (-1860.287) [-1860.159] (-1860.654) * (-1860.079) (-1860.692) (-1860.192) [-1860.863] -- 0:00:40

      Average standard deviation of split frequencies: 0.014350

      380500 -- (-1860.984) [-1861.744] (-1863.546) (-1861.733) * (-1860.019) [-1861.621] (-1861.313) (-1863.056) -- 0:00:40
      381000 -- (-1863.768) (-1861.555) [-1860.794] (-1861.453) * (-1859.471) (-1862.198) (-1860.408) [-1859.561] -- 0:00:40
      381500 -- (-1864.092) (-1859.462) [-1859.548] (-1863.258) * (-1861.711) (-1864.053) [-1859.511] (-1859.619) -- 0:00:40
      382000 -- (-1861.138) (-1860.032) (-1860.387) [-1863.663] * [-1860.204] (-1870.442) (-1859.641) (-1861.863) -- 0:00:40
      382500 -- [-1863.090] (-1863.171) (-1863.241) (-1862.576) * (-1862.691) (-1864.606) [-1859.202] (-1862.318) -- 0:00:40
      383000 -- (-1862.211) (-1859.634) [-1861.991] (-1861.533) * [-1859.605] (-1862.953) (-1862.760) (-1859.898) -- 0:00:40
      383500 -- [-1862.817] (-1859.406) (-1861.545) (-1862.501) * (-1865.433) (-1861.099) [-1860.825] (-1862.120) -- 0:00:40
      384000 -- (-1862.022) (-1860.895) [-1861.598] (-1864.108) * [-1864.016] (-1860.966) (-1860.561) (-1861.991) -- 0:00:41
      384500 -- [-1863.548] (-1860.649) (-1861.320) (-1863.019) * (-1861.415) (-1860.061) [-1860.481] (-1863.446) -- 0:00:41
      385000 -- (-1861.113) (-1861.500) (-1859.416) [-1861.633] * (-1866.068) (-1861.284) (-1861.996) [-1860.304] -- 0:00:41

      Average standard deviation of split frequencies: 0.014727

      385500 -- (-1860.027) (-1860.796) [-1863.474] (-1861.625) * (-1863.177) [-1861.008] (-1862.013) (-1858.689) -- 0:00:41
      386000 -- [-1861.336] (-1865.335) (-1863.217) (-1861.735) * [-1860.886] (-1860.736) (-1861.087) (-1861.025) -- 0:00:41
      386500 -- (-1860.072) (-1864.903) (-1863.412) [-1859.929] * (-1860.111) (-1861.222) (-1861.342) [-1864.412] -- 0:00:41
      387000 -- [-1862.353] (-1861.996) (-1862.913) (-1860.778) * [-1860.139] (-1861.824) (-1860.076) (-1860.404) -- 0:00:41
      387500 -- (-1860.237) (-1859.264) (-1862.844) [-1859.469] * [-1861.107] (-1864.790) (-1862.564) (-1860.501) -- 0:00:41
      388000 -- (-1859.810) [-1859.743] (-1861.137) (-1859.402) * [-1863.846] (-1864.677) (-1859.764) (-1859.835) -- 0:00:41
      388500 -- [-1860.083] (-1859.753) (-1860.679) (-1861.455) * (-1861.230) (-1862.672) [-1858.772] (-1859.413) -- 0:00:40
      389000 -- (-1859.649) [-1861.081] (-1860.446) (-1861.194) * [-1860.719] (-1862.203) (-1860.068) (-1863.057) -- 0:00:40
      389500 -- (-1859.995) (-1859.655) [-1859.436] (-1865.143) * [-1860.000] (-1859.920) (-1862.415) (-1866.683) -- 0:00:40
      390000 -- (-1859.241) (-1859.623) (-1859.527) [-1861.496] * [-1860.025] (-1858.701) (-1866.983) (-1866.277) -- 0:00:40

      Average standard deviation of split frequencies: 0.014551

      390500 -- (-1861.409) [-1860.168] (-1860.890) (-1863.518) * (-1862.548) (-1858.701) [-1863.396] (-1866.130) -- 0:00:40
      391000 -- (-1862.035) (-1859.855) [-1859.696] (-1859.762) * (-1858.852) [-1861.813] (-1859.272) (-1865.219) -- 0:00:40
      391500 -- (-1862.651) (-1861.024) [-1859.600] (-1860.936) * [-1859.076] (-1862.906) (-1859.407) (-1862.017) -- 0:00:40
      392000 -- (-1861.244) (-1859.510) [-1860.407] (-1859.341) * (-1859.814) [-1861.284] (-1860.851) (-1861.070) -- 0:00:40
      392500 -- [-1860.429] (-1859.727) (-1859.531) (-1859.361) * (-1863.431) (-1861.999) (-1861.980) [-1861.013] -- 0:00:40
      393000 -- (-1860.275) (-1858.764) [-1859.120] (-1862.671) * (-1860.179) (-1861.110) [-1861.229] (-1860.419) -- 0:00:40
      393500 -- (-1859.520) (-1859.250) [-1864.456] (-1861.009) * [-1859.015] (-1862.392) (-1863.116) (-1861.801) -- 0:00:40
      394000 -- (-1859.829) (-1862.124) [-1861.236] (-1859.509) * (-1859.567) (-1859.489) (-1861.508) [-1862.261] -- 0:00:39
      394500 -- (-1859.587) (-1868.406) (-1861.330) [-1859.657] * [-1860.035] (-1859.905) (-1859.659) (-1864.281) -- 0:00:39
      395000 -- (-1862.193) [-1863.736] (-1862.362) (-1861.437) * [-1861.279] (-1859.815) (-1859.453) (-1861.173) -- 0:00:39

      Average standard deviation of split frequencies: 0.015125

      395500 -- (-1863.353) [-1868.192] (-1860.582) (-1865.204) * (-1859.839) [-1859.273] (-1861.765) (-1859.624) -- 0:00:39
      396000 -- (-1859.885) (-1866.710) [-1861.436] (-1865.798) * (-1861.087) (-1859.165) [-1860.211] (-1864.517) -- 0:00:39
      396500 -- (-1861.503) (-1865.758) [-1861.681] (-1861.326) * (-1862.312) [-1859.434] (-1860.194) (-1860.317) -- 0:00:39
      397000 -- (-1862.748) (-1867.439) (-1861.215) [-1861.230] * (-1860.468) (-1862.052) (-1861.508) [-1862.991] -- 0:00:39
      397500 -- (-1865.081) (-1866.071) [-1860.892] (-1861.431) * [-1859.634] (-1859.081) (-1861.463) (-1863.182) -- 0:00:39
      398000 -- (-1863.759) [-1861.677] (-1862.275) (-1861.689) * [-1859.936] (-1859.036) (-1862.223) (-1863.750) -- 0:00:39
      398500 -- [-1863.782] (-1860.435) (-1861.650) (-1863.611) * [-1861.296] (-1860.082) (-1859.028) (-1862.776) -- 0:00:39
      399000 -- (-1862.987) [-1861.173] (-1861.229) (-1860.169) * (-1860.809) (-1863.377) (-1860.381) [-1860.092] -- 0:00:40
      399500 -- (-1864.038) [-1859.489] (-1867.589) (-1861.354) * [-1862.874] (-1867.497) (-1859.697) (-1859.407) -- 0:00:40
      400000 -- (-1861.277) (-1860.850) (-1861.270) [-1860.616] * [-1860.991] (-1862.578) (-1862.633) (-1859.174) -- 0:00:40

      Average standard deviation of split frequencies: 0.014326

      400500 -- (-1860.994) (-1861.206) [-1859.390] (-1864.891) * (-1859.521) (-1861.499) [-1859.904] (-1859.395) -- 0:00:40
      401000 -- (-1862.192) (-1861.081) (-1859.732) [-1859.370] * (-1859.193) (-1859.348) [-1861.483] (-1859.846) -- 0:00:40
      401500 -- (-1862.882) [-1861.329] (-1860.656) (-1859.468) * [-1859.512] (-1859.903) (-1860.075) (-1859.543) -- 0:00:40
      402000 -- (-1859.045) (-1859.958) (-1861.003) [-1860.778] * (-1860.769) (-1861.233) (-1859.748) [-1859.786] -- 0:00:40
      402500 -- (-1859.590) (-1863.199) [-1860.979] (-1859.971) * [-1860.271] (-1861.069) (-1860.423) (-1862.637) -- 0:00:40
      403000 -- (-1859.328) (-1862.419) [-1863.573] (-1860.319) * (-1862.092) (-1860.811) [-1859.379] (-1859.287) -- 0:00:39
      403500 -- (-1859.277) (-1862.867) (-1860.660) [-1863.472] * (-1861.225) (-1862.944) (-1860.366) [-1860.394] -- 0:00:39
      404000 -- (-1861.847) (-1862.115) [-1861.110] (-1861.727) * (-1862.805) (-1859.826) (-1859.254) [-1860.224] -- 0:00:39
      404500 -- (-1861.708) [-1861.236] (-1862.890) (-1860.342) * [-1863.518] (-1859.651) (-1861.263) (-1859.435) -- 0:00:39
      405000 -- (-1859.224) [-1860.296] (-1861.105) (-1861.717) * [-1861.219] (-1860.025) (-1863.373) (-1862.464) -- 0:00:39

      Average standard deviation of split frequencies: 0.014070

      405500 -- (-1859.400) [-1861.433] (-1859.304) (-1865.557) * (-1861.873) [-1860.386] (-1866.705) (-1859.176) -- 0:00:39
      406000 -- (-1858.924) (-1860.942) [-1859.231] (-1865.567) * (-1862.063) (-1859.378) (-1861.587) [-1858.658] -- 0:00:39
      406500 -- (-1861.259) [-1861.313] (-1859.237) (-1865.758) * (-1864.844) (-1861.105) (-1859.969) [-1858.480] -- 0:00:39
      407000 -- (-1865.850) [-1861.950] (-1859.926) (-1864.163) * (-1861.218) (-1861.696) [-1859.898] (-1859.702) -- 0:00:39
      407500 -- [-1861.055] (-1862.266) (-1859.283) (-1860.681) * [-1860.368] (-1861.594) (-1862.285) (-1861.863) -- 0:00:39
      408000 -- (-1859.779) (-1861.858) (-1858.852) [-1865.209] * [-1860.459] (-1860.538) (-1860.939) (-1860.725) -- 0:00:39
      408500 -- [-1860.069] (-1861.030) (-1865.092) (-1861.345) * (-1862.039) [-1860.825] (-1862.852) (-1860.788) -- 0:00:39
      409000 -- [-1860.439] (-1861.558) (-1865.374) (-1863.826) * (-1862.578) (-1864.593) [-1862.603] (-1862.856) -- 0:00:39
      409500 -- [-1860.844] (-1860.516) (-1861.142) (-1863.265) * (-1862.517) (-1863.913) [-1859.565] (-1861.139) -- 0:00:38
      410000 -- (-1858.864) (-1860.658) (-18