--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:24:56 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/sucC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1612.50         -1615.50
2      -1612.50         -1616.75
--------------------------------------
TOTAL    -1612.50         -1616.31
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895892    0.087357    0.365056    1.476019    0.870393   1501.00   1501.00    1.000
r(A<->C){all}   0.169237    0.021717    0.000054    0.471195    0.129973    133.81    138.38    1.012
r(A<->G){all}   0.164642    0.019232    0.000215    0.436873    0.127877    311.50    341.78    1.000
r(A<->T){all}   0.167376    0.019656    0.000050    0.447994    0.129342    143.83    146.02    1.000
r(C<->G){all}   0.165995    0.019414    0.000048    0.445555    0.126951    151.38    223.49    1.001
r(C<->T){all}   0.173209    0.021412    0.000162    0.470042    0.131211    238.95    321.52    1.001
r(G<->T){all}   0.159542    0.018516    0.000023    0.436607    0.124826    203.40    219.28    1.001
pi(A){all}      0.220081    0.000150    0.195057    0.243440    0.220296   1437.17   1469.09    1.000
pi(C){all}      0.278531    0.000171    0.253273    0.303984    0.278682   1055.09   1082.92    1.000
pi(G){all}      0.314303    0.000181    0.287284    0.339671    0.314570   1145.84   1244.77    1.000
pi(T){all}      0.187085    0.000127    0.165527    0.210093    0.187156   1325.28   1395.41    1.000
alpha{1,2}      0.439060    0.249325    0.000114    1.435679    0.269793   1188.86   1291.41    1.000
alpha{3}        0.462473    0.242756    0.000251    1.483219    0.297069   1039.76   1205.92    1.000
pinvar{all}     0.998746    0.000002    0.995929    0.999999    0.999220   1154.44   1161.40    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1522.938275
Model 2: PositiveSelection	-1522.93808
Model 0: one-ratio	-1522.93808
Model 7: beta	-1522.93808
Model 8: beta&w>1	-1522.93808


Model 0 vs 1	3.9000000015221303E-4

Model 2 vs 1	3.9000000015221303E-4

Model 8 vs 7	0.0
>C1
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C2
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C3
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C4
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C5
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C6
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=393 

C1              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C2              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C3              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C4              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C5              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C6              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
                **************************************************

C1              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C2              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C3              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C4              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C5              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C6              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
                **************************************************

C1              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C2              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C3              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C4              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C5              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C6              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
                **************************************************

C1              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C2              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C3              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C4              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C5              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C6              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
                **************************************************

C1              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C2              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C3              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C4              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C5              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C6              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
                **************************************************

C1              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C2              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C3              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C4              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C5              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C6              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
                **************************************************

C1              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C2              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C3              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C4              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C5              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C6              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
                **************************************************

C1              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C2              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C3              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C4              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C5              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C6              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
                *******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  393 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  393 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11790]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [11790]--->[11790]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.521 Mb, Max= 30.962 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C2              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C3              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C4              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C5              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
C6              MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
                **************************************************

C1              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C2              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C3              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C4              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C5              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
C6              GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
                **************************************************

C1              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C2              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C3              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C4              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C5              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
C6              YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
                **************************************************

C1              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C2              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C3              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C4              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C5              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
C6              CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
                **************************************************

C1              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C2              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C3              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C4              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C5              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
C6              YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
                **************************************************

C1              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C2              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C3              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C4              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C5              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
C6              IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
                **************************************************

C1              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C2              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C3              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C4              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C5              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
C6              MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
                **************************************************

C1              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C2              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C3              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C4              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C5              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
C6              VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
                *******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
C2              ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
C3              ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
C4              ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
C5              ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
C6              ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
                **************************************************

C1              CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
C2              CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
C3              CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
C4              CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
C5              CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
C6              CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
                **************************************************

C1              TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
C2              TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
C3              TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
C4              TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
C5              TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
C6              TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
                **************************************************

C1              GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
C2              GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
C3              GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
C4              GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
C5              GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
C6              GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
                **************************************************

C1              AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
C2              AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
C3              AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
C4              AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
C5              AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
C6              AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
                **************************************************

C1              TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
C2              TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
C3              TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
C4              TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
C5              TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
C6              TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
                **************************************************

C1              TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
C2              TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
C3              TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
C4              TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
C5              TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
C6              TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
                **************************************************

C1              CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
C2              CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
C3              CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
C4              CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
C5              CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
C6              CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
                **************************************************

C1              AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
C2              AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
C3              AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
C4              AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
C5              AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
C6              AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
                **************************************************

C1              TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
C2              TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
C3              TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
C4              TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
C5              TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
C6              TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
                **************************************************

C1              CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
C2              CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
C3              CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
C4              CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
C5              CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
C6              CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
                **************************************************

C1              ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
C2              ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
C3              ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
C4              ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
C5              ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
C6              ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
                **************************************************

C1              TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
C2              TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
C3              TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
C4              TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
C5              TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
C6              TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
                **************************************************

C1              TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
C2              TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
C3              TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
C4              TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
C5              TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
C6              TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
                **************************************************

C1              CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
C2              CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
C3              CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
C4              CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
C5              CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
C6              CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
                **************************************************

C1              ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
C2              ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
C3              ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
C4              ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
C5              ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
C6              ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
                **************************************************

C1              CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
C2              CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
C3              CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
C4              CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
C5              CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
C6              CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
                **************************************************

C1              TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
C2              TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
C3              TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
C4              TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
C5              TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
C6              TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
                **************************************************

C1              ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
C2              ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
C3              ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
C4              ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
C5              ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
C6              ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
                **************************************************

C1              GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
C2              GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
C3              GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
C4              GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
C5              GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
C6              GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
                **************************************************

C1              GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
C2              GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
C3              GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
C4              GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
C5              GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
C6              GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
                **************************************************

C1              GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
C2              GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
C3              GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
C4              GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
C5              GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
C6              GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
                **************************************************

C1              CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
C2              CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
C3              CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
C4              CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
C5              CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
C6              CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
                **************************************************

C1              CTAACAAGGCCGCCGAGTTGGCCCGCACT
C2              CTAACAAGGCCGCCGAGTTGGCCCGCACT
C3              CTAACAAGGCCGCCGAGTTGGCCCGCACT
C4              CTAACAAGGCCGCCGAGTTGGCCCGCACT
C5              CTAACAAGGCCGCCGAGTTGGCCCGCACT
C6              CTAACAAGGCCGCCGAGTTGGCCCGCACT
                *****************************



>C1
ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
CTAACAAGGCCGCCGAGTTGGCCCGCACT
>C2
ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
CTAACAAGGCCGCCGAGTTGGCCCGCACT
>C3
ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
CTAACAAGGCCGCCGAGTTGGCCCGCACT
>C4
ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
CTAACAAGGCCGCCGAGTTGGCCCGCACT
>C5
ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
CTAACAAGGCCGCCGAGTTGGCCCGCACT
>C6
ATGGATCTTTTCGAGTATCAAGCTAAGGAATTGTTCGCCAAGCACGGCGT
CCCTGGCATACAAGGACGGGTGACCGACAGCGCGGAAGGCGCTAAGACCA
TCGCCATGGAGATTGGTCGTCCCGTAATGGTGAAAGCTCAGGTAAAAACA
GGCGGGCGAGGCAAAGCGGGTGGCGTCAAATATGCTGCCACCCCAGAAGA
AGCCTACCAACAGGCCAAGAACATTCTTGGCCTGGACATAAAAGGCCATA
TTGTCAAGAAATTGCTGGTGGTCGAAGCTAGCGACATCGCCGAGGAATAC
TATCTCTCCTTCCTGCTCGACCGTGCCAACCGAACATACCTTGCGATGTG
CTCGGTGGAAGGCGGCATGGAAATCGAAGAGGTGGCCGCCACCAAGCCTG
AGCGACTGGCCAAGGTCTCGGTGGACGCGGTAAAGGGTGTAGATTTAGCC
TGCGCACGCTCTATTGCGCAGCAGGGCCATCTGCCGGCTGAGGTGCTCGA
CGCCGCCGCGGCCACCATCGCCAAGTTGTGGGAACTCTTTGTAGCCGAGG
ACGCCACCCTGGTGGAGGTCAACCCGTTGGTGCGCACTCCCTCCCGCGGG
TACGGAAGCTCGGGCAAGATTTTGGCGCTGGACGGCAAGGTCACTCTTGA
TGCCAACGCCCGCTTCCGCCAGCCCGGCCATGCCGAGTTCGAAGATCGCG
CGGCCACTGATCCGCTGGAGTGGAAGGCCAAGCAGCACAACCTCAACTAC
ATCAAGCTCGACGGTGAGGTGGGGATCATCGGTAACGGCGCGGGTCTGAC
CATGTCGACCTTCGACGTCGTCGCCTATGCAGGGGAACAGCACGGGGGGG
TTAAGCCGGCCAACTTCCTCGATATCGGTGGCGGCGCTTCCGCTGAGGTG
ATGGCTGCCAGTCTGGACGTAGTTCTGGGCGACGTTCAGGTCAAGAGCGT
GTTCGTCAACATATTCGGTGGGATTACCACATGTGACACCGTCGCTACCG
GAATTGTCAAGGCATTGGAAATCTTGGGTGATGAGGCCAACAAGCCTTTA
GTGGTGCGCCTGGACGGCAATAACGTCGGTGAAGGCCGACGCATCCTGGC
CGAGGCCAACCATCCGCTAGTGATGCTGGTCCCGACGATGGACGAGGCCG
CTAACAAGGCCGCCGAGTTGGCCCGCACT
>C1
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C2
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C3
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C4
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C5
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
>C6
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKT
GGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEY
YLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLA
CARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRG
YGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNY
IKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEV
MAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPL
VVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1179 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579789414
      Setting output file names to "/data/12res/sucC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1654164570
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0211766293
      Seed = 217218013
      Swapseed = 1579789414
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2638.658523 -- -24.965149
         Chain 2 -- -2638.658523 -- -24.965149
         Chain 3 -- -2638.658523 -- -24.965149
         Chain 4 -- -2638.658523 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2638.658372 -- -24.965149
         Chain 2 -- -2638.658523 -- -24.965149
         Chain 3 -- -2638.658372 -- -24.965149
         Chain 4 -- -2638.658523 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2638.659] (-2638.659) (-2638.659) (-2638.659) * [-2638.658] (-2638.659) (-2638.658) (-2638.659) 
        500 -- (-1633.961) [-1622.452] (-1615.983) (-1629.973) * (-1631.954) (-1621.530) [-1631.210] (-1627.505) -- 0:00:00
       1000 -- (-1617.766) [-1618.967] (-1620.125) (-1625.016) * (-1628.517) (-1623.755) [-1622.572] (-1627.414) -- 0:00:00
       1500 -- (-1626.186) (-1626.740) (-1624.393) [-1623.394] * [-1621.612] (-1625.383) (-1636.755) (-1631.733) -- 0:00:00
       2000 -- [-1621.909] (-1619.965) (-1623.743) (-1621.531) * [-1621.045] (-1630.600) (-1621.632) (-1622.438) -- 0:00:00
       2500 -- (-1625.202) (-1637.029) [-1621.039] (-1620.589) * (-1623.202) [-1629.822] (-1623.394) (-1631.443) -- 0:00:00
       3000 -- (-1618.620) (-1626.700) [-1621.087] (-1641.173) * (-1626.678) [-1621.057] (-1622.336) (-1617.271) -- 0:00:00
       3500 -- (-1622.256) (-1621.473) [-1625.292] (-1619.626) * (-1615.919) (-1628.095) [-1623.731] (-1619.915) -- 0:00:00
       4000 -- (-1631.128) (-1628.541) (-1620.807) [-1622.177] * (-1626.422) (-1619.702) [-1624.334] (-1621.470) -- 0:00:00
       4500 -- (-1627.242) [-1618.758] (-1632.776) (-1626.785) * [-1617.320] (-1623.022) (-1620.911) (-1621.777) -- 0:00:00
       5000 -- (-1616.432) (-1626.974) (-1621.524) [-1623.019] * [-1621.958] (-1623.245) (-1624.150) (-1623.117) -- 0:00:00

      Average standard deviation of split frequencies: 0.064282

       5500 -- [-1620.352] (-1620.419) (-1620.848) (-1620.728) * [-1622.947] (-1621.095) (-1633.347) (-1617.283) -- 0:00:00
       6000 -- [-1625.144] (-1619.773) (-1618.375) (-1629.204) * (-1619.402) [-1623.826] (-1621.562) (-1615.064) -- 0:00:00
       6500 -- (-1625.681) (-1625.281) [-1627.830] (-1618.964) * (-1620.047) (-1621.677) (-1620.531) [-1620.271] -- 0:00:00
       7000 -- (-1624.438) (-1629.144) [-1622.282] (-1621.010) * (-1620.674) (-1624.473) (-1626.443) [-1617.146] -- 0:00:00
       7500 -- (-1620.042) (-1621.448) (-1622.135) [-1625.792] * (-1628.652) (-1624.171) (-1626.794) [-1616.880] -- 0:00:00
       8000 -- (-1620.105) (-1617.868) [-1630.470] (-1620.278) * (-1626.392) [-1618.601] (-1625.679) (-1623.922) -- 0:00:00
       8500 -- (-1625.374) (-1622.332) [-1620.852] (-1620.794) * [-1618.150] (-1623.525) (-1618.163) (-1626.031) -- 0:00:00
       9000 -- (-1621.589) (-1623.174) [-1618.116] (-1621.533) * (-1620.518) (-1622.159) (-1623.294) [-1615.769] -- 0:00:00
       9500 -- (-1620.421) (-1618.801) [-1619.045] (-1623.532) * (-1625.515) (-1623.102) (-1621.603) [-1621.343] -- 0:00:00
      10000 -- (-1629.062) (-1625.367) [-1622.998] (-1623.516) * (-1633.411) (-1620.748) [-1628.176] (-1629.393) -- 0:00:00

      Average standard deviation of split frequencies: 0.063836

      10500 -- (-1621.107) [-1620.312] (-1622.622) (-1626.633) * (-1626.670) (-1625.278) (-1622.817) [-1625.606] -- 0:00:00
      11000 -- (-1618.275) (-1624.951) [-1625.715] (-1622.118) * (-1629.394) (-1617.033) (-1619.304) [-1623.723] -- 0:00:00
      11500 -- (-1627.046) [-1628.848] (-1623.239) (-1630.691) * (-1625.089) (-1626.609) [-1623.132] (-1622.153) -- 0:00:00
      12000 -- [-1627.272] (-1623.901) (-1628.077) (-1631.067) * [-1624.486] (-1620.395) (-1626.071) (-1617.548) -- 0:01:22
      12500 -- (-1623.840) (-1622.265) (-1621.401) [-1627.289] * (-1620.664) [-1620.169] (-1626.644) (-1629.444) -- 0:01:19
      13000 -- (-1623.051) [-1620.442] (-1624.813) (-1623.109) * (-1619.487) (-1621.707) (-1622.483) [-1623.445] -- 0:01:15
      13500 -- (-1627.052) (-1636.434) [-1616.873] (-1618.957) * (-1624.742) [-1621.315] (-1625.389) (-1622.820) -- 0:01:13
      14000 -- (-1624.920) (-1625.951) [-1617.957] (-1619.739) * (-1619.294) (-1620.711) (-1624.901) [-1618.249] -- 0:01:10
      14500 -- [-1619.633] (-1620.493) (-1622.150) (-1625.606) * (-1624.373) [-1624.898] (-1620.866) (-1620.869) -- 0:01:07
      15000 -- (-1618.139) (-1620.880) (-1623.653) [-1620.549] * [-1619.723] (-1623.233) (-1624.842) (-1624.842) -- 0:01:05

      Average standard deviation of split frequencies: 0.062608

      15500 -- (-1617.868) (-1636.090) (-1624.086) [-1622.132] * [-1627.909] (-1624.601) (-1621.091) (-1619.235) -- 0:01:03
      16000 -- (-1624.889) (-1624.701) (-1624.402) [-1623.937] * (-1617.966) (-1617.019) [-1621.188] (-1618.798) -- 0:01:01
      16500 -- [-1620.045] (-1624.075) (-1619.266) (-1628.236) * (-1623.466) (-1618.509) (-1627.451) [-1619.427] -- 0:00:59
      17000 -- (-1627.043) (-1623.929) (-1628.800) [-1617.824] * (-1627.414) (-1623.103) [-1622.282] (-1628.324) -- 0:00:57
      17500 -- (-1623.661) [-1620.055] (-1621.524) (-1623.238) * (-1623.049) [-1625.496] (-1630.588) (-1620.887) -- 0:00:56
      18000 -- (-1626.525) (-1619.481) (-1618.798) [-1620.162] * (-1625.008) (-1620.453) (-1621.825) [-1624.214] -- 0:00:54
      18500 -- (-1616.274) [-1615.868] (-1613.242) (-1629.496) * [-1617.863] (-1623.965) (-1620.067) (-1625.017) -- 0:00:53
      19000 -- (-1616.512) (-1621.818) [-1612.375] (-1622.918) * [-1621.980] (-1621.257) (-1616.616) (-1622.926) -- 0:00:51
      19500 -- (-1628.345) (-1619.940) (-1616.188) [-1617.922] * (-1624.157) (-1620.655) (-1627.157) [-1619.919] -- 0:00:50
      20000 -- (-1621.230) [-1623.003] (-1614.630) (-1626.800) * (-1620.066) [-1625.262] (-1623.590) (-1621.098) -- 0:00:49

      Average standard deviation of split frequencies: 0.051956

      20500 -- (-1627.330) [-1618.654] (-1615.565) (-1620.932) * (-1620.035) [-1617.083] (-1626.099) (-1623.927) -- 0:00:47
      21000 -- (-1621.930) (-1625.813) (-1613.053) [-1624.696] * (-1622.621) [-1621.354] (-1615.880) (-1618.418) -- 0:00:46
      21500 -- (-1619.551) (-1624.885) [-1614.449] (-1625.475) * (-1620.953) [-1621.097] (-1619.382) (-1621.474) -- 0:00:45
      22000 -- (-1624.321) [-1622.186] (-1613.815) (-1622.879) * [-1621.341] (-1630.673) (-1616.870) (-1625.345) -- 0:00:44
      22500 -- (-1619.926) (-1621.092) [-1611.692] (-1623.433) * (-1624.505) (-1619.436) [-1618.377] (-1624.127) -- 0:00:43
      23000 -- (-1618.953) (-1631.328) (-1617.789) [-1622.130] * [-1623.862] (-1618.898) (-1614.532) (-1622.746) -- 0:00:42
      23500 -- (-1625.202) (-1616.429) [-1612.465] (-1618.318) * (-1619.641) (-1618.061) (-1614.681) [-1618.075] -- 0:00:41
      24000 -- [-1624.115] (-1626.881) (-1612.655) (-1620.711) * [-1621.464] (-1624.773) (-1614.547) (-1614.328) -- 0:00:40
      24500 -- (-1625.768) (-1625.740) [-1613.718] (-1619.524) * (-1621.522) (-1631.562) [-1617.310] (-1612.022) -- 0:00:39
      25000 -- (-1625.492) [-1618.326] (-1613.057) (-1621.888) * (-1620.367) (-1632.230) [-1616.303] (-1613.308) -- 0:00:39

      Average standard deviation of split frequencies: 0.038982

      25500 -- (-1623.877) (-1617.379) [-1615.342] (-1618.673) * (-1622.477) (-1635.938) [-1613.702] (-1612.671) -- 0:01:16
      26000 -- (-1621.991) [-1615.609] (-1613.049) (-1622.474) * (-1624.260) (-1622.521) [-1613.307] (-1611.940) -- 0:01:14
      26500 -- (-1618.714) [-1623.756] (-1614.987) (-1627.073) * (-1625.861) (-1620.359) [-1612.833] (-1614.343) -- 0:01:13
      27000 -- (-1613.254) [-1622.698] (-1616.764) (-1620.270) * [-1620.647] (-1617.016) (-1614.045) (-1613.677) -- 0:01:12
      27500 -- (-1616.619) [-1623.860] (-1615.759) (-1629.562) * (-1619.752) (-1622.024) [-1613.836] (-1610.854) -- 0:01:10
      28000 -- (-1617.468) (-1620.358) (-1615.396) [-1620.888] * (-1626.085) (-1622.924) (-1613.290) [-1613.705] -- 0:01:09
      28500 -- (-1614.516) [-1619.420] (-1615.062) (-1615.645) * (-1619.602) [-1620.011] (-1614.644) (-1611.628) -- 0:01:08
      29000 -- (-1614.574) (-1629.153) [-1612.615] (-1619.520) * [-1625.225] (-1625.354) (-1618.853) (-1613.431) -- 0:01:06
      29500 -- [-1612.038] (-1623.303) (-1613.264) (-1621.377) * (-1618.563) (-1625.444) (-1614.990) [-1614.065] -- 0:01:05
      30000 -- (-1611.273) (-1616.550) [-1613.378] (-1626.077) * [-1626.778] (-1623.974) (-1614.381) (-1613.750) -- 0:01:04

      Average standard deviation of split frequencies: 0.037661

      30500 -- (-1611.272) (-1621.281) [-1614.731] (-1629.620) * [-1619.275] (-1629.070) (-1619.209) (-1613.377) -- 0:01:03
      31000 -- (-1611.272) [-1621.745] (-1612.967) (-1624.023) * [-1631.243] (-1632.082) (-1613.401) (-1613.609) -- 0:01:02
      31500 -- (-1613.629) (-1621.754) [-1612.595] (-1622.538) * [-1622.284] (-1625.877) (-1615.752) (-1615.459) -- 0:01:01
      32000 -- [-1613.294] (-1620.810) (-1616.079) (-1617.899) * [-1621.190] (-1620.323) (-1616.462) (-1614.544) -- 0:01:00
      32500 -- (-1618.948) (-1621.223) (-1613.152) [-1618.197] * (-1621.909) [-1619.944] (-1612.437) (-1615.260) -- 0:00:59
      33000 -- (-1615.675) (-1625.892) [-1612.913] (-1624.369) * (-1620.690) (-1623.144) [-1611.233] (-1612.274) -- 0:00:58
      33500 -- (-1616.249) (-1623.017) (-1615.197) [-1618.057] * [-1615.907] (-1628.281) (-1611.270) (-1611.303) -- 0:00:57
      34000 -- (-1611.968) [-1626.116] (-1615.039) (-1632.435) * (-1618.360) [-1628.110] (-1612.737) (-1617.259) -- 0:00:56
      34500 -- (-1612.130) (-1619.949) (-1616.155) [-1617.699] * [-1621.938] (-1623.656) (-1617.766) (-1614.203) -- 0:00:55
      35000 -- [-1612.037] (-1621.538) (-1616.488) (-1624.702) * (-1626.469) [-1619.251] (-1615.788) (-1612.764) -- 0:00:55

      Average standard deviation of split frequencies: 0.034459

      35500 -- (-1610.874) (-1628.604) [-1613.304] (-1629.449) * [-1620.497] (-1620.351) (-1613.940) (-1612.355) -- 0:00:54
      36000 -- (-1611.027) [-1624.681] (-1616.758) (-1621.909) * [-1625.220] (-1621.277) (-1616.003) (-1614.097) -- 0:00:53
      36500 -- [-1611.131] (-1623.399) (-1614.395) (-1627.916) * (-1619.884) [-1625.671] (-1612.922) (-1615.623) -- 0:00:52
      37000 -- [-1611.157] (-1626.791) (-1613.653) (-1635.574) * [-1619.503] (-1622.755) (-1615.561) (-1611.305) -- 0:00:52
      37500 -- [-1611.146] (-1622.259) (-1613.676) (-1629.463) * [-1622.426] (-1626.855) (-1616.194) (-1611.605) -- 0:00:51
      38000 -- [-1611.878] (-1619.530) (-1615.724) (-1623.899) * (-1633.660) (-1624.291) [-1612.621] (-1613.105) -- 0:00:50
      38500 -- (-1610.990) (-1619.271) [-1615.228] (-1625.395) * (-1625.119) (-1629.533) (-1611.858) [-1613.528] -- 0:00:49
      39000 -- (-1610.988) (-1623.709) (-1614.083) [-1621.866] * (-1624.204) (-1620.626) [-1612.893] (-1616.648) -- 0:00:49
      39500 -- (-1617.255) [-1620.691] (-1617.396) (-1624.023) * (-1628.712) (-1619.059) [-1612.524] (-1613.299) -- 0:01:12
      40000 -- (-1615.400) (-1621.556) (-1618.200) [-1620.245] * [-1622.470] (-1621.110) (-1617.449) (-1613.299) -- 0:01:12

      Average standard deviation of split frequencies: 0.037996

      40500 -- (-1615.257) [-1621.508] (-1623.658) (-1622.407) * [-1624.030] (-1619.450) (-1612.041) (-1612.873) -- 0:01:11
      41000 -- (-1613.718) [-1628.472] (-1613.128) (-1623.850) * (-1626.028) (-1622.599) (-1613.820) [-1611.216] -- 0:01:10
      41500 -- (-1616.946) (-1625.593) (-1613.989) [-1616.033] * (-1623.338) (-1622.158) [-1611.615] (-1611.635) -- 0:01:09
      42000 -- (-1614.492) [-1618.526] (-1616.182) (-1619.221) * [-1618.268] (-1621.162) (-1614.025) (-1614.162) -- 0:01:08
      42500 -- (-1615.932) [-1618.624] (-1613.162) (-1624.615) * [-1619.517] (-1621.315) (-1611.041) (-1613.669) -- 0:01:07
      43000 -- (-1613.246) (-1616.367) (-1613.214) [-1618.943] * (-1625.284) (-1625.108) (-1612.488) [-1614.158] -- 0:01:06
      43500 -- [-1613.255] (-1623.741) (-1615.781) (-1627.909) * (-1626.278) [-1620.093] (-1613.441) (-1612.838) -- 0:01:05
      44000 -- [-1611.432] (-1619.357) (-1612.463) (-1622.289) * (-1617.789) [-1620.755] (-1614.853) (-1613.079) -- 0:01:05
      44500 -- (-1611.847) (-1618.700) (-1614.661) [-1619.797] * (-1623.856) [-1618.048] (-1612.734) (-1614.503) -- 0:01:04
      45000 -- (-1611.847) (-1623.135) [-1614.373] (-1629.738) * (-1631.666) [-1625.125] (-1611.330) (-1612.983) -- 0:01:03

      Average standard deviation of split frequencies: 0.033306

      45500 -- (-1612.201) (-1619.690) [-1615.032] (-1623.643) * (-1619.885) [-1619.379] (-1612.453) (-1615.294) -- 0:01:02
      46000 -- (-1614.612) (-1619.514) (-1613.771) [-1628.145] * (-1623.039) (-1618.874) [-1615.871] (-1615.309) -- 0:01:02
      46500 -- (-1613.909) [-1618.184] (-1614.575) (-1625.133) * (-1623.542) (-1622.823) (-1611.204) [-1613.771] -- 0:01:01
      47000 -- (-1611.717) (-1611.666) [-1614.352] (-1630.968) * (-1625.581) (-1625.901) [-1611.718] (-1613.413) -- 0:01:00
      47500 -- (-1611.717) (-1611.401) [-1616.409] (-1626.500) * [-1621.930] (-1641.115) (-1612.700) (-1614.345) -- 0:01:00
      48000 -- (-1611.967) (-1614.201) (-1618.850) [-1625.692] * (-1622.381) [-1619.476] (-1614.866) (-1615.146) -- 0:00:59
      48500 -- (-1613.672) (-1614.219) [-1612.091] (-1621.904) * (-1626.986) (-1625.036) (-1616.041) [-1614.326] -- 0:00:58
      49000 -- [-1613.934] (-1611.677) (-1612.498) (-1622.105) * (-1620.097) [-1621.061] (-1616.705) (-1614.645) -- 0:00:58
      49500 -- (-1617.422) (-1611.800) (-1614.409) [-1621.319] * (-1619.432) (-1627.541) (-1618.107) [-1612.398] -- 0:00:57
      50000 -- [-1611.959] (-1612.270) (-1615.391) (-1622.592) * (-1619.576) [-1620.790] (-1616.355) (-1611.352) -- 0:00:57

      Average standard deviation of split frequencies: 0.034768

      50500 -- (-1611.818) (-1615.967) [-1612.645] (-1620.763) * (-1616.076) (-1624.886) (-1615.074) [-1611.673] -- 0:00:56
      51000 -- [-1612.241] (-1614.818) (-1616.235) (-1622.924) * (-1621.839) (-1625.355) (-1617.412) [-1612.129] -- 0:00:55
      51500 -- (-1614.169) (-1613.087) [-1614.500] (-1620.869) * (-1627.100) (-1632.661) (-1619.367) [-1611.599] -- 0:00:55
      52000 -- (-1611.908) [-1613.282] (-1613.511) (-1631.963) * [-1619.382] (-1613.735) (-1613.197) (-1611.527) -- 0:00:54
      52500 -- (-1614.324) [-1614.246] (-1615.466) (-1628.006) * [-1619.801] (-1616.598) (-1613.628) (-1614.039) -- 0:00:54
      53000 -- (-1615.352) (-1615.894) [-1612.330] (-1626.715) * (-1624.733) (-1616.299) [-1614.303] (-1613.988) -- 0:01:11
      53500 -- (-1615.675) [-1612.226] (-1614.015) (-1618.981) * [-1623.720] (-1612.512) (-1617.864) (-1612.463) -- 0:01:10
      54000 -- (-1614.350) [-1611.741] (-1616.075) (-1623.456) * (-1623.462) (-1612.308) (-1616.083) [-1612.460] -- 0:01:10
      54500 -- [-1614.625] (-1612.939) (-1613.842) (-1626.706) * (-1630.367) (-1613.405) [-1614.579] (-1613.051) -- 0:01:09
      55000 -- (-1613.475) (-1614.679) (-1616.002) [-1623.934] * (-1625.948) (-1612.455) (-1614.030) [-1612.395] -- 0:01:08

      Average standard deviation of split frequencies: 0.031900

      55500 -- (-1612.243) (-1614.776) [-1613.899] (-1627.778) * [-1623.287] (-1611.558) (-1614.157) (-1612.521) -- 0:01:08
      56000 -- (-1611.385) (-1613.025) [-1613.841] (-1622.310) * (-1620.645) (-1611.971) [-1614.291] (-1612.341) -- 0:01:07
      56500 -- (-1612.554) (-1612.460) (-1611.805) [-1623.900] * (-1631.241) [-1611.971] (-1614.245) (-1612.979) -- 0:01:06
      57000 -- (-1612.739) (-1612.811) [-1613.125] (-1622.873) * [-1616.607] (-1611.301) (-1614.594) (-1611.650) -- 0:01:06
      57500 -- (-1614.382) (-1615.328) (-1614.001) [-1623.841] * (-1634.872) (-1611.997) [-1612.450] (-1614.494) -- 0:01:05
      58000 -- (-1620.145) (-1611.501) [-1615.341] (-1624.758) * [-1615.772] (-1611.605) (-1612.017) (-1613.457) -- 0:01:04
      58500 -- (-1613.284) [-1612.209] (-1613.675) (-1625.405) * (-1613.727) [-1610.927] (-1615.341) (-1613.078) -- 0:01:04
      59000 -- (-1612.812) [-1612.926] (-1614.268) (-1622.824) * (-1613.438) (-1610.927) [-1612.784] (-1613.141) -- 0:01:03
      59500 -- [-1612.061] (-1613.162) (-1614.878) (-1623.911) * (-1615.773) (-1612.658) [-1611.535] (-1612.509) -- 0:01:03
      60000 -- (-1613.125) (-1612.827) [-1614.153] (-1631.163) * (-1614.284) [-1613.147] (-1612.320) (-1613.153) -- 0:01:02

      Average standard deviation of split frequencies: 0.028628

      60500 -- (-1613.190) [-1612.628] (-1615.358) (-1619.480) * (-1614.650) (-1614.303) [-1613.357] (-1614.387) -- 0:01:02
      61000 -- [-1613.499] (-1613.378) (-1616.650) (-1621.767) * (-1616.192) (-1613.419) [-1613.027] (-1615.832) -- 0:01:01
      61500 -- (-1611.465) [-1613.371] (-1612.378) (-1627.210) * (-1616.180) (-1613.488) (-1612.979) [-1614.218] -- 0:01:01
      62000 -- [-1612.001] (-1612.730) (-1612.101) (-1621.632) * (-1616.556) (-1613.219) (-1612.183) [-1612.510] -- 0:01:00
      62500 -- (-1612.789) (-1611.628) [-1611.792] (-1624.399) * (-1612.964) [-1613.792] (-1611.669) (-1613.315) -- 0:01:00
      63000 -- [-1612.016] (-1614.402) (-1612.813) (-1619.065) * (-1611.435) (-1614.082) [-1611.251] (-1613.353) -- 0:00:59
      63500 -- (-1613.419) [-1613.086] (-1613.344) (-1622.361) * (-1611.954) (-1610.949) (-1616.686) [-1613.672] -- 0:00:58
      64000 -- (-1614.766) (-1613.600) [-1613.835] (-1626.690) * (-1612.982) [-1611.554] (-1612.608) (-1613.399) -- 0:00:58
      64500 -- [-1612.114] (-1614.433) (-1612.736) (-1623.735) * (-1613.252) (-1611.004) [-1613.673] (-1611.969) -- 0:00:58
      65000 -- (-1612.709) [-1613.135] (-1611.573) (-1632.685) * [-1612.848] (-1611.840) (-1612.534) (-1612.849) -- 0:00:57

      Average standard deviation of split frequencies: 0.029250

      65500 -- (-1615.680) (-1612.853) (-1611.481) [-1619.020] * [-1611.819] (-1611.163) (-1613.878) (-1612.438) -- 0:00:57
      66000 -- (-1614.267) [-1613.239] (-1614.428) (-1626.326) * [-1616.801] (-1611.052) (-1613.382) (-1614.893) -- 0:01:10
      66500 -- (-1613.224) (-1612.892) [-1615.033] (-1623.744) * [-1612.979] (-1611.301) (-1614.150) (-1614.181) -- 0:01:10
      67000 -- (-1612.687) [-1612.569] (-1614.578) (-1624.188) * (-1612.813) [-1617.561] (-1615.939) (-1611.911) -- 0:01:09
      67500 -- (-1613.205) [-1610.931] (-1614.116) (-1619.443) * (-1612.477) (-1613.400) (-1618.912) [-1612.667] -- 0:01:09
      68000 -- (-1613.360) (-1613.411) (-1616.100) [-1619.093] * (-1612.439) (-1614.354) (-1617.505) [-1612.971] -- 0:01:08
      68500 -- (-1613.308) (-1614.630) (-1614.624) [-1626.916] * (-1612.867) (-1616.972) [-1612.043] (-1616.127) -- 0:01:07
      69000 -- (-1615.563) [-1612.313] (-1613.235) (-1618.578) * (-1614.512) [-1615.195] (-1611.722) (-1617.075) -- 0:01:07
      69500 -- (-1613.201) (-1621.164) [-1612.311] (-1623.430) * (-1612.738) (-1614.386) [-1612.000] (-1614.642) -- 0:01:06
      70000 -- (-1611.097) [-1613.043] (-1612.655) (-1628.315) * [-1611.602] (-1613.485) (-1613.035) (-1612.802) -- 0:01:06

      Average standard deviation of split frequencies: 0.029860

      70500 -- (-1611.378) [-1615.713] (-1611.827) (-1623.583) * (-1616.895) (-1615.210) (-1613.713) [-1617.640] -- 0:01:05
      71000 -- (-1612.692) (-1616.114) (-1614.558) [-1621.452] * (-1612.707) (-1615.172) (-1612.749) [-1613.991] -- 0:01:05
      71500 -- [-1613.087] (-1615.920) (-1613.530) (-1620.104) * (-1612.825) (-1616.730) (-1613.597) [-1611.625] -- 0:01:04
      72000 -- (-1613.756) [-1615.433] (-1616.528) (-1618.698) * (-1613.437) (-1614.012) [-1613.755] (-1612.124) -- 0:01:04
      72500 -- (-1613.917) [-1616.229] (-1613.662) (-1624.685) * (-1617.255) [-1612.740] (-1612.944) (-1611.503) -- 0:01:03
      73000 -- (-1616.593) (-1619.315) (-1614.369) [-1623.708] * [-1616.109] (-1613.544) (-1615.276) (-1611.446) -- 0:01:03
      73500 -- [-1611.945] (-1615.482) (-1613.123) (-1622.964) * (-1611.970) (-1612.817) (-1617.543) [-1616.018] -- 0:01:03
      74000 -- (-1611.286) (-1616.325) (-1615.183) [-1618.829] * (-1612.670) (-1612.726) [-1611.841] (-1614.034) -- 0:01:02
      74500 -- (-1612.493) (-1611.541) (-1615.976) [-1620.986] * [-1613.128] (-1611.390) (-1612.446) (-1612.326) -- 0:01:02
      75000 -- (-1611.880) [-1611.130] (-1615.685) (-1624.085) * (-1613.747) (-1611.411) [-1611.610] (-1611.973) -- 0:01:01

      Average standard deviation of split frequencies: 0.027469

      75500 -- [-1612.857] (-1613.003) (-1613.927) (-1617.945) * (-1612.705) (-1611.956) (-1611.575) [-1612.376] -- 0:01:01
      76000 -- (-1614.933) (-1613.096) [-1614.385] (-1619.581) * [-1612.548] (-1613.156) (-1613.679) (-1612.197) -- 0:01:00
      76500 -- (-1612.347) (-1612.177) (-1613.544) [-1612.917] * (-1611.280) (-1613.629) [-1612.021] (-1613.791) -- 0:01:00
      77000 -- [-1613.602] (-1612.212) (-1613.173) (-1613.767) * [-1611.265] (-1614.842) (-1611.904) (-1613.691) -- 0:00:59
      77500 -- (-1612.299) (-1615.330) [-1613.034] (-1613.803) * (-1614.803) [-1611.555] (-1613.440) (-1613.321) -- 0:00:59
      78000 -- (-1613.273) (-1613.970) (-1613.051) [-1617.152] * [-1612.480] (-1612.069) (-1612.750) (-1615.728) -- 0:00:59
      78500 -- (-1613.152) (-1611.576) [-1613.335] (-1614.826) * (-1611.982) (-1611.200) (-1613.233) [-1613.336] -- 0:00:58
      79000 -- [-1612.256] (-1612.701) (-1615.657) (-1615.677) * (-1613.300) (-1616.099) [-1613.553] (-1612.885) -- 0:00:58
      79500 -- [-1613.167] (-1612.733) (-1615.583) (-1615.628) * (-1614.188) (-1612.291) [-1614.610] (-1614.103) -- 0:01:09
      80000 -- [-1611.187] (-1613.879) (-1618.086) (-1613.091) * (-1620.025) [-1611.591] (-1614.691) (-1615.606) -- 0:01:09

      Average standard deviation of split frequencies: 0.027758

      80500 -- (-1612.719) (-1614.988) (-1613.695) [-1612.875] * (-1615.406) [-1611.590] (-1616.408) (-1613.720) -- 0:01:08
      81000 -- [-1611.935] (-1612.561) (-1615.075) (-1611.948) * [-1612.357] (-1614.197) (-1612.864) (-1615.943) -- 0:01:08
      81500 -- (-1611.050) (-1611.109) (-1612.704) [-1612.352] * (-1611.925) [-1614.530] (-1612.479) (-1614.455) -- 0:01:07
      82000 -- (-1615.209) (-1611.803) [-1611.420] (-1615.489) * (-1613.404) [-1615.150] (-1611.749) (-1617.464) -- 0:01:07
      82500 -- [-1612.487] (-1612.520) (-1614.596) (-1612.580) * [-1613.524] (-1612.773) (-1612.580) (-1615.112) -- 0:01:06
      83000 -- (-1613.344) (-1613.624) [-1613.686] (-1622.175) * (-1612.521) [-1612.505] (-1613.398) (-1612.905) -- 0:01:06
      83500 -- (-1615.476) (-1614.550) [-1614.823] (-1613.714) * (-1612.393) (-1612.891) (-1611.316) [-1613.634] -- 0:01:05
      84000 -- (-1613.450) [-1613.252] (-1613.504) (-1613.710) * [-1612.699] (-1613.989) (-1611.965) (-1615.326) -- 0:01:05
      84500 -- [-1613.614] (-1614.812) (-1613.261) (-1613.440) * (-1612.968) [-1612.885] (-1612.611) (-1612.548) -- 0:01:05
      85000 -- (-1614.608) [-1613.593] (-1613.130) (-1613.018) * [-1611.549] (-1611.277) (-1612.611) (-1612.449) -- 0:01:04

      Average standard deviation of split frequencies: 0.024797

      85500 -- (-1613.973) (-1611.490) [-1612.297] (-1611.125) * [-1611.558] (-1611.267) (-1613.536) (-1611.370) -- 0:01:04
      86000 -- (-1613.636) (-1611.928) (-1615.432) [-1611.142] * (-1611.685) [-1616.119] (-1613.195) (-1612.352) -- 0:01:03
      86500 -- [-1612.279] (-1611.816) (-1611.973) (-1616.650) * (-1611.882) (-1621.918) (-1613.194) [-1612.319] -- 0:01:03
      87000 -- [-1611.351] (-1611.830) (-1613.131) (-1615.290) * (-1613.039) [-1615.426] (-1613.677) (-1612.321) -- 0:01:02
      87500 -- [-1612.154] (-1612.902) (-1614.356) (-1613.282) * (-1612.878) (-1613.486) [-1612.791] (-1615.080) -- 0:01:02
      88000 -- [-1612.125] (-1614.235) (-1612.688) (-1611.875) * (-1612.657) (-1613.482) (-1612.750) [-1616.131] -- 0:01:02
      88500 -- [-1617.055] (-1613.006) (-1612.099) (-1611.584) * (-1613.850) (-1612.695) (-1613.495) [-1612.703] -- 0:01:01
      89000 -- (-1613.539) (-1614.253) (-1611.567) [-1611.621] * (-1613.858) (-1611.937) (-1613.809) [-1613.485] -- 0:01:01
      89500 -- [-1611.620] (-1612.940) (-1611.567) (-1610.946) * (-1612.685) (-1613.447) (-1615.698) [-1611.354] -- 0:01:01
      90000 -- [-1612.190] (-1611.897) (-1611.519) (-1612.862) * (-1611.759) (-1613.081) [-1616.813] (-1612.285) -- 0:01:00

      Average standard deviation of split frequencies: 0.025997

      90500 -- (-1612.594) (-1612.771) (-1614.314) [-1611.501] * (-1613.211) [-1612.964] (-1619.670) (-1614.668) -- 0:01:00
      91000 -- (-1612.966) [-1612.205] (-1612.627) (-1612.325) * (-1614.690) [-1614.237] (-1613.765) (-1615.391) -- 0:00:59
      91500 -- (-1611.921) (-1612.872) (-1612.092) [-1611.791] * (-1613.001) (-1611.764) (-1612.803) [-1613.931] -- 0:00:59
      92000 -- [-1612.415] (-1612.767) (-1612.016) (-1614.988) * (-1611.639) [-1611.994] (-1611.738) (-1613.450) -- 0:00:59
      92500 -- (-1613.026) (-1612.267) [-1612.916] (-1613.073) * (-1614.282) [-1611.995] (-1613.974) (-1614.300) -- 0:00:58
      93000 -- (-1612.492) [-1612.181] (-1612.603) (-1616.849) * (-1611.738) (-1611.468) (-1613.498) [-1612.547] -- 0:00:58
      93500 -- (-1611.715) (-1614.259) [-1613.581] (-1617.857) * (-1612.326) [-1614.849] (-1613.094) (-1613.405) -- 0:00:58
      94000 -- [-1615.608] (-1612.378) (-1614.189) (-1615.496) * (-1612.733) (-1614.691) [-1615.278] (-1614.793) -- 0:01:07
      94500 -- (-1617.064) (-1613.040) [-1614.154] (-1614.695) * (-1613.274) [-1615.506] (-1616.161) (-1616.974) -- 0:01:07
      95000 -- (-1613.403) (-1611.050) [-1615.042] (-1612.112) * [-1611.673] (-1615.232) (-1614.944) (-1618.253) -- 0:01:06

      Average standard deviation of split frequencies: 0.021968

      95500 -- (-1613.283) (-1610.996) [-1615.701] (-1614.315) * [-1612.117] (-1615.461) (-1613.779) (-1615.144) -- 0:01:06
      96000 -- (-1612.831) (-1612.314) [-1613.789] (-1613.929) * (-1611.301) [-1614.698] (-1616.400) (-1612.155) -- 0:01:05
      96500 -- [-1612.488] (-1612.327) (-1614.955) (-1615.251) * (-1615.721) [-1614.494] (-1615.796) (-1614.826) -- 0:01:05
      97000 -- [-1613.301] (-1612.351) (-1616.626) (-1617.224) * (-1611.893) (-1616.327) (-1612.628) [-1614.942] -- 0:01:05
      97500 -- (-1613.254) (-1611.977) (-1613.755) [-1618.009] * (-1611.431) (-1612.270) [-1612.726] (-1612.709) -- 0:01:04
      98000 -- (-1617.043) (-1611.868) (-1614.964) [-1613.020] * (-1613.577) [-1612.980] (-1613.396) (-1614.926) -- 0:01:04
      98500 -- (-1614.685) (-1613.340) [-1612.345] (-1618.358) * [-1613.856] (-1614.904) (-1612.732) (-1614.632) -- 0:01:04
      99000 -- (-1616.183) [-1613.566] (-1611.868) (-1614.665) * (-1613.904) (-1615.142) (-1615.585) [-1612.534] -- 0:01:03
      99500 -- [-1613.464] (-1614.737) (-1612.752) (-1617.828) * (-1612.068) [-1612.518] (-1615.475) (-1616.623) -- 0:01:03
      100000 -- [-1614.365] (-1614.739) (-1612.557) (-1617.417) * (-1612.711) (-1612.509) [-1612.719] (-1616.141) -- 0:01:02

      Average standard deviation of split frequencies: 0.024266

      100500 -- (-1614.407) (-1614.942) [-1612.490] (-1615.029) * (-1613.367) (-1612.742) (-1616.519) [-1615.232] -- 0:01:02
      101000 -- (-1612.982) (-1614.018) (-1613.030) [-1613.748] * (-1612.442) [-1613.543] (-1614.885) (-1620.560) -- 0:01:02
      101500 -- (-1612.422) (-1612.883) (-1611.836) [-1615.764] * (-1612.551) (-1613.269) (-1615.722) [-1616.285] -- 0:01:01
      102000 -- (-1612.152) [-1612.563] (-1615.921) (-1615.439) * [-1614.421] (-1615.297) (-1619.664) (-1612.088) -- 0:01:01
      102500 -- (-1614.643) (-1613.241) [-1613.070] (-1613.471) * (-1612.603) [-1611.274] (-1619.851) (-1613.845) -- 0:01:01
      103000 -- (-1614.962) (-1613.597) [-1615.170] (-1613.260) * (-1613.521) [-1612.466] (-1619.968) (-1612.619) -- 0:01:00
      103500 -- (-1613.083) (-1613.803) (-1612.422) [-1612.145] * (-1617.509) (-1611.105) [-1616.712] (-1612.321) -- 0:01:00
      104000 -- (-1617.659) [-1621.112] (-1614.738) (-1614.039) * (-1618.280) (-1611.640) (-1615.965) [-1613.695] -- 0:01:00
      104500 -- [-1614.277] (-1615.163) (-1614.212) (-1611.421) * (-1615.707) (-1611.640) [-1613.894] (-1612.409) -- 0:00:59
      105000 -- [-1614.874] (-1612.612) (-1611.986) (-1610.895) * (-1613.370) (-1612.234) (-1612.607) [-1612.365] -- 0:00:59

      Average standard deviation of split frequencies: 0.026683

      105500 -- (-1613.249) (-1613.011) [-1612.186] (-1611.969) * (-1616.702) (-1611.413) (-1611.493) [-1613.453] -- 0:00:59
      106000 -- (-1613.143) (-1617.564) [-1612.175] (-1611.919) * (-1612.227) (-1612.803) (-1611.344) [-1612.759] -- 0:00:59
      106500 -- (-1612.242) (-1614.377) [-1611.677] (-1613.060) * (-1613.141) (-1612.037) [-1611.221] (-1612.346) -- 0:00:58
      107000 -- (-1617.142) (-1619.313) [-1611.587] (-1613.657) * (-1614.814) (-1613.894) [-1612.509] (-1613.575) -- 0:00:58
      107500 -- (-1616.977) [-1613.884] (-1619.798) (-1612.543) * (-1614.737) (-1614.168) (-1611.112) [-1615.349] -- 0:00:58
      108000 -- (-1618.765) (-1612.148) (-1619.470) [-1614.328] * (-1613.373) [-1612.025] (-1612.631) (-1612.372) -- 0:00:57
      108500 -- (-1612.580) [-1611.155] (-1613.792) (-1617.079) * [-1617.532] (-1611.919) (-1612.150) (-1612.185) -- 0:00:57
      109000 -- (-1617.487) [-1613.175] (-1613.863) (-1612.903) * (-1615.091) (-1612.802) [-1611.284] (-1612.264) -- 0:01:05
      109500 -- (-1611.666) (-1611.396) [-1612.076] (-1612.037) * (-1614.259) [-1611.730] (-1615.752) (-1614.308) -- 0:01:05
      110000 -- (-1616.631) (-1613.146) [-1612.971] (-1617.996) * (-1611.459) (-1614.406) (-1612.835) [-1612.306] -- 0:01:04

      Average standard deviation of split frequencies: 0.024341

      110500 -- (-1611.933) [-1612.040] (-1612.729) (-1611.322) * (-1613.851) (-1613.503) (-1612.956) [-1614.255] -- 0:01:04
      111000 -- (-1613.809) (-1613.433) [-1612.490] (-1612.297) * (-1616.076) (-1613.475) (-1611.973) [-1611.706] -- 0:01:04
      111500 -- (-1612.161) (-1614.110) [-1613.111] (-1612.704) * (-1615.709) [-1613.207] (-1614.705) (-1612.140) -- 0:01:03
      112000 -- (-1614.641) (-1612.057) [-1613.414] (-1616.691) * (-1613.365) [-1612.967] (-1611.527) (-1615.314) -- 0:01:03
      112500 -- (-1614.637) [-1613.108] (-1615.323) (-1613.858) * (-1612.094) (-1614.405) (-1611.480) [-1612.162] -- 0:01:03
      113000 -- (-1616.823) [-1612.726] (-1615.689) (-1613.604) * [-1611.932] (-1613.649) (-1614.000) (-1613.785) -- 0:01:02
      113500 -- [-1615.956] (-1614.568) (-1615.829) (-1612.965) * (-1612.351) (-1614.534) [-1612.304] (-1612.218) -- 0:01:02
      114000 -- (-1615.078) (-1611.812) (-1615.761) [-1613.418] * (-1613.930) (-1613.489) (-1612.102) [-1611.698] -- 0:01:02
      114500 -- (-1614.226) (-1611.766) (-1614.999) [-1613.907] * (-1614.732) (-1612.837) [-1612.054] (-1611.341) -- 0:01:01
      115000 -- (-1616.114) (-1612.863) (-1615.371) [-1613.454] * (-1612.925) (-1613.854) (-1612.361) [-1611.341] -- 0:01:01

      Average standard deviation of split frequencies: 0.021742

      115500 -- (-1613.046) (-1611.694) [-1613.821] (-1613.840) * (-1613.487) (-1614.332) (-1611.974) [-1611.666] -- 0:01:01
      116000 -- (-1616.904) (-1611.693) [-1612.114] (-1617.344) * [-1614.194] (-1614.576) (-1611.737) (-1612.261) -- 0:01:00
      116500 -- (-1616.018) [-1611.413] (-1613.731) (-1613.460) * [-1611.990] (-1612.258) (-1614.097) (-1612.966) -- 0:01:00
      117000 -- (-1616.528) (-1611.412) (-1612.563) [-1611.890] * (-1614.190) [-1612.212] (-1613.088) (-1612.525) -- 0:01:00
      117500 -- (-1614.736) (-1613.701) [-1614.238] (-1613.353) * (-1613.869) (-1612.127) (-1612.628) [-1612.781] -- 0:01:00
      118000 -- [-1612.672] (-1611.632) (-1613.466) (-1616.515) * [-1613.963] (-1614.578) (-1621.750) (-1612.668) -- 0:00:59
      118500 -- [-1611.330] (-1611.473) (-1613.531) (-1615.369) * (-1616.613) [-1615.323] (-1618.855) (-1612.668) -- 0:00:59
      119000 -- (-1612.284) (-1611.000) (-1612.418) [-1614.077] * (-1613.879) (-1613.019) (-1615.079) [-1611.938] -- 0:00:59
      119500 -- [-1615.952] (-1613.827) (-1612.595) (-1614.125) * (-1614.623) [-1616.130] (-1613.981) (-1611.687) -- 0:00:58
      120000 -- (-1612.001) (-1615.868) [-1612.456] (-1612.741) * (-1612.597) (-1612.904) [-1612.327] (-1612.662) -- 0:00:58

      Average standard deviation of split frequencies: 0.022206

      120500 -- (-1612.717) (-1613.965) (-1615.412) [-1612.861] * (-1612.427) [-1612.846] (-1612.128) (-1611.248) -- 0:00:58
      121000 -- (-1612.074) (-1614.172) (-1616.868) [-1611.930] * (-1612.923) (-1613.502) (-1612.274) [-1613.805] -- 0:00:58
      121500 -- (-1610.896) (-1615.592) [-1616.232] (-1612.967) * (-1613.307) (-1618.257) [-1612.285] (-1615.600) -- 0:00:57
      122000 -- (-1611.038) (-1614.928) [-1616.748] (-1612.354) * [-1614.659] (-1618.788) (-1611.073) (-1611.754) -- 0:00:57
      122500 -- (-1611.377) (-1613.277) [-1614.087] (-1616.324) * (-1613.085) (-1619.495) [-1615.295] (-1613.002) -- 0:00:57
      123000 -- (-1612.579) (-1612.733) [-1613.867] (-1619.369) * (-1612.947) (-1617.399) [-1612.755] (-1612.186) -- 0:00:57
      123500 -- (-1615.356) [-1613.518] (-1611.840) (-1614.415) * (-1612.959) [-1616.934] (-1613.792) (-1612.868) -- 0:00:56
      124000 -- [-1613.328] (-1613.729) (-1612.936) (-1615.479) * [-1614.070] (-1614.036) (-1616.275) (-1612.307) -- 0:00:56
      124500 -- (-1611.109) [-1617.284] (-1614.445) (-1614.236) * (-1612.823) (-1612.705) [-1613.599] (-1613.502) -- 0:01:03
      125000 -- (-1613.201) [-1612.460] (-1615.296) (-1614.358) * [-1616.626] (-1612.964) (-1615.026) (-1612.928) -- 0:01:03

      Average standard deviation of split frequencies: 0.021463

      125500 -- (-1611.795) (-1613.806) [-1611.737] (-1612.408) * (-1617.122) [-1614.021] (-1617.431) (-1614.755) -- 0:01:02
      126000 -- (-1612.143) [-1613.237] (-1612.039) (-1613.278) * [-1616.645] (-1615.908) (-1615.893) (-1612.831) -- 0:01:02
      126500 -- (-1613.824) [-1612.664] (-1612.229) (-1614.348) * (-1614.649) (-1613.682) (-1615.850) [-1615.148] -- 0:01:02
      127000 -- [-1613.005] (-1613.871) (-1612.475) (-1614.472) * (-1619.124) (-1613.747) (-1615.096) [-1616.770] -- 0:01:01
      127500 -- [-1612.714] (-1612.676) (-1613.510) (-1615.629) * (-1613.005) [-1613.353] (-1613.105) (-1617.457) -- 0:01:01
      128000 -- (-1612.712) (-1615.683) [-1615.619] (-1613.074) * (-1611.806) (-1612.608) (-1613.630) [-1613.610] -- 0:01:01
      128500 -- [-1612.164] (-1612.452) (-1619.550) (-1612.994) * [-1614.023] (-1619.566) (-1613.050) (-1612.925) -- 0:01:01
      129000 -- (-1612.212) (-1613.447) (-1615.653) [-1615.175] * (-1614.944) [-1612.460] (-1613.907) (-1616.547) -- 0:01:00
      129500 -- (-1614.112) (-1611.459) (-1616.878) [-1614.660] * [-1614.018] (-1614.534) (-1611.929) (-1613.770) -- 0:01:00
      130000 -- (-1612.768) [-1612.216] (-1612.766) (-1613.763) * (-1615.798) [-1614.166] (-1613.017) (-1611.614) -- 0:01:00

      Average standard deviation of split frequencies: 0.021646

      130500 -- [-1612.056] (-1613.122) (-1617.259) (-1613.732) * (-1614.343) [-1621.039] (-1613.204) (-1613.242) -- 0:00:59
      131000 -- (-1612.418) [-1612.839] (-1613.427) (-1612.974) * (-1612.771) (-1612.264) [-1613.151] (-1613.892) -- 0:00:59
      131500 -- (-1614.455) (-1612.480) (-1613.549) [-1615.240] * (-1611.595) (-1614.422) (-1614.638) [-1612.483] -- 0:00:59
      132000 -- (-1615.098) (-1615.648) (-1612.972) [-1613.291] * (-1611.144) (-1614.865) [-1615.679] (-1612.745) -- 0:00:59
      132500 -- (-1614.965) (-1614.633) (-1614.304) [-1613.312] * (-1612.620) (-1613.160) (-1614.835) [-1613.997] -- 0:00:58
      133000 -- (-1614.616) [-1612.952] (-1623.865) (-1612.752) * [-1612.433] (-1612.252) (-1617.363) (-1613.467) -- 0:00:58
      133500 -- (-1614.276) (-1615.286) (-1620.537) [-1612.818] * (-1611.373) (-1612.465) (-1614.459) [-1614.313] -- 0:00:58
      134000 -- (-1612.969) (-1618.305) (-1613.712) [-1612.254] * [-1613.383] (-1613.584) (-1613.695) (-1613.233) -- 0:00:58
      134500 -- [-1614.612] (-1622.082) (-1612.847) (-1614.991) * (-1611.574) [-1612.507] (-1611.940) (-1612.952) -- 0:00:57
      135000 -- [-1613.452] (-1619.616) (-1612.929) (-1611.870) * (-1619.096) [-1613.122] (-1616.934) (-1612.539) -- 0:00:57

      Average standard deviation of split frequencies: 0.021144

      135500 -- [-1611.811] (-1612.877) (-1612.237) (-1611.874) * (-1618.582) (-1612.515) [-1615.613] (-1613.342) -- 0:00:57
      136000 -- (-1611.972) (-1612.946) [-1614.239] (-1612.459) * (-1614.815) (-1612.638) (-1614.442) [-1613.837] -- 0:00:57
      136500 -- (-1614.828) [-1614.646] (-1613.223) (-1612.777) * (-1615.204) (-1612.618) [-1614.167] (-1612.737) -- 0:00:56
      137000 -- (-1613.265) (-1613.580) (-1611.623) [-1612.334] * (-1612.233) (-1613.546) [-1614.478] (-1611.398) -- 0:00:56
      137500 -- (-1611.619) (-1612.149) [-1611.930] (-1612.422) * [-1612.994] (-1613.191) (-1612.902) (-1614.723) -- 0:00:56
      138000 -- (-1614.474) (-1611.343) [-1612.279] (-1611.386) * (-1613.233) (-1612.733) (-1614.128) [-1615.220] -- 0:00:56
      138500 -- (-1612.042) (-1611.699) [-1612.606] (-1615.070) * (-1612.770) (-1613.030) [-1613.453] (-1613.662) -- 0:00:55
      139000 -- [-1612.731] (-1611.499) (-1612.526) (-1614.649) * (-1612.503) (-1614.156) (-1612.836) [-1616.825] -- 0:00:55
      139500 -- [-1616.270] (-1611.372) (-1611.730) (-1614.503) * [-1615.514] (-1613.015) (-1613.488) (-1616.790) -- 0:00:55
      140000 -- (-1615.465) [-1611.590] (-1614.450) (-1613.936) * (-1612.553) (-1612.921) [-1612.040] (-1618.344) -- 0:01:01

      Average standard deviation of split frequencies: 0.020107

      140500 -- (-1613.169) (-1612.282) [-1613.122] (-1613.170) * (-1611.957) [-1611.948] (-1611.550) (-1616.061) -- 0:01:01
      141000 -- (-1616.453) (-1612.248) (-1611.969) [-1613.630] * [-1614.483] (-1613.732) (-1613.925) (-1618.007) -- 0:01:00
      141500 -- [-1614.882] (-1612.188) (-1611.970) (-1614.711) * (-1615.793) [-1613.748] (-1614.815) (-1617.787) -- 0:01:00
      142000 -- (-1614.623) [-1612.730] (-1613.492) (-1614.601) * (-1616.133) [-1613.313] (-1613.431) (-1614.288) -- 0:01:00
      142500 -- [-1612.811] (-1613.259) (-1614.189) (-1615.556) * (-1616.761) [-1615.708] (-1614.138) (-1614.972) -- 0:01:00
      143000 -- (-1614.164) [-1615.376] (-1614.067) (-1614.137) * (-1618.440) (-1614.227) [-1612.181] (-1615.695) -- 0:00:59
      143500 -- [-1611.286] (-1613.735) (-1616.945) (-1615.910) * (-1618.571) (-1614.521) [-1611.094] (-1612.061) -- 0:00:59
      144000 -- (-1611.744) [-1612.743] (-1615.931) (-1617.072) * (-1617.756) (-1618.842) (-1619.936) [-1617.285] -- 0:00:59
      144500 -- (-1611.244) [-1611.897] (-1612.568) (-1612.973) * (-1611.959) (-1616.891) [-1614.540] (-1616.731) -- 0:00:59
      145000 -- (-1612.906) [-1612.573] (-1613.552) (-1617.494) * (-1612.049) [-1611.692] (-1613.927) (-1611.990) -- 0:00:58

      Average standard deviation of split frequencies: 0.017164

      145500 -- (-1611.939) [-1615.674] (-1612.708) (-1617.081) * (-1611.937) (-1612.414) (-1612.074) [-1611.510] -- 0:00:58
      146000 -- (-1613.863) [-1612.946] (-1612.534) (-1617.247) * (-1614.495) (-1612.770) (-1612.947) [-1615.943] -- 0:00:58
      146500 -- [-1611.538] (-1612.873) (-1615.621) (-1618.121) * [-1613.240] (-1611.225) (-1613.971) (-1618.840) -- 0:00:58
      147000 -- (-1613.657) (-1614.782) [-1614.822] (-1616.260) * (-1615.003) (-1611.349) [-1615.025] (-1618.426) -- 0:00:58
      147500 -- [-1615.477] (-1614.495) (-1613.593) (-1615.351) * (-1614.398) (-1611.325) (-1616.246) [-1613.155] -- 0:00:57
      148000 -- (-1612.833) (-1613.356) (-1616.491) [-1611.822] * (-1615.720) [-1612.530] (-1611.650) (-1612.841) -- 0:00:57
      148500 -- (-1613.312) (-1614.822) (-1615.146) [-1612.645] * (-1616.329) (-1611.833) [-1615.247] (-1612.804) -- 0:00:57
      149000 -- [-1616.750] (-1614.555) (-1613.457) (-1613.319) * (-1614.291) [-1611.839] (-1612.451) (-1613.331) -- 0:00:57
      149500 -- (-1612.940) (-1615.698) (-1614.441) [-1612.102] * (-1611.960) (-1612.206) (-1613.270) [-1612.239] -- 0:00:56
      150000 -- (-1613.926) (-1616.185) (-1611.980) [-1611.639] * (-1612.136) (-1612.175) (-1613.504) [-1612.817] -- 0:00:56

      Average standard deviation of split frequencies: 0.018147

      150500 -- [-1614.349] (-1613.021) (-1614.611) (-1615.277) * [-1612.236] (-1611.920) (-1615.037) (-1613.574) -- 0:00:56
      151000 -- (-1615.391) (-1613.903) (-1613.604) [-1614.297] * (-1612.587) [-1613.968] (-1612.267) (-1614.551) -- 0:00:56
      151500 -- (-1615.941) (-1614.198) (-1615.332) [-1614.434] * (-1612.061) (-1613.604) [-1612.940] (-1613.677) -- 0:00:56
      152000 -- [-1614.546] (-1614.400) (-1618.458) (-1622.452) * [-1615.404] (-1614.147) (-1612.497) (-1611.859) -- 0:00:55
      152500 -- (-1614.272) (-1616.408) (-1616.294) [-1614.048] * (-1614.252) (-1612.496) [-1611.655] (-1611.684) -- 0:00:55
      153000 -- (-1615.052) [-1614.539] (-1615.057) (-1612.483) * [-1614.288] (-1612.646) (-1611.393) (-1615.579) -- 0:00:55
      153500 -- (-1612.512) (-1613.173) (-1612.044) [-1611.776] * (-1613.146) [-1613.804] (-1611.621) (-1613.036) -- 0:00:55
      154000 -- (-1612.554) (-1613.311) [-1613.591] (-1613.969) * (-1613.283) [-1613.541] (-1614.130) (-1614.742) -- 0:01:00
      154500 -- (-1616.087) (-1614.550) [-1613.265] (-1615.429) * (-1616.554) [-1611.518] (-1613.942) (-1619.289) -- 0:01:00
      155000 -- (-1613.820) [-1614.222] (-1615.700) (-1613.015) * (-1611.415) (-1611.414) [-1612.250] (-1613.428) -- 0:00:59

      Average standard deviation of split frequencies: 0.020835

      155500 -- (-1612.032) (-1615.331) (-1614.820) [-1613.972] * (-1613.336) [-1612.101] (-1612.142) (-1614.616) -- 0:00:59
      156000 -- (-1612.728) [-1616.518] (-1612.904) (-1617.903) * (-1613.923) (-1615.099) (-1613.659) [-1613.149] -- 0:00:59
      156500 -- [-1612.342] (-1617.718) (-1614.908) (-1612.666) * (-1612.154) (-1617.862) [-1618.678] (-1614.236) -- 0:00:59
      157000 -- (-1611.823) (-1613.923) (-1611.997) [-1614.149] * (-1611.736) (-1613.015) [-1613.587] (-1614.444) -- 0:00:59
      157500 -- (-1611.823) [-1612.295] (-1610.952) (-1614.801) * (-1613.118) [-1612.258] (-1614.251) (-1613.297) -- 0:00:58
      158000 -- (-1611.236) (-1614.629) [-1610.837] (-1616.097) * (-1614.346) (-1612.127) (-1612.132) [-1613.334] -- 0:00:58
      158500 -- (-1611.738) (-1612.622) (-1611.993) [-1613.293] * (-1612.741) (-1611.810) (-1613.541) [-1613.220] -- 0:00:58
      159000 -- (-1615.218) (-1611.351) [-1612.935] (-1613.627) * (-1612.751) [-1612.647] (-1613.394) (-1611.994) -- 0:00:58
      159500 -- [-1613.818] (-1611.353) (-1612.379) (-1615.703) * (-1612.679) (-1612.972) (-1613.303) [-1613.303] -- 0:00:57
      160000 -- (-1613.535) (-1612.994) [-1614.479] (-1611.382) * (-1612.530) (-1613.173) (-1615.039) [-1614.422] -- 0:00:57

      Average standard deviation of split frequencies: 0.018840

      160500 -- [-1614.295] (-1614.483) (-1612.831) (-1616.455) * [-1612.600] (-1613.700) (-1612.235) (-1616.768) -- 0:00:57
      161000 -- (-1613.431) [-1612.962] (-1611.569) (-1613.758) * (-1611.942) (-1612.611) [-1615.719] (-1617.377) -- 0:00:57
      161500 -- (-1612.754) (-1615.591) [-1612.286] (-1612.782) * (-1611.816) [-1612.602] (-1612.376) (-1615.454) -- 0:00:57
      162000 -- [-1613.695] (-1621.055) (-1611.728) (-1612.773) * (-1612.474) [-1612.385] (-1612.766) (-1615.359) -- 0:00:56
      162500 -- (-1613.805) [-1610.929] (-1613.059) (-1612.075) * [-1614.767] (-1611.444) (-1616.038) (-1612.555) -- 0:00:56
      163000 -- (-1614.453) (-1611.539) (-1617.824) [-1612.795] * (-1619.609) (-1612.784) [-1615.725] (-1612.979) -- 0:00:56
      163500 -- (-1614.306) (-1615.810) [-1612.597] (-1614.598) * (-1616.269) (-1612.172) (-1616.091) [-1615.058] -- 0:00:56
      164000 -- (-1613.208) (-1613.304) (-1613.932) [-1614.822] * (-1613.189) [-1612.173] (-1618.917) (-1613.807) -- 0:00:56
      164500 -- (-1617.127) [-1611.913] (-1614.776) (-1612.402) * (-1612.495) [-1612.194] (-1614.018) (-1614.077) -- 0:00:55
      165000 -- (-1618.773) (-1611.915) (-1614.240) [-1612.317] * (-1615.482) [-1611.641] (-1615.828) (-1613.225) -- 0:00:55

      Average standard deviation of split frequencies: 0.019729

      165500 -- [-1617.559] (-1612.232) (-1613.039) (-1613.304) * (-1614.545) (-1611.494) (-1614.886) [-1620.573] -- 0:00:55
      166000 -- [-1615.724] (-1612.462) (-1612.680) (-1614.311) * [-1612.550] (-1613.074) (-1611.900) (-1613.616) -- 0:00:55
      166500 -- (-1615.310) (-1613.311) (-1614.275) [-1614.761] * (-1612.936) (-1613.890) (-1612.016) [-1615.122] -- 0:00:55
      167000 -- (-1612.807) (-1614.086) [-1614.287] (-1613.335) * (-1612.801) (-1615.855) (-1614.715) [-1611.555] -- 0:00:54
      167500 -- [-1612.976] (-1613.730) (-1614.809) (-1613.862) * [-1612.576] (-1613.221) (-1613.979) (-1611.164) -- 0:00:54
      168000 -- (-1613.109) [-1612.965] (-1616.581) (-1613.488) * (-1611.744) (-1614.278) [-1614.273] (-1611.056) -- 0:00:54
      168500 -- (-1612.211) (-1617.954) (-1618.020) [-1613.715] * (-1616.647) (-1614.219) [-1612.845] (-1611.011) -- 0:00:54
      169000 -- (-1612.906) (-1614.754) (-1614.234) [-1613.763] * (-1616.873) (-1611.852) (-1613.031) [-1613.025] -- 0:00:54
      169500 -- (-1611.414) [-1613.720] (-1613.210) (-1612.681) * [-1613.515] (-1611.237) (-1613.480) (-1612.829) -- 0:00:53
      170000 -- (-1612.651) (-1616.117) (-1614.897) [-1611.392] * (-1613.183) (-1611.918) (-1619.088) [-1612.736] -- 0:00:58

      Average standard deviation of split frequencies: 0.018608

      170500 -- (-1612.771) (-1614.668) (-1615.474) [-1611.131] * (-1612.087) (-1612.340) (-1612.785) [-1612.109] -- 0:00:58
      171000 -- (-1613.088) (-1613.231) (-1613.508) [-1613.854] * (-1611.375) (-1612.271) [-1611.385] (-1614.107) -- 0:00:58
      171500 -- (-1617.356) (-1612.140) [-1612.875] (-1615.884) * (-1614.894) (-1612.920) [-1612.603] (-1612.850) -- 0:00:57
      172000 -- (-1612.705) (-1612.815) [-1612.943] (-1616.327) * (-1612.372) [-1614.747] (-1613.846) (-1613.223) -- 0:00:57
      172500 -- [-1614.602] (-1612.316) (-1616.455) (-1613.609) * [-1612.698] (-1612.106) (-1612.220) (-1612.589) -- 0:00:57
      173000 -- (-1613.738) (-1612.649) [-1613.031] (-1611.610) * [-1611.923] (-1611.671) (-1611.304) (-1612.914) -- 0:00:57
      173500 -- (-1612.931) (-1613.877) (-1613.558) [-1613.021] * (-1612.738) [-1612.113] (-1612.166) (-1618.650) -- 0:00:57
      174000 -- (-1614.350) (-1613.048) (-1611.703) [-1615.278] * (-1613.414) (-1612.252) (-1613.720) [-1612.701] -- 0:00:56
      174500 -- [-1612.459] (-1615.159) (-1611.829) (-1612.697) * (-1619.098) (-1613.719) [-1613.201] (-1615.615) -- 0:00:56
      175000 -- (-1613.314) (-1616.040) (-1611.634) [-1613.900] * (-1616.109) (-1613.964) (-1616.702) [-1612.113] -- 0:00:56

      Average standard deviation of split frequencies: 0.018608

      175500 -- [-1612.667] (-1614.348) (-1614.179) (-1613.272) * (-1616.045) [-1613.402] (-1614.013) (-1612.155) -- 0:00:56
      176000 -- (-1613.350) (-1612.838) [-1614.217] (-1613.313) * (-1613.948) (-1612.514) (-1614.566) [-1611.618] -- 0:00:56
      176500 -- (-1615.975) [-1612.124] (-1613.219) (-1613.320) * (-1612.885) (-1613.820) [-1616.469] (-1613.705) -- 0:00:55
      177000 -- (-1613.894) [-1613.958] (-1612.170) (-1611.870) * (-1615.975) [-1613.123] (-1612.105) (-1612.406) -- 0:00:55
      177500 -- (-1613.969) (-1614.621) [-1613.333] (-1611.829) * [-1614.443] (-1611.727) (-1613.075) (-1610.908) -- 0:00:55
      178000 -- (-1613.287) (-1614.108) (-1611.859) [-1612.238] * (-1615.825) (-1611.495) [-1612.543] (-1612.543) -- 0:00:55
      178500 -- (-1615.812) (-1618.541) [-1611.748] (-1615.248) * (-1613.336) (-1613.672) [-1611.904] (-1612.628) -- 0:00:55
      179000 -- [-1612.970] (-1615.404) (-1612.605) (-1613.525) * [-1613.613] (-1612.863) (-1611.932) (-1613.028) -- 0:00:55
      179500 -- [-1614.447] (-1612.332) (-1614.217) (-1613.536) * [-1611.553] (-1612.589) (-1614.629) (-1615.441) -- 0:00:54
      180000 -- (-1617.961) [-1611.472] (-1613.186) (-1613.184) * (-1615.594) [-1614.043] (-1618.681) (-1616.567) -- 0:00:54

      Average standard deviation of split frequencies: 0.018402

      180500 -- (-1614.055) (-1612.023) [-1614.325] (-1613.693) * (-1614.564) (-1615.203) [-1612.333] (-1611.631) -- 0:00:54
      181000 -- [-1612.307] (-1612.341) (-1614.258) (-1615.041) * (-1614.528) (-1614.855) (-1613.369) [-1612.742] -- 0:00:54
      181500 -- (-1612.158) (-1612.976) (-1612.423) [-1612.413] * (-1614.504) [-1612.647] (-1611.943) (-1615.233) -- 0:00:54
      182000 -- (-1617.155) (-1613.515) [-1614.282] (-1615.464) * (-1612.945) (-1613.109) [-1612.432] (-1614.761) -- 0:00:53
      182500 -- (-1618.139) (-1619.371) (-1617.347) [-1613.870] * (-1614.312) (-1614.346) [-1612.305] (-1617.119) -- 0:00:53
      183000 -- (-1612.116) (-1624.103) (-1612.116) [-1615.168] * (-1615.879) (-1614.346) [-1613.383] (-1613.575) -- 0:00:53
      183500 -- (-1614.017) (-1621.027) (-1612.164) [-1613.585] * (-1613.200) [-1613.708] (-1613.505) (-1611.658) -- 0:00:53
      184000 -- (-1612.401) (-1623.619) (-1612.729) [-1611.665] * (-1612.581) (-1613.708) [-1612.202] (-1613.459) -- 0:00:53
      184500 -- (-1616.435) (-1613.183) [-1612.689] (-1611.997) * [-1612.704] (-1613.549) (-1611.318) (-1612.709) -- 0:00:53
      185000 -- [-1615.041] (-1613.202) (-1613.408) (-1614.676) * (-1612.681) (-1615.476) (-1612.416) [-1612.957] -- 0:00:52

      Average standard deviation of split frequencies: 0.019475

      185500 -- (-1613.125) [-1612.558] (-1614.513) (-1614.167) * (-1612.549) (-1613.151) [-1615.051] (-1614.184) -- 0:00:57
      186000 -- (-1612.922) [-1611.418] (-1616.770) (-1612.838) * [-1611.632] (-1612.422) (-1612.441) (-1612.578) -- 0:00:56
      186500 -- (-1611.441) [-1612.201] (-1616.732) (-1614.852) * [-1611.835] (-1611.910) (-1612.225) (-1613.098) -- 0:00:56
      187000 -- (-1611.560) [-1611.708] (-1615.520) (-1613.295) * (-1611.369) (-1612.023) [-1613.503] (-1615.790) -- 0:00:56
      187500 -- (-1611.305) (-1612.062) [-1611.102] (-1614.966) * [-1612.767] (-1611.821) (-1615.095) (-1614.732) -- 0:00:56
      188000 -- (-1616.154) (-1612.052) [-1613.130] (-1617.138) * (-1611.741) [-1611.426] (-1618.058) (-1613.075) -- 0:00:56
      188500 -- (-1621.245) [-1612.220] (-1611.723) (-1613.547) * (-1615.913) (-1613.543) [-1611.513] (-1613.360) -- 0:00:55
      189000 -- (-1616.474) (-1611.329) [-1614.336] (-1613.858) * [-1612.540] (-1617.483) (-1619.506) (-1611.607) -- 0:00:55
      189500 -- (-1613.208) (-1611.725) [-1614.148] (-1617.288) * (-1612.874) (-1615.937) (-1616.748) [-1611.953] -- 0:00:55
      190000 -- [-1613.905] (-1611.822) (-1612.894) (-1614.614) * (-1613.104) (-1617.045) (-1614.948) [-1612.536] -- 0:00:55

      Average standard deviation of split frequencies: 0.020430

      190500 -- (-1611.466) (-1615.801) [-1612.402] (-1613.698) * (-1616.609) (-1613.700) (-1615.933) [-1612.697] -- 0:00:55
      191000 -- (-1611.388) [-1614.050] (-1612.084) (-1612.660) * (-1615.849) (-1614.700) (-1614.202) [-1613.530] -- 0:00:55
      191500 -- (-1611.380) (-1612.085) (-1612.837) [-1612.593] * (-1618.878) [-1614.704] (-1613.343) (-1614.784) -- 0:00:54
      192000 -- (-1615.211) (-1613.026) (-1612.992) [-1616.425] * (-1615.731) [-1616.559] (-1614.849) (-1612.940) -- 0:00:54
      192500 -- (-1611.980) (-1612.637) (-1615.160) [-1614.286] * (-1614.280) [-1616.432] (-1615.765) (-1611.595) -- 0:00:54
      193000 -- [-1612.959] (-1612.609) (-1613.335) (-1615.401) * (-1615.783) (-1616.156) (-1614.165) [-1611.932] -- 0:00:54
      193500 -- (-1613.551) (-1614.151) (-1613.495) [-1614.096] * (-1613.787) (-1614.728) (-1617.412) [-1612.701] -- 0:00:54
      194000 -- (-1613.245) (-1614.138) [-1614.791] (-1613.286) * (-1613.685) (-1611.290) [-1613.106] (-1612.745) -- 0:00:54
      194500 -- (-1611.629) (-1616.670) (-1612.359) [-1615.155] * (-1616.263) (-1611.189) (-1613.358) [-1612.730] -- 0:00:53
      195000 -- (-1612.298) (-1614.511) (-1611.364) [-1614.289] * (-1615.659) (-1612.818) [-1614.999] (-1613.387) -- 0:00:53

      Average standard deviation of split frequencies: 0.020760

      195500 -- (-1612.348) [-1613.785] (-1614.466) (-1612.337) * [-1614.466] (-1612.350) (-1617.123) (-1611.550) -- 0:00:53
      196000 -- [-1611.439] (-1614.975) (-1612.088) (-1612.649) * (-1614.839) (-1612.284) (-1620.342) [-1612.061] -- 0:00:53
      196500 -- (-1611.846) (-1617.046) (-1614.709) [-1615.885] * (-1614.843) (-1617.827) (-1618.736) [-1611.719] -- 0:00:53
      197000 -- (-1611.664) [-1612.202] (-1613.873) (-1615.120) * (-1615.660) (-1615.023) [-1617.243] (-1611.522) -- 0:00:52
      197500 -- (-1614.654) [-1613.706] (-1611.412) (-1612.604) * (-1612.714) [-1612.369] (-1615.207) (-1612.442) -- 0:00:52
      198000 -- (-1611.710) [-1611.455] (-1611.446) (-1613.812) * (-1618.109) (-1611.484) [-1616.347] (-1613.210) -- 0:00:52
      198500 -- (-1611.049) (-1612.814) (-1614.336) [-1611.950] * (-1615.186) (-1612.016) [-1614.402] (-1613.096) -- 0:00:52
      199000 -- (-1611.724) [-1613.106] (-1614.937) (-1615.184) * (-1614.588) (-1612.964) (-1615.776) [-1611.474] -- 0:00:52
      199500 -- (-1611.724) (-1612.566) (-1614.021) [-1612.461] * (-1613.532) (-1613.045) (-1612.255) [-1614.514] -- 0:00:52
      200000 -- (-1612.342) [-1612.407] (-1612.902) (-1612.462) * (-1611.924) [-1612.926] (-1611.975) (-1611.196) -- 0:00:51

      Average standard deviation of split frequencies: 0.020648

      200500 -- (-1614.549) (-1616.600) (-1612.963) [-1611.908] * [-1612.485] (-1612.840) (-1612.180) (-1611.194) -- 0:00:51
      201000 -- (-1615.382) [-1612.292] (-1612.154) (-1612.870) * (-1612.404) [-1613.959] (-1612.174) (-1613.267) -- 0:00:55
      201500 -- (-1613.830) (-1612.250) (-1612.772) [-1612.142] * (-1612.244) (-1613.639) [-1611.073] (-1612.165) -- 0:00:55
      202000 -- (-1611.859) (-1615.881) (-1616.047) [-1611.724] * (-1611.985) (-1611.937) [-1612.046] (-1612.477) -- 0:00:55
      202500 -- (-1613.060) [-1611.136] (-1611.512) (-1612.342) * (-1612.003) (-1611.062) [-1612.373] (-1612.563) -- 0:00:55
      203000 -- (-1612.871) (-1611.285) [-1611.478] (-1612.765) * [-1612.094] (-1612.442) (-1612.950) (-1616.764) -- 0:00:54
      203500 -- (-1613.570) (-1613.887) [-1612.151] (-1612.891) * (-1613.184) (-1612.793) [-1613.089] (-1614.173) -- 0:00:54
      204000 -- [-1614.856] (-1613.428) (-1613.090) (-1611.866) * (-1614.833) (-1612.053) [-1612.528] (-1613.912) -- 0:00:54
      204500 -- (-1614.859) (-1614.537) (-1618.144) [-1616.086] * (-1616.901) (-1613.886) [-1612.127] (-1612.842) -- 0:00:54
      205000 -- (-1614.151) (-1615.057) (-1615.753) [-1617.721] * (-1613.812) (-1616.913) (-1613.601) [-1613.094] -- 0:00:54

      Average standard deviation of split frequencies: 0.019511

      205500 -- (-1615.409) [-1615.544] (-1612.271) (-1616.862) * (-1618.333) [-1618.230] (-1613.976) (-1615.312) -- 0:00:54
      206000 -- (-1617.247) [-1613.703] (-1613.580) (-1614.539) * (-1614.246) (-1612.886) [-1615.199] (-1616.046) -- 0:00:53
      206500 -- (-1617.024) [-1617.414] (-1612.853) (-1612.914) * (-1612.715) (-1613.433) (-1618.677) [-1615.810] -- 0:00:53
      207000 -- (-1613.801) (-1612.890) (-1611.788) [-1612.255] * [-1612.875] (-1612.190) (-1613.644) (-1613.930) -- 0:00:53
      207500 -- (-1613.785) (-1611.112) (-1611.247) [-1614.911] * (-1612.505) (-1613.680) [-1611.851] (-1614.495) -- 0:00:53
      208000 -- (-1613.671) [-1616.791] (-1612.366) (-1614.608) * [-1612.457] (-1613.187) (-1611.758) (-1615.700) -- 0:00:53
      208500 -- (-1613.688) (-1615.551) [-1613.319] (-1621.386) * (-1612.079) (-1613.787) [-1611.876] (-1618.537) -- 0:00:53
      209000 -- (-1613.614) [-1616.355] (-1613.075) (-1612.954) * (-1612.630) [-1611.093] (-1611.576) (-1615.534) -- 0:00:52
      209500 -- (-1612.117) (-1617.443) [-1612.881] (-1612.301) * (-1615.065) [-1612.160] (-1611.354) (-1612.905) -- 0:00:52
      210000 -- [-1612.291] (-1612.850) (-1614.071) (-1612.809) * (-1616.222) (-1612.469) (-1611.392) [-1612.219] -- 0:00:52

      Average standard deviation of split frequencies: 0.019315

      210500 -- (-1613.084) (-1614.599) [-1613.960] (-1612.818) * (-1614.141) [-1614.109] (-1611.838) (-1615.879) -- 0:00:52
      211000 -- (-1612.874) (-1613.837) [-1614.879] (-1614.149) * (-1617.217) (-1614.235) [-1613.208] (-1612.508) -- 0:00:52
      211500 -- (-1613.138) (-1617.639) (-1618.490) [-1613.525] * [-1615.491] (-1614.226) (-1613.180) (-1616.171) -- 0:00:52
      212000 -- [-1612.030] (-1615.100) (-1615.667) (-1618.738) * (-1613.421) (-1617.533) (-1611.685) [-1613.597] -- 0:00:52
      212500 -- [-1611.370] (-1613.633) (-1615.428) (-1615.142) * [-1614.182] (-1619.521) (-1615.924) (-1612.605) -- 0:00:51
      213000 -- (-1614.195) (-1612.833) (-1611.366) [-1612.165] * (-1613.133) (-1612.142) [-1613.467] (-1612.370) -- 0:00:51
      213500 -- [-1612.584] (-1614.218) (-1612.896) (-1612.049) * (-1613.680) (-1614.283) (-1611.965) [-1612.413] -- 0:00:51
      214000 -- (-1612.888) (-1613.098) [-1613.445] (-1612.341) * (-1615.376) (-1614.455) (-1611.889) [-1613.329] -- 0:00:51
      214500 -- (-1615.569) (-1613.648) (-1611.347) [-1612.120] * [-1612.089] (-1614.359) (-1611.625) (-1613.614) -- 0:00:51
      215000 -- [-1612.851] (-1613.202) (-1615.415) (-1613.310) * (-1612.654) (-1613.141) (-1614.845) [-1616.345] -- 0:00:51

      Average standard deviation of split frequencies: 0.019412

      215500 -- [-1613.561] (-1614.224) (-1616.625) (-1612.103) * (-1614.076) (-1612.407) [-1611.995] (-1613.642) -- 0:00:50
      216000 -- (-1613.940) (-1615.406) [-1612.376] (-1613.208) * [-1614.274] (-1615.582) (-1615.339) (-1614.102) -- 0:00:50
      216500 -- (-1613.266) (-1612.220) [-1611.848] (-1617.889) * (-1612.780) [-1613.184] (-1612.953) (-1614.180) -- 0:00:50
      217000 -- (-1613.203) (-1612.312) [-1613.677] (-1612.126) * (-1611.551) (-1613.436) [-1614.720] (-1616.029) -- 0:00:54
      217500 -- (-1611.047) (-1614.200) (-1612.994) [-1612.052] * (-1614.719) (-1613.406) [-1613.786] (-1615.535) -- 0:00:53
      218000 -- (-1611.052) (-1616.048) [-1612.698] (-1611.905) * (-1613.143) [-1614.963] (-1613.375) (-1616.971) -- 0:00:53
      218500 -- (-1612.139) [-1613.650] (-1611.668) (-1615.654) * (-1612.647) (-1612.483) [-1617.385] (-1613.867) -- 0:00:53
      219000 -- (-1612.491) [-1613.516] (-1610.916) (-1613.611) * (-1614.502) [-1615.120] (-1611.521) (-1615.149) -- 0:00:53
      219500 -- [-1611.203] (-1615.692) (-1612.057) (-1611.977) * (-1614.459) [-1616.339] (-1611.663) (-1616.626) -- 0:00:53
      220000 -- (-1612.228) (-1612.985) [-1613.118] (-1614.874) * (-1612.664) (-1614.432) (-1611.663) [-1612.470] -- 0:00:53

      Average standard deviation of split frequencies: 0.019701

      220500 -- (-1611.432) [-1613.455] (-1611.797) (-1614.655) * (-1614.731) (-1614.291) [-1612.138] (-1615.682) -- 0:00:53
      221000 -- [-1613.165] (-1614.218) (-1612.182) (-1613.366) * (-1615.854) (-1616.951) (-1613.065) [-1616.263] -- 0:00:52
      221500 -- [-1612.677] (-1614.275) (-1612.323) (-1612.900) * (-1614.902) [-1616.348] (-1612.368) (-1613.353) -- 0:00:52
      222000 -- [-1613.692] (-1615.765) (-1611.513) (-1612.211) * (-1614.053) (-1617.573) [-1613.514] (-1613.906) -- 0:00:52
      222500 -- (-1615.546) (-1614.099) (-1611.519) [-1612.679] * [-1618.504] (-1618.325) (-1615.384) (-1614.289) -- 0:00:52
      223000 -- (-1613.577) [-1614.052] (-1611.371) (-1615.196) * [-1612.898] (-1615.248) (-1612.799) (-1613.444) -- 0:00:52
      223500 -- [-1613.934] (-1618.034) (-1611.241) (-1611.994) * (-1613.278) (-1616.032) (-1615.160) [-1614.908] -- 0:00:52
      224000 -- (-1612.613) (-1615.073) (-1613.701) [-1612.116] * (-1612.417) [-1615.966] (-1616.838) (-1615.954) -- 0:00:51
      224500 -- (-1613.171) (-1614.395) (-1613.272) [-1615.088] * (-1612.387) (-1616.470) (-1612.621) [-1616.051] -- 0:00:51
      225000 -- (-1611.940) [-1615.760] (-1612.862) (-1618.766) * (-1612.445) (-1613.047) (-1613.142) [-1612.952] -- 0:00:51

      Average standard deviation of split frequencies: 0.019816

      225500 -- [-1614.439] (-1617.244) (-1613.233) (-1614.554) * (-1613.706) (-1613.594) [-1611.809] (-1613.294) -- 0:00:51
      226000 -- (-1617.457) (-1617.499) (-1615.320) [-1614.765] * (-1612.317) (-1612.625) [-1612.026] (-1613.548) -- 0:00:51
      226500 -- [-1616.098] (-1611.862) (-1623.234) (-1614.376) * (-1612.982) (-1612.801) (-1612.578) [-1611.932] -- 0:00:51
      227000 -- (-1615.204) [-1611.862] (-1614.268) (-1613.232) * (-1614.167) (-1611.907) [-1612.281] (-1611.499) -- 0:00:51
      227500 -- (-1612.707) [-1611.291] (-1613.242) (-1613.734) * [-1617.843] (-1614.969) (-1613.015) (-1611.495) -- 0:00:50
      228000 -- (-1611.869) (-1616.425) (-1612.673) [-1613.695] * (-1615.880) (-1613.887) (-1614.386) [-1614.006] -- 0:00:50
      228500 -- [-1612.298] (-1615.137) (-1613.234) (-1611.566) * (-1613.572) (-1613.999) (-1619.505) [-1612.741] -- 0:00:50
      229000 -- (-1611.986) (-1614.221) (-1614.773) [-1612.459] * (-1613.842) [-1615.137] (-1615.645) (-1613.251) -- 0:00:50
      229500 -- (-1612.151) [-1612.044] (-1613.989) (-1612.652) * (-1613.237) [-1611.713] (-1612.815) (-1614.311) -- 0:00:50
      230000 -- (-1612.970) (-1612.006) (-1612.973) [-1613.844] * (-1612.158) (-1612.092) (-1611.111) [-1612.727] -- 0:00:50

      Average standard deviation of split frequencies: 0.020777

      230500 -- [-1613.100] (-1611.640) (-1612.973) (-1613.191) * (-1612.781) (-1612.880) [-1612.508] (-1612.575) -- 0:00:50
      231000 -- [-1619.663] (-1611.396) (-1613.910) (-1612.567) * (-1612.078) [-1612.620] (-1612.378) (-1614.283) -- 0:00:49
      231500 -- (-1612.532) (-1612.249) (-1618.370) [-1612.235] * (-1612.582) [-1612.308] (-1613.074) (-1614.486) -- 0:00:49
      232000 -- (-1613.965) [-1611.941] (-1612.412) (-1611.405) * (-1613.699) (-1612.167) (-1614.085) [-1617.410] -- 0:00:49
      232500 -- (-1616.607) (-1614.388) [-1613.481] (-1614.098) * (-1612.328) (-1620.520) [-1611.648] (-1611.889) -- 0:00:52
      233000 -- [-1615.203] (-1612.975) (-1614.295) (-1614.108) * (-1615.219) (-1613.756) [-1611.660] (-1613.422) -- 0:00:52
      233500 -- (-1613.769) [-1613.676] (-1613.717) (-1614.056) * [-1612.246] (-1612.932) (-1611.637) (-1613.422) -- 0:00:52
      234000 -- [-1612.574] (-1613.122) (-1615.782) (-1612.326) * (-1611.823) (-1612.431) [-1613.368] (-1613.526) -- 0:00:52
      234500 -- (-1611.410) (-1612.468) (-1612.958) [-1616.672] * (-1611.918) (-1614.398) (-1612.196) [-1613.248] -- 0:00:52
      235000 -- (-1615.250) [-1612.410] (-1613.100) (-1616.627) * (-1610.934) [-1612.842] (-1612.245) (-1613.049) -- 0:00:52

      Average standard deviation of split frequencies: 0.020752

      235500 -- [-1611.721] (-1612.737) (-1614.714) (-1618.333) * (-1615.083) (-1611.683) (-1612.557) [-1614.375] -- 0:00:51
      236000 -- (-1612.915) (-1617.211) (-1613.275) [-1612.953] * (-1612.557) (-1615.523) [-1617.600] (-1613.438) -- 0:00:51
      236500 -- (-1613.155) (-1611.346) [-1613.799] (-1612.709) * [-1612.582] (-1613.962) (-1612.129) (-1616.193) -- 0:00:51
      237000 -- (-1612.895) (-1612.012) (-1613.945) [-1612.856] * [-1613.601] (-1614.109) (-1611.206) (-1614.066) -- 0:00:51
      237500 -- (-1612.292) (-1613.534) (-1612.341) [-1611.192] * (-1612.065) (-1611.667) (-1611.596) [-1612.489] -- 0:00:51
      238000 -- [-1611.698] (-1613.979) (-1612.665) (-1611.348) * (-1612.033) (-1620.978) (-1611.427) [-1612.487] -- 0:00:51
      238500 -- (-1613.163) [-1612.611] (-1616.736) (-1614.752) * (-1612.263) [-1613.458] (-1612.152) (-1614.789) -- 0:00:51
      239000 -- (-1612.511) [-1611.886] (-1615.265) (-1613.424) * (-1616.337) (-1612.375) [-1612.024] (-1613.829) -- 0:00:50
      239500 -- [-1613.024] (-1612.623) (-1613.351) (-1613.571) * (-1616.490) (-1612.278) (-1611.724) [-1612.952] -- 0:00:50
      240000 -- [-1613.062] (-1612.019) (-1614.540) (-1615.839) * [-1614.685] (-1612.126) (-1615.622) (-1614.378) -- 0:00:50

      Average standard deviation of split frequencies: 0.020458

      240500 -- (-1613.141) [-1612.637] (-1614.246) (-1615.267) * (-1615.524) [-1612.977] (-1612.611) (-1612.966) -- 0:00:50
      241000 -- (-1613.215) [-1613.115] (-1616.008) (-1613.900) * (-1611.887) [-1612.250] (-1613.044) (-1611.977) -- 0:00:50
      241500 -- [-1612.809] (-1617.817) (-1614.463) (-1617.921) * (-1614.474) [-1614.674] (-1613.483) (-1612.191) -- 0:00:50
      242000 -- (-1614.189) (-1614.958) [-1612.859] (-1614.784) * [-1611.209] (-1618.355) (-1613.112) (-1614.733) -- 0:00:50
      242500 -- (-1615.726) (-1614.981) (-1614.294) [-1615.128] * (-1612.295) (-1615.652) [-1611.770] (-1614.021) -- 0:00:49
      243000 -- (-1618.369) (-1620.885) (-1613.689) [-1614.374] * [-1613.349] (-1612.183) (-1612.110) (-1612.764) -- 0:00:49
      243500 -- [-1614.768] (-1614.013) (-1617.405) (-1613.673) * (-1615.627) (-1612.229) [-1613.646] (-1612.857) -- 0:00:49
      244000 -- (-1616.868) (-1612.192) (-1612.844) [-1612.239] * (-1611.950) (-1612.885) (-1615.367) [-1611.714] -- 0:00:49
      244500 -- [-1614.028] (-1610.857) (-1613.465) (-1620.946) * [-1615.211] (-1612.488) (-1612.924) (-1613.409) -- 0:00:49
      245000 -- (-1615.136) (-1617.969) [-1613.725] (-1612.151) * (-1615.187) [-1612.012] (-1612.489) (-1613.880) -- 0:00:49

      Average standard deviation of split frequencies: 0.019269

      245500 -- [-1614.338] (-1616.295) (-1617.998) (-1614.658) * (-1617.841) [-1612.275] (-1611.706) (-1612.470) -- 0:00:49
      246000 -- (-1615.202) (-1613.727) [-1617.929] (-1612.964) * (-1613.455) (-1612.931) [-1612.901] (-1616.996) -- 0:00:49
      246500 -- (-1612.730) [-1613.502] (-1613.222) (-1612.912) * [-1613.960] (-1613.677) (-1613.122) (-1613.677) -- 0:00:48
      247000 -- (-1613.236) [-1613.877] (-1614.881) (-1611.354) * (-1617.665) (-1612.871) [-1611.373] (-1613.456) -- 0:00:48
      247500 -- (-1614.710) (-1615.255) [-1613.805] (-1611.389) * [-1612.358] (-1612.364) (-1612.674) (-1620.654) -- 0:00:48
      248000 -- (-1615.315) [-1617.588] (-1615.363) (-1613.066) * (-1612.663) [-1613.984] (-1613.700) (-1615.263) -- 0:00:51
      248500 -- (-1611.188) (-1613.305) (-1615.094) [-1612.920] * (-1619.489) (-1612.173) [-1613.965] (-1617.836) -- 0:00:51
      249000 -- (-1612.361) (-1616.601) [-1611.987] (-1614.193) * (-1617.819) (-1617.049) [-1616.687] (-1612.628) -- 0:00:51
      249500 -- (-1611.842) (-1612.738) [-1612.146] (-1611.259) * (-1622.312) (-1612.611) (-1612.037) [-1611.943] -- 0:00:51
      250000 -- (-1611.138) (-1612.782) [-1612.004] (-1611.307) * (-1619.123) (-1614.758) (-1611.814) [-1612.166] -- 0:00:51

      Average standard deviation of split frequencies: 0.017970

      250500 -- (-1612.105) (-1612.800) (-1611.950) [-1611.667] * [-1612.234] (-1613.433) (-1612.130) (-1613.190) -- 0:00:50
      251000 -- (-1611.582) [-1615.213] (-1615.174) (-1612.902) * [-1613.099] (-1612.547) (-1612.530) (-1615.603) -- 0:00:50
      251500 -- (-1611.705) (-1612.541) (-1615.093) [-1611.840] * (-1612.131) (-1614.314) (-1612.583) [-1612.767] -- 0:00:50
      252000 -- [-1613.814] (-1612.468) (-1612.480) (-1612.140) * (-1613.626) (-1614.914) (-1611.279) [-1613.179] -- 0:00:50
      252500 -- (-1613.974) (-1613.799) (-1612.169) [-1612.140] * (-1614.306) (-1613.999) [-1611.408] (-1612.814) -- 0:00:50
      253000 -- [-1612.113] (-1613.094) (-1613.970) (-1613.093) * (-1613.761) (-1614.030) (-1611.607) [-1612.750] -- 0:00:50
      253500 -- (-1614.284) [-1611.547] (-1613.117) (-1611.726) * (-1611.349) (-1614.362) [-1611.538] (-1613.299) -- 0:00:50
      254000 -- (-1613.146) [-1614.683] (-1617.477) (-1612.940) * (-1611.544) (-1612.073) (-1616.698) [-1612.147] -- 0:00:49
      254500 -- [-1613.771] (-1613.313) (-1612.450) (-1613.125) * [-1611.622] (-1611.820) (-1615.649) (-1612.238) -- 0:00:49
      255000 -- [-1613.119] (-1612.575) (-1613.084) (-1614.177) * (-1613.374) [-1611.380] (-1612.584) (-1612.067) -- 0:00:49

      Average standard deviation of split frequencies: 0.017114

      255500 -- [-1613.561] (-1612.566) (-1615.239) (-1617.319) * (-1616.504) (-1611.985) [-1612.460] (-1611.291) -- 0:00:49
      256000 -- (-1613.547) [-1613.840] (-1614.300) (-1618.456) * (-1616.506) (-1613.378) (-1612.925) [-1616.657] -- 0:00:49
      256500 -- [-1614.204] (-1616.858) (-1616.208) (-1613.968) * (-1614.089) [-1615.157] (-1612.025) (-1616.883) -- 0:00:49
      257000 -- [-1615.280] (-1618.697) (-1614.603) (-1612.219) * (-1613.995) [-1612.571] (-1612.168) (-1615.576) -- 0:00:49
      257500 -- (-1614.827) [-1616.838] (-1615.120) (-1614.546) * (-1614.015) (-1612.848) [-1611.979] (-1615.445) -- 0:00:49
      258000 -- (-1614.032) [-1611.399] (-1616.056) (-1617.684) * (-1611.589) [-1613.186] (-1612.598) (-1615.086) -- 0:00:48
      258500 -- (-1614.352) (-1611.284) [-1615.395] (-1617.257) * (-1612.149) [-1615.023] (-1613.243) (-1613.982) -- 0:00:48
      259000 -- (-1614.840) (-1618.203) [-1613.909] (-1612.667) * (-1613.821) [-1615.570] (-1612.157) (-1613.521) -- 0:00:48
      259500 -- [-1611.524] (-1612.994) (-1615.775) (-1612.776) * (-1613.141) (-1615.589) [-1612.157] (-1613.823) -- 0:00:48
      260000 -- (-1611.819) [-1613.332] (-1615.546) (-1613.839) * [-1611.529] (-1615.783) (-1612.741) (-1612.557) -- 0:00:48

      Average standard deviation of split frequencies: 0.018191

      260500 -- [-1613.660] (-1614.635) (-1612.637) (-1613.896) * (-1611.556) [-1612.579] (-1615.844) (-1613.716) -- 0:00:48
      261000 -- (-1616.830) (-1611.666) [-1613.374] (-1612.183) * (-1612.878) (-1615.901) [-1614.567] (-1613.066) -- 0:00:48
      261500 -- (-1614.952) (-1612.474) [-1613.744] (-1613.970) * [-1612.357] (-1616.192) (-1615.236) (-1615.641) -- 0:00:48
      262000 -- (-1615.406) [-1612.300] (-1615.850) (-1617.152) * (-1614.003) (-1615.620) [-1612.620] (-1612.729) -- 0:00:47
      262500 -- [-1614.185] (-1611.686) (-1612.698) (-1616.009) * [-1612.918] (-1612.563) (-1614.966) (-1613.270) -- 0:00:47
      263000 -- [-1612.262] (-1611.727) (-1614.542) (-1614.584) * [-1611.731] (-1612.408) (-1612.375) (-1611.979) -- 0:00:47
      263500 -- [-1614.476] (-1612.245) (-1614.344) (-1612.617) * (-1611.362) (-1611.577) [-1612.483] (-1615.387) -- 0:00:50
      264000 -- (-1616.018) (-1612.711) [-1612.270] (-1612.191) * (-1613.847) [-1612.144] (-1612.766) (-1612.084) -- 0:00:50
      264500 -- (-1617.472) (-1614.421) [-1612.067] (-1612.815) * [-1615.930] (-1612.573) (-1614.345) (-1614.556) -- 0:00:50
      265000 -- (-1621.486) (-1614.878) [-1611.500] (-1612.904) * (-1614.410) [-1612.896] (-1614.868) (-1619.125) -- 0:00:49

      Average standard deviation of split frequencies: 0.018452

      265500 -- (-1619.995) [-1613.299] (-1615.100) (-1613.651) * [-1614.768] (-1616.068) (-1612.542) (-1616.990) -- 0:00:49
      266000 -- (-1618.087) (-1611.537) (-1614.617) [-1613.684] * (-1614.929) (-1612.754) (-1614.047) [-1614.770] -- 0:00:49
      266500 -- (-1617.605) [-1612.880] (-1614.750) (-1612.772) * (-1616.213) [-1613.447] (-1613.058) (-1611.887) -- 0:00:49
      267000 -- [-1613.991] (-1612.029) (-1614.389) (-1614.552) * (-1615.421) (-1612.494) [-1612.649] (-1611.725) -- 0:00:49
      267500 -- (-1612.695) (-1612.030) (-1615.685) [-1612.289] * (-1613.817) [-1613.233] (-1612.506) (-1611.441) -- 0:00:49
      268000 -- (-1613.102) (-1612.071) (-1614.635) [-1612.018] * (-1613.949) (-1611.496) (-1612.058) [-1611.638] -- 0:00:49
      268500 -- (-1614.453) (-1611.881) (-1615.435) [-1613.836] * (-1613.977) (-1611.454) (-1612.110) [-1613.545] -- 0:00:49
      269000 -- [-1612.045] (-1611.954) (-1614.143) (-1617.925) * (-1611.821) (-1613.564) (-1613.183) [-1611.572] -- 0:00:48
      269500 -- [-1612.408] (-1611.930) (-1616.258) (-1612.894) * [-1613.579] (-1613.042) (-1614.922) (-1612.353) -- 0:00:48
      270000 -- (-1613.484) [-1611.175] (-1612.842) (-1614.615) * (-1617.001) (-1617.495) [-1611.356] (-1611.464) -- 0:00:48

      Average standard deviation of split frequencies: 0.017212

      270500 -- (-1614.367) (-1612.454) [-1611.732] (-1611.971) * (-1614.170) (-1619.168) (-1612.177) [-1618.397] -- 0:00:48
      271000 -- (-1614.359) (-1613.253) (-1611.157) [-1613.136] * (-1612.469) (-1614.149) [-1613.471] (-1614.438) -- 0:00:48
      271500 -- (-1620.806) (-1613.062) (-1611.258) [-1611.926] * (-1612.817) [-1613.990] (-1612.686) (-1613.336) -- 0:00:48
      272000 -- (-1615.954) [-1611.304] (-1612.707) (-1611.526) * (-1616.057) [-1614.380] (-1614.209) (-1616.524) -- 0:00:48
      272500 -- (-1613.296) (-1613.221) (-1613.891) [-1613.169] * [-1611.763] (-1613.815) (-1612.880) (-1615.246) -- 0:00:48
      273000 -- (-1612.441) [-1611.150] (-1613.060) (-1614.329) * (-1612.367) (-1614.124) (-1613.069) [-1613.133] -- 0:00:47
      273500 -- (-1612.051) [-1612.045] (-1614.712) (-1613.785) * (-1615.559) (-1614.858) (-1612.417) [-1614.767] -- 0:00:47
      274000 -- (-1611.149) [-1611.334] (-1615.672) (-1612.909) * (-1619.631) [-1614.676] (-1613.931) (-1614.220) -- 0:00:47
      274500 -- (-1611.003) (-1612.054) [-1613.947] (-1611.807) * (-1616.429) (-1613.882) (-1618.124) [-1614.504] -- 0:00:47
      275000 -- (-1611.416) (-1613.723) [-1612.311] (-1612.146) * (-1616.998) [-1615.223] (-1613.237) (-1613.900) -- 0:00:47

      Average standard deviation of split frequencies: 0.016653

      275500 -- (-1612.023) (-1611.573) [-1612.223] (-1612.684) * (-1614.050) [-1613.965] (-1614.846) (-1611.475) -- 0:00:47
      276000 -- (-1612.637) (-1611.321) (-1612.733) [-1614.853] * (-1613.390) (-1612.502) [-1613.947] (-1613.649) -- 0:00:47
      276500 -- [-1613.522] (-1611.613) (-1611.924) (-1616.692) * (-1615.807) (-1614.615) (-1613.395) [-1613.712] -- 0:00:47
      277000 -- (-1612.199) [-1612.649] (-1612.957) (-1616.284) * [-1613.349] (-1612.659) (-1612.221) (-1611.986) -- 0:00:46
      277500 -- [-1611.606] (-1613.421) (-1612.064) (-1614.621) * [-1613.180] (-1614.516) (-1612.993) (-1611.808) -- 0:00:46
      278000 -- [-1615.712] (-1611.310) (-1615.934) (-1612.438) * (-1613.671) (-1612.273) [-1613.725] (-1611.411) -- 0:00:46
      278500 -- (-1614.733) (-1615.502) [-1615.296] (-1613.009) * (-1616.181) (-1613.268) [-1616.771] (-1611.363) -- 0:00:46
      279000 -- [-1615.392] (-1613.653) (-1613.484) (-1612.673) * (-1614.127) (-1615.919) [-1613.949] (-1612.430) -- 0:00:46
      279500 -- (-1613.141) (-1613.006) (-1613.559) [-1613.543] * (-1613.809) (-1616.625) [-1612.158] (-1612.161) -- 0:00:48
      280000 -- (-1619.570) (-1613.047) (-1614.006) [-1615.618] * (-1617.863) [-1614.583] (-1612.462) (-1612.087) -- 0:00:48

      Average standard deviation of split frequencies: 0.015215

      280500 -- (-1618.396) [-1611.171] (-1613.234) (-1612.749) * (-1612.035) [-1614.003] (-1614.004) (-1613.205) -- 0:00:48
      281000 -- (-1614.659) (-1612.783) [-1615.517] (-1612.302) * (-1611.919) [-1620.712] (-1613.014) (-1613.368) -- 0:00:48
      281500 -- [-1613.678] (-1612.466) (-1615.457) (-1612.323) * (-1612.788) (-1613.611) [-1612.783] (-1618.525) -- 0:00:48
      282000 -- (-1612.956) (-1612.132) (-1612.160) [-1613.924] * [-1611.520] (-1614.422) (-1614.457) (-1616.171) -- 0:00:48
      282500 -- [-1612.247] (-1612.690) (-1615.564) (-1612.028) * [-1615.801] (-1615.698) (-1611.553) (-1612.959) -- 0:00:48
      283000 -- (-1613.693) (-1613.655) [-1612.776] (-1612.847) * (-1616.591) (-1616.640) [-1611.852] (-1612.771) -- 0:00:48
      283500 -- [-1612.753] (-1611.837) (-1612.619) (-1613.605) * [-1615.535] (-1612.166) (-1612.918) (-1614.313) -- 0:00:48
      284000 -- (-1613.372) (-1613.417) [-1616.260] (-1613.280) * (-1620.960) (-1613.683) [-1610.867] (-1614.786) -- 0:00:47
      284500 -- [-1613.040] (-1614.456) (-1614.822) (-1612.887) * (-1622.559) [-1613.583] (-1612.573) (-1616.686) -- 0:00:47
      285000 -- (-1617.417) (-1612.360) [-1615.199] (-1612.639) * (-1622.921) (-1617.775) [-1613.565] (-1613.668) -- 0:00:47

      Average standard deviation of split frequencies: 0.014743

      285500 -- [-1613.166] (-1614.426) (-1615.177) (-1614.542) * (-1617.472) (-1621.802) (-1617.469) [-1619.206] -- 0:00:47
      286000 -- [-1612.185] (-1614.584) (-1613.825) (-1618.202) * [-1616.679] (-1620.360) (-1617.202) (-1615.513) -- 0:00:47
      286500 -- [-1613.382] (-1615.222) (-1616.958) (-1613.105) * (-1613.184) (-1618.444) [-1616.364] (-1622.905) -- 0:00:47
      287000 -- (-1612.954) [-1613.302] (-1613.659) (-1612.528) * (-1613.267) (-1619.269) (-1617.139) [-1616.042] -- 0:00:47
      287500 -- (-1613.480) (-1612.238) [-1613.497] (-1612.051) * (-1614.132) [-1612.130] (-1618.396) (-1615.597) -- 0:00:47
      288000 -- (-1613.918) (-1615.625) [-1613.366] (-1611.738) * (-1612.683) (-1611.850) (-1617.111) [-1613.136] -- 0:00:46
      288500 -- (-1616.594) [-1612.834] (-1613.798) (-1612.195) * (-1614.438) [-1613.904] (-1613.693) (-1613.949) -- 0:00:46
      289000 -- (-1615.992) (-1612.287) [-1614.200] (-1610.987) * (-1612.365) [-1612.918] (-1615.971) (-1615.253) -- 0:00:46
      289500 -- (-1614.670) (-1612.337) (-1614.404) [-1611.304] * [-1612.083] (-1615.114) (-1616.147) (-1612.789) -- 0:00:46
      290000 -- (-1613.536) (-1611.451) (-1614.236) [-1612.437] * (-1612.460) (-1614.239) [-1613.927] (-1614.958) -- 0:00:46

      Average standard deviation of split frequencies: 0.015455

      290500 -- (-1611.195) [-1611.682] (-1615.112) (-1611.947) * [-1612.675] (-1616.384) (-1611.662) (-1614.098) -- 0:00:46
      291000 -- (-1611.842) (-1614.737) [-1612.648] (-1612.691) * [-1611.825] (-1614.694) (-1611.453) (-1614.767) -- 0:00:46
      291500 -- (-1611.458) [-1616.959] (-1611.848) (-1612.566) * [-1612.681] (-1613.275) (-1614.460) (-1614.184) -- 0:00:46
      292000 -- (-1611.300) (-1617.232) (-1611.214) [-1612.480] * (-1611.239) [-1613.031] (-1612.735) (-1613.534) -- 0:00:46
      292500 -- (-1611.870) (-1611.734) (-1611.612) [-1614.098] * [-1613.196] (-1618.371) (-1614.837) (-1613.369) -- 0:00:45
      293000 -- (-1611.728) (-1613.405) [-1612.050] (-1614.105) * [-1613.484] (-1618.743) (-1611.510) (-1613.261) -- 0:00:45
      293500 -- (-1612.263) (-1614.047) (-1612.048) [-1614.446] * [-1616.785] (-1618.714) (-1614.919) (-1614.175) -- 0:00:45
      294000 -- (-1611.415) (-1612.693) (-1613.609) [-1613.206] * (-1617.622) (-1614.523) (-1613.898) [-1611.757] -- 0:00:45
      294500 -- (-1611.544) (-1613.090) (-1611.977) [-1613.590] * (-1616.905) (-1613.849) (-1616.905) [-1611.494] -- 0:00:45
      295000 -- (-1611.485) [-1612.246] (-1611.163) (-1615.169) * (-1616.664) (-1614.597) (-1617.897) [-1612.215] -- 0:00:47

      Average standard deviation of split frequencies: 0.015645

      295500 -- (-1612.274) (-1610.994) [-1611.317] (-1613.659) * (-1616.102) [-1619.556] (-1615.901) (-1613.101) -- 0:00:47
      296000 -- (-1612.148) [-1612.308] (-1612.203) (-1613.456) * (-1617.002) (-1617.734) [-1615.799] (-1615.476) -- 0:00:47
      296500 -- (-1612.979) [-1611.392] (-1613.770) (-1614.315) * [-1612.528] (-1617.131) (-1613.831) (-1614.036) -- 0:00:47
      297000 -- (-1614.955) (-1615.756) [-1613.910] (-1615.416) * (-1615.263) [-1613.770] (-1613.892) (-1616.395) -- 0:00:47
      297500 -- (-1617.704) (-1614.577) [-1614.173] (-1616.542) * (-1617.590) (-1615.550) [-1615.045] (-1617.904) -- 0:00:47
      298000 -- (-1613.087) (-1613.807) (-1614.865) [-1613.752] * (-1613.896) [-1616.476] (-1614.936) (-1615.868) -- 0:00:47
      298500 -- (-1613.176) [-1612.389] (-1613.601) (-1614.964) * (-1614.011) (-1616.903) (-1613.254) [-1615.583] -- 0:00:47
      299000 -- (-1613.782) [-1614.612] (-1616.238) (-1613.538) * (-1611.000) [-1613.712] (-1613.191) (-1614.985) -- 0:00:46
      299500 -- [-1613.194] (-1614.410) (-1614.845) (-1615.167) * (-1612.843) (-1614.101) (-1612.043) [-1614.769] -- 0:00:46
      300000 -- (-1613.446) (-1614.292) [-1612.007] (-1615.719) * (-1613.409) [-1612.987] (-1619.899) (-1613.183) -- 0:00:46

      Average standard deviation of split frequencies: 0.015402

      300500 -- (-1615.354) (-1616.647) (-1614.280) [-1612.730] * (-1616.615) (-1611.951) [-1620.848] (-1616.531) -- 0:00:46
      301000 -- (-1614.226) [-1612.388] (-1613.779) (-1613.357) * [-1617.331] (-1612.847) (-1614.389) (-1618.544) -- 0:00:46
      301500 -- (-1612.781) [-1611.933] (-1616.078) (-1619.247) * (-1611.299) (-1613.089) [-1612.333] (-1612.975) -- 0:00:46
      302000 -- (-1613.058) [-1611.910] (-1611.600) (-1614.507) * (-1612.077) [-1611.468] (-1613.172) (-1613.044) -- 0:00:46
      302500 -- (-1613.778) [-1611.963] (-1612.133) (-1616.513) * (-1613.038) (-1611.609) [-1612.183] (-1612.238) -- 0:00:46
      303000 -- (-1614.062) [-1614.143] (-1612.785) (-1613.638) * (-1612.437) (-1612.610) [-1615.129] (-1612.436) -- 0:00:46
      303500 -- (-1612.956) [-1615.733] (-1614.211) (-1615.140) * [-1613.482] (-1614.622) (-1612.280) (-1612.093) -- 0:00:45
      304000 -- (-1612.936) [-1615.384] (-1611.923) (-1611.447) * [-1615.527] (-1613.770) (-1611.810) (-1612.807) -- 0:00:45
      304500 -- (-1616.640) (-1615.353) (-1611.975) [-1612.874] * (-1614.540) (-1612.220) (-1613.210) [-1613.611] -- 0:00:45
      305000 -- (-1612.358) [-1615.361] (-1613.730) (-1612.891) * [-1614.042] (-1611.940) (-1612.643) (-1614.194) -- 0:00:45

      Average standard deviation of split frequencies: 0.015063

      305500 -- (-1611.979) [-1612.879] (-1612.890) (-1612.256) * (-1613.363) (-1612.106) (-1615.366) [-1616.748] -- 0:00:45
      306000 -- [-1612.162] (-1612.311) (-1613.605) (-1611.516) * (-1613.214) [-1611.663] (-1614.076) (-1615.264) -- 0:00:45
      306500 -- (-1613.134) (-1613.239) [-1612.570] (-1613.038) * (-1611.410) (-1614.666) (-1612.665) [-1613.284] -- 0:00:45
      307000 -- (-1613.155) [-1616.911] (-1613.379) (-1613.068) * (-1612.151) [-1613.742] (-1614.675) (-1613.696) -- 0:00:45
      307500 -- (-1615.801) (-1612.788) (-1613.060) [-1613.704] * (-1612.199) [-1612.327] (-1615.257) (-1613.198) -- 0:00:45
      308000 -- (-1614.925) [-1613.968] (-1612.637) (-1615.340) * [-1611.122] (-1612.521) (-1615.583) (-1611.430) -- 0:00:44
      308500 -- [-1614.814] (-1613.526) (-1611.352) (-1613.445) * [-1611.715] (-1612.524) (-1612.823) (-1612.259) -- 0:00:44
      309000 -- (-1614.984) (-1616.218) [-1612.048] (-1617.339) * (-1613.843) [-1613.486] (-1613.801) (-1613.887) -- 0:00:44
      309500 -- (-1614.058) (-1616.410) (-1612.826) [-1612.707] * (-1612.926) (-1611.381) (-1613.306) [-1612.425] -- 0:00:44
      310000 -- [-1611.699] (-1612.546) (-1612.785) (-1613.199) * (-1613.854) (-1613.015) [-1612.263] (-1615.291) -- 0:00:44

      Average standard deviation of split frequencies: 0.016067

      310500 -- (-1612.685) [-1611.283] (-1613.816) (-1612.750) * (-1618.327) (-1614.977) (-1614.455) [-1613.213] -- 0:00:46
      311000 -- [-1614.218] (-1612.806) (-1612.623) (-1614.558) * (-1615.896) (-1612.256) (-1614.258) [-1613.588] -- 0:00:46
      311500 -- [-1611.967] (-1613.586) (-1615.166) (-1616.341) * (-1619.046) (-1614.012) [-1612.661] (-1612.668) -- 0:00:46
      312000 -- (-1617.651) (-1613.370) [-1614.710] (-1617.785) * (-1616.397) (-1613.791) (-1612.178) [-1612.091] -- 0:00:46
      312500 -- [-1611.962] (-1611.623) (-1615.025) (-1615.525) * (-1615.203) [-1615.356] (-1613.384) (-1611.212) -- 0:00:46
      313000 -- (-1611.281) [-1613.014] (-1619.696) (-1618.075) * (-1616.864) (-1613.274) [-1616.589] (-1614.023) -- 0:00:46
      313500 -- (-1613.992) (-1611.523) [-1615.259] (-1612.655) * (-1614.057) (-1613.452) [-1616.448] (-1612.035) -- 0:00:45
      314000 -- (-1619.980) (-1611.307) (-1615.662) [-1612.069] * (-1612.386) (-1611.640) [-1615.986] (-1612.924) -- 0:00:45
      314500 -- (-1615.673) (-1610.832) (-1616.474) [-1613.145] * (-1613.113) (-1613.061) [-1612.758] (-1612.899) -- 0:00:45
      315000 -- (-1616.271) (-1611.149) [-1612.392] (-1613.729) * (-1612.496) [-1612.732] (-1611.954) (-1612.260) -- 0:00:45

      Average standard deviation of split frequencies: 0.015757

      315500 -- (-1616.286) (-1611.137) [-1612.218] (-1611.647) * [-1611.708] (-1612.360) (-1614.770) (-1611.751) -- 0:00:45
      316000 -- (-1613.249) [-1611.824] (-1612.477) (-1612.709) * (-1611.257) (-1613.814) (-1616.663) [-1612.768] -- 0:00:45
      316500 -- (-1615.502) (-1611.536) [-1613.850] (-1612.707) * [-1611.308] (-1613.932) (-1615.564) (-1615.735) -- 0:00:45
      317000 -- (-1612.618) (-1611.383) (-1611.360) [-1612.958] * (-1612.638) [-1613.404] (-1614.562) (-1615.154) -- 0:00:45
      317500 -- [-1613.833] (-1613.204) (-1611.678) (-1612.491) * (-1614.239) (-1614.152) [-1614.608] (-1614.232) -- 0:00:45
      318000 -- [-1613.071] (-1614.153) (-1611.816) (-1611.769) * (-1614.716) (-1611.863) (-1613.168) [-1612.343] -- 0:00:45
      318500 -- [-1611.129] (-1612.668) (-1616.328) (-1612.618) * [-1612.829] (-1613.241) (-1613.168) (-1611.188) -- 0:00:44
      319000 -- [-1611.101] (-1614.900) (-1618.087) (-1612.537) * [-1611.977] (-1611.929) (-1614.698) (-1611.178) -- 0:00:44
      319500 -- (-1616.584) [-1614.272] (-1612.762) (-1612.635) * (-1611.026) [-1612.383] (-1612.005) (-1611.592) -- 0:00:44
      320000 -- (-1614.494) (-1613.920) (-1612.141) [-1613.869] * (-1611.587) (-1611.607) (-1613.803) [-1611.582] -- 0:00:44

      Average standard deviation of split frequencies: 0.014517

      320500 -- (-1612.803) (-1614.461) (-1619.817) [-1611.314] * (-1613.058) [-1611.316] (-1613.073) (-1614.217) -- 0:00:44
      321000 -- (-1611.655) [-1616.378] (-1616.983) (-1617.104) * (-1611.360) [-1611.850] (-1611.687) (-1617.072) -- 0:00:44
      321500 -- (-1611.554) (-1619.697) [-1616.009] (-1614.483) * (-1611.291) [-1613.781] (-1616.051) (-1614.952) -- 0:00:44
      322000 -- (-1612.335) (-1619.935) (-1617.372) [-1612.351] * (-1611.548) (-1613.728) [-1613.256] (-1614.300) -- 0:00:44
      322500 -- (-1612.453) [-1618.742] (-1619.778) (-1613.681) * (-1613.621) (-1612.164) (-1612.148) [-1612.994] -- 0:00:44
      323000 -- [-1612.114] (-1614.390) (-1615.539) (-1615.320) * (-1612.727) (-1612.129) [-1612.858] (-1612.619) -- 0:00:44
      323500 -- [-1612.970] (-1615.170) (-1613.154) (-1618.192) * (-1613.710) (-1616.716) (-1614.467) [-1612.521] -- 0:00:43
      324000 -- (-1614.990) (-1613.135) [-1612.722] (-1614.591) * (-1613.293) (-1614.709) (-1615.652) [-1612.417] -- 0:00:43
      324500 -- [-1615.821] (-1613.537) (-1614.541) (-1613.285) * (-1614.339) [-1613.900] (-1616.132) (-1615.446) -- 0:00:43
      325000 -- (-1612.161) [-1612.519] (-1615.110) (-1613.175) * [-1615.614] (-1613.619) (-1613.865) (-1614.349) -- 0:00:43

      Average standard deviation of split frequencies: 0.013577

      325500 -- (-1612.833) (-1611.932) [-1613.034] (-1612.027) * (-1611.880) (-1612.509) (-1614.599) [-1611.760] -- 0:00:43
      326000 -- (-1614.536) (-1612.646) (-1612.562) [-1612.313] * [-1613.203] (-1612.012) (-1612.768) (-1613.273) -- 0:00:45
      326500 -- [-1613.413] (-1613.192) (-1612.150) (-1613.164) * [-1613.243] (-1612.077) (-1613.870) (-1614.494) -- 0:00:45
      327000 -- (-1615.879) (-1611.735) [-1611.637] (-1613.241) * [-1614.617] (-1615.519) (-1616.265) (-1613.880) -- 0:00:45
      327500 -- [-1612.510] (-1616.037) (-1613.997) (-1612.616) * (-1614.094) (-1614.687) (-1618.627) [-1613.868] -- 0:00:45
      328000 -- (-1612.741) (-1615.469) (-1613.054) [-1614.284] * [-1612.313] (-1613.752) (-1619.051) (-1613.005) -- 0:00:45
      328500 -- (-1613.947) (-1614.010) (-1614.400) [-1612.922] * (-1612.223) [-1611.047] (-1612.402) (-1612.990) -- 0:00:44
      329000 -- (-1615.094) [-1612.959] (-1611.977) (-1615.998) * [-1611.704] (-1611.969) (-1611.714) (-1614.715) -- 0:00:44
      329500 -- (-1612.196) (-1612.112) (-1612.763) [-1613.086] * (-1618.043) (-1612.999) (-1613.600) [-1613.608] -- 0:00:44
      330000 -- (-1612.488) [-1611.319] (-1612.846) (-1615.918) * (-1611.787) [-1613.252] (-1618.641) (-1613.452) -- 0:00:44

      Average standard deviation of split frequencies: 0.013385

      330500 -- [-1611.462] (-1611.455) (-1612.647) (-1614.855) * (-1613.190) (-1614.842) [-1618.299] (-1612.218) -- 0:00:44
      331000 -- (-1611.801) (-1612.925) (-1612.215) [-1612.582] * (-1613.306) [-1612.296] (-1616.638) (-1611.619) -- 0:00:44
      331500 -- (-1611.342) (-1615.875) [-1613.199] (-1613.400) * [-1613.932] (-1611.680) (-1615.589) (-1618.955) -- 0:00:44
      332000 -- (-1613.434) (-1614.275) (-1613.263) [-1614.263] * (-1612.083) (-1612.152) (-1612.343) [-1614.326] -- 0:00:44
      332500 -- [-1612.791] (-1611.808) (-1614.068) (-1613.746) * (-1611.608) (-1611.083) [-1613.202] (-1612.485) -- 0:00:44
      333000 -- (-1612.514) [-1614.968] (-1612.656) (-1612.984) * (-1611.278) [-1613.856] (-1614.458) (-1614.228) -- 0:00:44
      333500 -- [-1612.524] (-1612.701) (-1613.468) (-1612.345) * (-1611.050) (-1615.019) (-1612.330) [-1611.180] -- 0:00:43
      334000 -- (-1614.285) (-1612.627) [-1615.369] (-1621.715) * [-1612.885] (-1613.806) (-1614.015) (-1612.134) -- 0:00:43
      334500 -- (-1613.006) (-1612.467) [-1612.278] (-1612.948) * (-1614.609) (-1613.601) [-1613.448] (-1614.063) -- 0:00:43
      335000 -- (-1613.086) (-1613.268) [-1612.499] (-1619.903) * (-1615.222) [-1614.337] (-1613.817) (-1614.362) -- 0:00:43

      Average standard deviation of split frequencies: 0.012462

      335500 -- (-1613.471) (-1617.152) [-1612.433] (-1615.997) * (-1612.067) (-1614.579) (-1611.531) [-1611.929] -- 0:00:43
      336000 -- (-1613.538) (-1614.310) (-1613.821) [-1616.333] * (-1612.792) (-1618.678) [-1613.945] (-1612.161) -- 0:00:43
      336500 -- (-1612.263) (-1617.023) [-1614.124] (-1616.401) * (-1615.708) (-1617.432) [-1611.480] (-1612.387) -- 0:00:43
      337000 -- (-1613.296) (-1615.095) (-1613.853) [-1613.181] * (-1614.360) (-1618.357) (-1614.273) [-1612.349] -- 0:00:43
      337500 -- (-1612.814) [-1612.543] (-1614.065) (-1618.184) * [-1614.840] (-1615.232) (-1612.292) (-1612.045) -- 0:00:43
      338000 -- (-1612.802) (-1613.058) [-1617.179] (-1615.680) * [-1614.446] (-1615.116) (-1614.403) (-1611.547) -- 0:00:43
      338500 -- [-1612.625] (-1612.497) (-1612.889) (-1612.871) * (-1613.216) [-1616.567] (-1613.411) (-1612.125) -- 0:00:42
      339000 -- (-1613.388) (-1612.748) [-1614.996] (-1613.830) * [-1611.871] (-1614.542) (-1612.557) (-1615.169) -- 0:00:42
      339500 -- (-1613.530) [-1612.193] (-1616.271) (-1613.166) * (-1612.549) [-1614.423] (-1611.311) (-1617.882) -- 0:00:42
      340000 -- (-1611.516) [-1612.637] (-1614.785) (-1612.804) * (-1615.516) [-1612.246] (-1612.709) (-1616.357) -- 0:00:42

      Average standard deviation of split frequencies: 0.013349

      340500 -- (-1611.659) (-1612.192) [-1611.111] (-1612.297) * (-1616.398) (-1613.111) (-1612.983) [-1615.719] -- 0:00:42
      341000 -- [-1614.585] (-1611.570) (-1612.186) (-1614.738) * [-1615.075] (-1614.261) (-1611.826) (-1613.063) -- 0:00:42
      341500 -- (-1614.273) (-1615.766) (-1612.883) [-1613.383] * (-1616.418) [-1612.610] (-1612.784) (-1613.934) -- 0:00:42
      342000 -- (-1614.378) (-1611.475) (-1611.673) [-1612.073] * (-1613.600) (-1612.511) [-1611.630] (-1615.315) -- 0:00:44
      342500 -- [-1618.026] (-1613.351) (-1613.143) (-1613.246) * (-1612.848) (-1613.173) (-1614.738) [-1618.700] -- 0:00:44
      343000 -- (-1614.298) (-1617.286) (-1615.410) [-1613.567] * [-1612.979] (-1611.983) (-1613.665) (-1612.202) -- 0:00:44
      343500 -- (-1616.073) (-1613.302) (-1612.911) [-1614.394] * [-1614.374] (-1614.077) (-1612.976) (-1611.945) -- 0:00:43
      344000 -- (-1616.179) [-1614.467] (-1612.204) (-1613.301) * (-1612.768) (-1611.519) [-1611.987] (-1611.972) -- 0:00:43
      344500 -- (-1615.077) [-1612.517] (-1613.490) (-1612.331) * (-1611.862) [-1611.631] (-1611.619) (-1611.790) -- 0:00:43
      345000 -- (-1612.273) (-1613.521) [-1613.069] (-1613.519) * (-1612.874) (-1613.918) (-1611.168) [-1612.926] -- 0:00:43

      Average standard deviation of split frequencies: 0.012621

      345500 -- (-1614.829) (-1613.077) (-1612.310) [-1612.081] * [-1613.039] (-1612.328) (-1611.907) (-1613.325) -- 0:00:43
      346000 -- [-1615.378] (-1611.444) (-1614.096) (-1613.340) * [-1613.177] (-1615.082) (-1615.852) (-1614.132) -- 0:00:43
      346500 -- (-1612.831) [-1613.212] (-1616.052) (-1613.534) * (-1613.106) [-1613.334] (-1611.647) (-1615.340) -- 0:00:43
      347000 -- (-1612.721) [-1613.149] (-1616.494) (-1615.602) * (-1614.041) [-1612.691] (-1614.327) (-1613.412) -- 0:00:43
      347500 -- (-1613.488) [-1612.410] (-1615.010) (-1615.228) * (-1614.188) [-1612.479] (-1613.477) (-1613.836) -- 0:00:43
      348000 -- [-1616.111] (-1611.045) (-1614.196) (-1616.112) * (-1617.590) [-1612.287] (-1613.922) (-1614.592) -- 0:00:43
      348500 -- (-1617.115) (-1615.752) [-1613.393] (-1612.768) * (-1613.381) (-1613.505) (-1614.904) [-1612.853] -- 0:00:42
      349000 -- (-1613.456) [-1612.591] (-1612.329) (-1617.653) * (-1615.882) (-1612.666) [-1612.728] (-1615.378) -- 0:00:42
      349500 -- [-1613.034] (-1613.894) (-1612.416) (-1614.952) * (-1616.832) (-1612.935) (-1615.356) [-1615.787] -- 0:00:42
      350000 -- (-1613.434) (-1611.910) [-1612.456] (-1612.063) * (-1614.874) [-1612.121] (-1614.092) (-1612.646) -- 0:00:42

      Average standard deviation of split frequencies: 0.012311

      350500 -- (-1614.930) (-1612.609) (-1614.249) [-1611.700] * (-1612.163) [-1611.596] (-1614.226) (-1613.293) -- 0:00:42
      351000 -- [-1611.460] (-1612.918) (-1613.684) (-1616.582) * [-1613.137] (-1613.646) (-1613.294) (-1611.436) -- 0:00:42
      351500 -- (-1613.820) (-1612.009) (-1616.946) [-1616.534] * (-1612.811) (-1614.469) [-1614.560] (-1611.527) -- 0:00:42
      352000 -- [-1612.364] (-1612.123) (-1616.908) (-1617.235) * (-1613.314) (-1614.445) [-1616.148] (-1612.700) -- 0:00:42
      352500 -- (-1612.627) (-1613.215) [-1615.567] (-1612.580) * [-1612.970] (-1612.843) (-1614.796) (-1614.811) -- 0:00:42
      353000 -- (-1614.414) (-1613.298) (-1613.609) [-1612.715] * (-1611.790) (-1620.193) (-1611.751) [-1616.902] -- 0:00:42
      353500 -- (-1614.784) (-1612.952) [-1614.791] (-1618.758) * (-1614.059) [-1617.520] (-1612.805) (-1613.938) -- 0:00:42
      354000 -- (-1613.815) (-1613.313) [-1613.905] (-1615.936) * (-1612.772) (-1612.502) (-1614.405) [-1614.024] -- 0:00:41
      354500 -- (-1613.056) [-1615.060] (-1616.895) (-1613.829) * (-1612.383) (-1618.185) [-1612.986] (-1613.769) -- 0:00:41
      355000 -- [-1614.007] (-1615.399) (-1615.248) (-1612.488) * (-1612.023) [-1611.444] (-1612.613) (-1617.537) -- 0:00:41

      Average standard deviation of split frequencies: 0.012073

      355500 -- (-1611.628) (-1614.177) [-1614.942] (-1611.975) * (-1613.441) (-1611.464) [-1612.620] (-1621.143) -- 0:00:41
      356000 -- (-1614.625) [-1613.637] (-1614.863) (-1614.525) * (-1612.183) (-1611.708) [-1612.414] (-1616.558) -- 0:00:41
      356500 -- [-1612.341] (-1614.219) (-1612.144) (-1616.378) * (-1612.081) [-1611.804] (-1612.402) (-1612.781) -- 0:00:41
      357000 -- (-1612.029) (-1614.922) [-1612.612] (-1616.294) * (-1612.127) (-1612.864) (-1613.885) [-1613.046] -- 0:00:41
      357500 -- (-1615.491) (-1616.618) (-1614.154) [-1612.839] * (-1613.008) (-1612.424) (-1613.090) [-1612.408] -- 0:00:43
      358000 -- [-1613.134] (-1614.401) (-1613.671) (-1611.349) * (-1612.173) (-1612.146) (-1613.934) [-1613.585] -- 0:00:43
      358500 -- (-1614.601) (-1613.110) (-1613.286) [-1611.349] * (-1612.885) (-1612.893) [-1612.586] (-1613.324) -- 0:00:42
      359000 -- (-1616.702) (-1612.770) (-1613.184) [-1612.781] * [-1612.238] (-1613.001) (-1618.121) (-1612.446) -- 0:00:42
      359500 -- (-1616.222) (-1615.593) [-1613.824] (-1611.887) * [-1612.541] (-1611.976) (-1619.560) (-1614.214) -- 0:00:42
      360000 -- (-1616.663) (-1611.377) [-1611.549] (-1612.538) * [-1612.335] (-1612.432) (-1614.202) (-1615.521) -- 0:00:42

      Average standard deviation of split frequencies: 0.012302

      360500 -- (-1616.716) [-1611.714] (-1611.401) (-1614.507) * (-1612.126) (-1613.274) [-1614.265] (-1615.577) -- 0:00:42
      361000 -- (-1611.233) [-1612.113] (-1612.262) (-1613.399) * [-1613.726] (-1614.006) (-1615.122) (-1611.584) -- 0:00:42
      361500 -- (-1616.647) (-1611.929) (-1615.666) [-1612.421] * (-1611.288) (-1614.031) (-1615.418) [-1617.232] -- 0:00:42
      362000 -- [-1615.081] (-1611.728) (-1613.515) (-1615.099) * (-1613.325) (-1614.420) [-1613.446] (-1611.649) -- 0:00:42
      362500 -- [-1615.825] (-1613.011) (-1614.574) (-1614.473) * (-1613.568) [-1612.947] (-1613.438) (-1612.332) -- 0:00:42
      363000 -- (-1613.425) (-1617.552) [-1612.358] (-1612.012) * (-1615.518) [-1613.510] (-1615.024) (-1611.671) -- 0:00:42
      363500 -- (-1613.243) (-1614.823) [-1612.652] (-1611.700) * (-1616.881) (-1613.873) (-1613.944) [-1611.552] -- 0:00:42
      364000 -- (-1613.392) [-1615.260] (-1614.977) (-1614.554) * (-1614.076) (-1611.959) (-1616.048) [-1612.505] -- 0:00:41
      364500 -- (-1617.183) (-1613.845) [-1615.844] (-1615.146) * (-1613.124) (-1613.703) (-1614.049) [-1615.435] -- 0:00:41
      365000 -- (-1613.628) (-1612.248) (-1615.493) [-1613.014] * (-1614.421) (-1612.784) (-1611.284) [-1611.881] -- 0:00:41

      Average standard deviation of split frequencies: 0.012425

      365500 -- [-1612.681] (-1612.338) (-1613.827) (-1613.675) * (-1614.602) (-1617.363) [-1611.784] (-1613.771) -- 0:00:41
      366000 -- [-1617.477] (-1611.662) (-1614.375) (-1612.903) * (-1615.273) (-1611.870) (-1615.190) [-1615.082] -- 0:00:41
      366500 -- [-1614.745] (-1611.822) (-1612.561) (-1613.050) * (-1618.372) (-1611.362) (-1617.909) [-1618.236] -- 0:00:41
      367000 -- (-1613.845) (-1612.188) (-1612.743) [-1613.158] * [-1614.155] (-1613.434) (-1615.222) (-1613.322) -- 0:00:41
      367500 -- [-1612.602] (-1611.837) (-1611.494) (-1613.691) * (-1614.203) [-1611.226] (-1613.332) (-1612.748) -- 0:00:41
      368000 -- (-1612.887) [-1614.150] (-1613.018) (-1612.069) * (-1614.323) [-1615.864] (-1611.111) (-1612.510) -- 0:00:41
      368500 -- (-1611.520) [-1612.696] (-1615.737) (-1611.902) * (-1621.839) (-1612.457) [-1615.381] (-1614.988) -- 0:00:41
      369000 -- (-1614.770) (-1612.957) [-1615.762] (-1615.455) * (-1613.190) (-1612.421) (-1613.606) [-1610.978] -- 0:00:41
      369500 -- (-1614.922) (-1611.556) (-1618.832) [-1611.483] * (-1612.153) (-1616.537) [-1611.617] (-1614.934) -- 0:00:40
      370000 -- [-1613.830] (-1612.190) (-1614.504) (-1612.371) * [-1611.595] (-1614.261) (-1614.071) (-1616.284) -- 0:00:40

      Average standard deviation of split frequencies: 0.012568

      370500 -- [-1612.536] (-1611.881) (-1616.001) (-1613.716) * (-1611.490) [-1611.789] (-1614.217) (-1615.730) -- 0:00:40
      371000 -- (-1614.366) [-1613.211] (-1613.803) (-1616.405) * [-1612.593] (-1611.999) (-1614.580) (-1615.838) -- 0:00:40
      371500 -- (-1613.352) [-1613.581] (-1615.642) (-1612.715) * (-1614.795) (-1612.918) (-1613.000) [-1614.356] -- 0:00:40
      372000 -- [-1612.543] (-1612.955) (-1611.898) (-1612.071) * (-1618.246) (-1615.651) (-1617.619) [-1611.982] -- 0:00:40
      372500 -- [-1612.501] (-1612.068) (-1612.820) (-1611.219) * (-1613.799) (-1614.354) [-1612.091] (-1612.155) -- 0:00:40
      373000 -- (-1611.397) (-1612.111) [-1611.803] (-1611.675) * (-1613.429) (-1614.209) [-1612.513] (-1613.344) -- 0:00:40
      373500 -- (-1611.811) (-1614.137) [-1613.060] (-1611.572) * [-1614.057] (-1612.798) (-1611.458) (-1614.456) -- 0:00:41
      374000 -- (-1611.993) (-1613.085) (-1615.431) [-1611.510] * [-1611.672] (-1617.038) (-1612.309) (-1612.332) -- 0:00:41
      374500 -- (-1611.399) (-1613.658) (-1612.031) [-1612.395] * (-1612.840) (-1621.642) [-1612.308] (-1611.466) -- 0:00:41
      375000 -- (-1612.099) [-1615.159] (-1613.981) (-1612.334) * (-1611.395) (-1615.221) (-1615.935) [-1613.710] -- 0:00:41

      Average standard deviation of split frequencies: 0.012169

      375500 -- (-1612.205) (-1613.937) [-1618.602] (-1611.542) * (-1611.410) (-1615.401) (-1615.793) [-1613.716] -- 0:00:41
      376000 -- (-1612.745) (-1613.967) (-1612.529) [-1611.728] * [-1612.846] (-1614.067) (-1612.709) (-1611.415) -- 0:00:41
      376500 -- (-1612.916) (-1613.791) (-1612.238) [-1611.894] * (-1615.413) [-1611.900] (-1611.702) (-1614.664) -- 0:00:41
      377000 -- (-1615.009) [-1611.238] (-1615.526) (-1611.824) * (-1614.195) (-1618.280) [-1615.157] (-1614.709) -- 0:00:41
      377500 -- (-1618.378) (-1615.911) (-1614.247) [-1613.098] * (-1613.124) (-1614.245) [-1613.296] (-1614.113) -- 0:00:41
      378000 -- [-1615.135] (-1613.403) (-1617.697) (-1615.608) * [-1611.635] (-1616.061) (-1612.466) (-1614.622) -- 0:00:41
      378500 -- (-1612.609) (-1612.294) [-1614.241] (-1614.508) * (-1611.636) (-1613.495) [-1614.642] (-1612.615) -- 0:00:41
      379000 -- [-1612.284] (-1611.868) (-1615.576) (-1613.843) * (-1613.514) (-1612.934) (-1613.814) [-1612.826] -- 0:00:40
      379500 -- [-1611.488] (-1619.262) (-1611.580) (-1616.747) * [-1614.503] (-1612.167) (-1614.094) (-1611.836) -- 0:00:40
      380000 -- [-1612.119] (-1615.010) (-1611.580) (-1617.435) * (-1613.228) (-1611.576) (-1617.233) [-1611.781] -- 0:00:40

      Average standard deviation of split frequencies: 0.013039

      380500 -- (-1614.973) [-1612.328] (-1615.953) (-1617.130) * (-1612.052) [-1611.465] (-1611.304) (-1611.248) -- 0:00:40
      381000 -- (-1614.641) (-1612.395) [-1615.953] (-1615.005) * [-1612.474] (-1612.512) (-1616.270) (-1613.867) -- 0:00:40
      381500 -- (-1611.924) (-1615.515) (-1613.699) [-1612.812] * (-1611.914) [-1611.509] (-1619.854) (-1613.425) -- 0:00:40
      382000 -- (-1612.033) (-1611.800) [-1613.814] (-1613.241) * (-1616.672) [-1615.123] (-1618.859) (-1614.001) -- 0:00:40
      382500 -- [-1613.816] (-1613.815) (-1614.727) (-1614.342) * (-1615.753) (-1612.335) [-1613.813] (-1614.159) -- 0:00:40
      383000 -- (-1612.703) (-1614.418) (-1613.383) [-1612.804] * (-1612.664) (-1611.380) [-1612.422] (-1614.205) -- 0:00:40
      383500 -- (-1618.282) (-1615.545) [-1612.391] (-1613.829) * (-1612.876) (-1613.456) (-1611.487) [-1612.817] -- 0:00:40
      384000 -- [-1612.339] (-1612.531) (-1612.401) (-1614.626) * (-1613.895) [-1614.398] (-1611.554) (-1614.065) -- 0:00:40
      384500 -- (-1618.430) (-1612.379) (-1612.617) [-1612.774] * (-1612.332) [-1613.618] (-1611.478) (-1613.633) -- 0:00:40
      385000 -- (-1612.246) (-1613.528) [-1612.737] (-1612.911) * (-1613.823) (-1613.563) (-1611.514) [-1613.114] -- 0:00:39

      Average standard deviation of split frequencies: 0.011494

      385500 -- [-1612.935] (-1615.532) (-1614.990) (-1612.680) * [-1611.810] (-1614.993) (-1611.654) (-1614.230) -- 0:00:39
      386000 -- [-1612.278] (-1617.039) (-1612.961) (-1613.676) * (-1613.115) [-1614.314] (-1613.630) (-1616.308) -- 0:00:39
      386500 -- (-1611.929) (-1615.920) [-1611.237] (-1613.955) * [-1611.602] (-1611.434) (-1612.565) (-1614.865) -- 0:00:39
      387000 -- (-1617.148) (-1614.841) (-1611.270) [-1617.337] * (-1617.355) [-1612.854] (-1613.497) (-1617.575) -- 0:00:39
      387500 -- (-1614.606) (-1616.656) [-1614.010] (-1612.466) * (-1618.801) (-1612.302) [-1613.957] (-1616.797) -- 0:00:39
      388000 -- (-1613.522) (-1613.492) [-1613.619] (-1616.584) * (-1614.171) [-1611.728] (-1611.041) (-1615.328) -- 0:00:39
      388500 -- [-1612.675] (-1612.405) (-1613.449) (-1618.150) * (-1614.350) [-1611.183] (-1612.570) (-1613.875) -- 0:00:39
      389000 -- (-1614.489) (-1611.053) (-1611.621) [-1618.053] * (-1614.965) (-1614.631) (-1616.620) [-1613.879] -- 0:00:40
      389500 -- (-1613.763) [-1612.612] (-1613.556) (-1614.847) * (-1614.140) (-1619.157) [-1612.470] (-1613.552) -- 0:00:40
      390000 -- (-1615.426) (-1614.056) [-1614.364] (-1613.474) * [-1615.947] (-1613.193) (-1611.797) (-1615.085) -- 0:00:40

      Average standard deviation of split frequencies: 0.011086

      390500 -- (-1614.947) (-1616.239) [-1613.506] (-1612.727) * [-1615.581] (-1616.880) (-1612.606) (-1614.246) -- 0:00:40
      391000 -- (-1616.094) [-1611.040] (-1613.632) (-1612.172) * (-1614.121) (-1611.999) [-1611.418] (-1617.185) -- 0:00:40
      391500 -- (-1613.987) [-1616.849] (-1615.944) (-1611.269) * (-1618.119) (-1613.953) (-1612.652) [-1615.142] -- 0:00:40
      392000 -- (-1613.083) [-1611.549] (-1612.833) (-1611.987) * (-1616.533) [-1612.225] (-1612.184) (-1615.415) -- 0:00:40
      392500 -- (-1613.134) (-1613.260) (-1612.501) [-1613.639] * (-1614.273) [-1611.803] (-1614.999) (-1613.939) -- 0:00:40
      393000 -- (-1611.858) (-1611.596) (-1612.238) [-1613.132] * [-1614.321] (-1612.178) (-1612.034) (-1613.090) -- 0:00:40
      393500 -- (-1613.725) (-1611.914) [-1614.087] (-1614.637) * (-1613.089) (-1613.649) [-1612.031] (-1611.161) -- 0:00:40
      394000 -- [-1613.773] (-1611.364) (-1614.010) (-1614.933) * (-1612.048) (-1613.683) [-1611.897] (-1611.056) -- 0:00:39
      394500 -- [-1616.326] (-1612.275) (-1614.860) (-1613.359) * (-1612.430) (-1613.376) (-1615.559) [-1611.382] -- 0:00:39
      395000 -- (-1615.902) (-1612.417) (-1615.594) [-1613.137] * (-1614.120) [-1611.869] (-1617.116) (-1612.152) -- 0:00:39

      Average standard deviation of split frequencies: 0.011755

      395500 -- (-1613.417) [-1615.449] (-1613.613) (-1613.786) * [-1621.458] (-1613.416) (-1614.629) (-1612.217) -- 0:00:39
      396000 -- (-1613.448) (-1617.600) (-1614.778) [-1614.640] * (-1622.383) [-1614.998] (-1612.362) (-1612.159) -- 0:00:39
      396500 -- (-1613.498) (-1614.896) (-1615.832) [-1612.854] * (-1612.947) (-1611.430) (-1612.362) [-1612.801] -- 0:00:39
      397000 -- (-1614.326) (-1613.120) (-1610.939) [-1612.579] * (-1613.737) [-1611.747] (-1612.680) (-1611.315) -- 0:00:39
      397500 -- (-1614.117) (-1614.658) [-1611.434] (-1611.966) * [-1614.037] (-1611.988) (-1614.885) (-1611.809) -- 0:00:39
      398000 -- (-1613.388) (-1614.804) [-1611.434] (-1612.709) * (-1614.674) (-1613.926) (-1614.378) [-1614.110] -- 0:00:39
      398500 -- [-1611.449] (-1613.416) (-1612.793) (-1612.091) * [-1613.953] (-1614.389) (-1612.501) (-1613.190) -- 0:00:39
      399000 -- (-1611.982) (-1612.879) (-1612.074) [-1612.102] * (-1612.205) (-1614.520) [-1612.398] (-1618.951) -- 0:00:39
      399500 -- (-1612.556) (-1612.123) (-1612.295) [-1611.972] * (-1615.650) (-1613.883) [-1612.020] (-1614.100) -- 0:00:39
      400000 -- (-1612.201) (-1611.840) (-1613.193) [-1612.565] * [-1612.472] (-1613.861) (-1612.923) (-1616.203) -- 0:00:39

      Average standard deviation of split frequencies: 0.011618

      400500 -- (-1612.001) [-1612.007] (-1611.937) (-1612.825) * (-1612.084) (-1614.406) [-1611.542] (-1617.973) -- 0:00:38
      401000 -- (-1612.071) (-1612.295) [-1612.997] (-1613.419) * (-1612.021) (-1613.430) [-1611.631] (-1617.654) -- 0:00:38
      401500 -- (-1612.252) [-1616.383] (-1618.161) (-1613.420) * [-1612.412] (-1614.670) (-1615.840) (-1611.233) -- 0:00:38
      402000 -- (-1611.889) (-1612.699) [-1613.671] (-1615.296) * [-1613.639] (-1617.208) (-1614.026) (-1612.251) -- 0:00:38
      402500 -- (-1612.005) [-1612.058] (-1611.959) (-1615.623) * (-1611.887) (-1613.584) (-1615.042) [-1613.137] -- 0:00:38
      403000 -- [-1615.758] (-1612.037) (-1615.619) (-1612.548) * (-1614.017) (-1613.802) [-1616.494] (-1610.938) -- 0:00:38
      403500 -- [-1612.947] (-1612.392) (-1624.156) (-1614.863) * (-1611.562) (-1613.948) [-1615.716] (-1611.725) -- 0:00:38
      404000 -- [-1613.730] (-1612.528) (-1621.264) (-1616.466) * (-1614.229) (-1612.920) (-1612.789) [-1612.884] -- 0:00:38
      404500 -- (-1615.052) [-1613.114] (-1613.066) (-1618.536) * [-1617.283] (-1611.479) (-1614.584) (-1612.791) -- 0:00:39
      405000 -- [-1612.902] (-1615.460) (-1615.677) (-1611.620) * (-1613.752) (-1611.493) (-1612.827) [-1613.096] -- 0:00:39

      Average standard deviation of split frequencies: 0.012264

      405500 -- (-1614.882) (-1612.551) (-1615.632) [-1612.138] * [-1614.268] (-1612.981) (-1612.123) (-1613.560) -- 0:00:39
      406000 -- (-1615.504) (-1614.779) [-1613.079] (-1614.449) * [-1613.317] (-1611.582) (-1611.168) (-1615.340) -- 0:00:39
      406500 -- (-1617.394) [-1615.402] (-1614.151) (-1612.481) * (-1612.996) [-1612.679] (-1611.702) (-1614.047) -- 0:00:39
      407000 -- (-1613.932) (-1612.261) [-1613.377] (-1614.464) * [-1613.080] (-1613.387) (-1612.367) (-1611.904) -- 0:00:39
      407500 -- (-1613.770) [-1613.003] (-1612.525) (-1614.294) * (-1613.410) (-1611.874) [-1613.262] (-1612.814) -- 0:00:39
      408000 -- (-1614.763) (-1613.966) (-1615.084) [-1612.830] * (-1612.188) (-1614.620) (-1613.608) [-1612.830] -- 0:00:39
      408500 -- (-1613.945) (-1611.745) (-1613.464) [-1613.021] * (-1612.245) [-1614.086] (-1612.419) (-1614.359) -- 0:00:39
      409000 -- [-1617.083] (-1613.950) (-1611.393) (-1615.944) * (-1617.135) [-1614.946] (-1616.128) (-1612.878) -- 0:00:39
      409500 -- (-1611.922) [-1611.900] (-1611.574) (-1613.158) * (-1615.354) (-1614.006) (-1616.719) [-1613.627] -- 0:00:38
      410000 -- [-1615.285] (-1613.123) (-1613.531) (-1614.126) * (-1613.263) (-1614.513) [-1612.423] (-1611.968) -- 0:00:38

      Average standard deviation of split frequencies: 0.011766

      410500 -- (-1613.450) [-1612.677] (-1614.239) (-1613.957) * (-1615.186) (-1613.981) [-1612.444] (-1614.670) -- 0:00:38
      411000 -- (-1612.726) (-1614.252) [-1612.587] (-1613.942) * (-1616.012) [-1614.274] (-1613.370) (-1611.823) -- 0:00:38
      411500 -- (-1615.666) [-1613.451] (-1612.587) (-1614.169) * [-1618.007] (-1611.472) (-1614.175) (-1614.255) -- 0:00:38
      412000 -- (-1613.032) (-1612.935) [-1613.360] (-1614.428) * (-1612.714) (-1612.153) (-1614.182) [-1613.249] -- 0:00:38
      412500 -- (-1612.797) (-1615.575) [-1611.519] (-1611.961) * [-1612.616] (-1614.978) (-1613.684) (-1615.413) -- 0:00:38
      413000 -- [-1612.934] (-1614.904) (-1612.972) (-1613.126) * [-1614.830] (-1612.234) (-1612.088) (-1615.942) -- 0:00:38
      413500 -- (-1615.817) (-1611.863) [-1611.691] (-1614.755) * [-1611.816] (-1612.659) (-1612.637) (-1611.661) -- 0:00:38
      414000 -- (-1612.037) (-1611.347) [-1610.935] (-1611.180) * (-1612.945) (-1613.011) (-1617.394) [-1613.186] -- 0:00:38
      414500 -- [-1612.085] (-1611.226) (-1612.684) (-1611.962) * (-1614.945) (-1612.608) (-1617.512) [-1611.810] -- 0:00:38
      415000 -- [-1611.347] (-1612.760) (-1611.530) (-1611.953) * (-1614.663) (-1611.979) (-1614.420) [-1613.451] -- 0:00:38

      Average standard deviation of split frequencies: 0.011544

      415500 -- (-1611.038) [-1611.946] (-1610.835) (-1613.500) * (-1614.998) (-1611.813) (-1614.628) [-1612.070] -- 0:00:37
      416000 -- [-1611.900] (-1615.141) (-1613.042) (-1612.987) * [-1615.775] (-1612.518) (-1613.974) (-1611.313) -- 0:00:37
      416500 -- [-1611.233] (-1615.800) (-1615.815) (-1611.612) * [-1615.094] (-1613.221) (-1615.813) (-1613.257) -- 0:00:37
      417000 -- (-1611.429) (-1617.051) (-1613.561) [-1616.529] * [-1616.660] (-1612.928) (-1612.808) (-1612.692) -- 0:00:37
      417500 -- (-1614.368) (-1615.237) (-1612.835) [-1616.086] * (-1614.638) (-1612.613) [-1613.189] (-1616.870) -- 0:00:37
      418000 -- (-1614.698) (-1613.956) [-1612.947] (-1615.013) * (-1614.356) (-1612.984) (-1614.137) [-1612.056] -- 0:00:37
      418500 -- (-1615.018) [-1613.942] (-1616.249) (-1612.250) * [-1617.541] (-1618.669) (-1611.464) (-1612.549) -- 0:00:37
      419000 -- [-1617.522] (-1615.088) (-1615.553) (-1616.900) * [-1612.198] (-1620.267) (-1613.970) (-1615.293) -- 0:00:37
      419500 -- (-1616.008) (-1616.206) [-1616.702] (-1611.885) * [-1612.671] (-1614.634) (-1611.949) (-1613.445) -- 0:00:37
      420000 -- [-1613.248] (-1614.610) (-1615.388) (-1616.635) * (-1616.785) (-1618.327) (-1612.778) [-1611.672] -- 0:00:38

      Average standard deviation of split frequencies: 0.011416

      420500 -- (-1613.843) [-1614.333] (-1613.815) (-1614.303) * (-1613.293) (-1617.420) [-1613.043] (-1612.259) -- 0:00:38
      421000 -- (-1612.388) (-1614.957) (-1617.368) [-1613.413] * (-1617.161) [-1611.946] (-1613.685) (-1611.344) -- 0:00:38
      421500 -- (-1611.833) (-1615.468) [-1616.141] (-1614.658) * (-1612.932) [-1611.624] (-1613.081) (-1613.752) -- 0:00:38
      422000 -- (-1611.782) (-1617.085) [-1616.118] (-1611.323) * (-1615.897) (-1617.899) [-1614.717] (-1613.706) -- 0:00:38
      422500 -- (-1611.737) [-1614.125] (-1613.506) (-1615.231) * (-1616.052) [-1616.247] (-1614.942) (-1613.104) -- 0:00:38
      423000 -- [-1614.594] (-1615.128) (-1613.074) (-1613.765) * (-1613.867) (-1614.045) (-1613.381) [-1612.680] -- 0:00:38
      423500 -- (-1613.920) (-1614.112) (-1611.665) [-1612.061] * (-1614.652) [-1611.238] (-1612.171) (-1612.386) -- 0:00:38
      424000 -- (-1613.563) [-1613.275] (-1614.231) (-1612.991) * [-1614.407] (-1617.546) (-1611.701) (-1613.582) -- 0:00:38
      424500 -- [-1611.662] (-1619.672) (-1613.872) (-1615.816) * (-1612.665) [-1614.622] (-1619.384) (-1614.972) -- 0:00:37
      425000 -- (-1612.342) (-1620.315) (-1612.805) [-1612.498] * (-1612.418) [-1613.703] (-1619.702) (-1615.604) -- 0:00:37

      Average standard deviation of split frequencies: 0.010858

      425500 -- (-1612.429) (-1615.994) [-1617.248] (-1611.856) * (-1613.336) (-1612.309) [-1611.780] (-1613.028) -- 0:00:37
      426000 -- (-1612.462) [-1613.257] (-1618.674) (-1614.566) * (-1612.359) (-1611.992) [-1612.692] (-1616.080) -- 0:00:37
      426500 -- (-1612.375) [-1612.108] (-1611.653) (-1615.987) * (-1613.308) [-1611.614] (-1611.485) (-1615.496) -- 0:00:37
      427000 -- (-1611.807) [-1613.307] (-1613.668) (-1612.486) * [-1615.767] (-1612.960) (-1612.178) (-1612.925) -- 0:00:37
      427500 -- (-1611.233) (-1619.724) (-1613.557) [-1612.974] * [-1612.430] (-1613.798) (-1612.823) (-1613.157) -- 0:00:37
      428000 -- [-1612.445] (-1620.543) (-1613.178) (-1611.608) * (-1612.755) [-1615.233] (-1614.604) (-1611.264) -- 0:00:37
      428500 -- (-1613.033) [-1612.861] (-1611.950) (-1613.864) * (-1611.655) (-1613.179) [-1611.662] (-1613.036) -- 0:00:37
      429000 -- (-1613.973) [-1611.524] (-1611.642) (-1614.344) * [-1612.086] (-1615.932) (-1615.694) (-1612.395) -- 0:00:37
      429500 -- (-1618.166) [-1613.047] (-1611.562) (-1612.380) * (-1612.100) [-1612.193] (-1613.730) (-1622.458) -- 0:00:37
      430000 -- (-1612.760) (-1613.254) [-1611.698] (-1613.278) * (-1615.687) (-1611.919) [-1612.666] (-1613.776) -- 0:00:37

      Average standard deviation of split frequencies: 0.011014

      430500 -- [-1612.928] (-1612.396) (-1612.460) (-1616.186) * (-1613.873) [-1611.738] (-1611.883) (-1612.163) -- 0:00:37
      431000 -- (-1612.614) [-1616.510] (-1611.886) (-1613.374) * (-1612.620) (-1612.455) (-1619.127) [-1613.357] -- 0:00:36
      431500 -- (-1616.362) [-1614.193] (-1614.155) (-1612.729) * (-1613.892) (-1612.475) [-1614.287] (-1613.433) -- 0:00:36
      432000 -- [-1615.202] (-1618.542) (-1614.754) (-1613.090) * (-1614.214) (-1611.936) [-1614.131] (-1614.059) -- 0:00:36
      432500 -- (-1612.485) (-1615.486) (-1613.264) [-1611.617] * (-1613.277) (-1611.785) [-1614.170] (-1612.023) -- 0:00:36
      433000 -- (-1611.718) (-1613.521) (-1612.847) [-1612.397] * (-1614.503) [-1613.541] (-1612.121) (-1613.976) -- 0:00:36
      433500 -- (-1612.126) (-1615.492) (-1611.961) [-1611.690] * (-1613.833) (-1613.465) (-1612.121) [-1613.827] -- 0:00:36
      434000 -- (-1611.687) [-1611.696] (-1616.746) (-1611.514) * (-1614.553) (-1612.163) (-1612.244) [-1613.048] -- 0:00:36
      434500 -- [-1613.174] (-1611.371) (-1613.750) (-1614.292) * [-1611.675] (-1613.661) (-1611.978) (-1612.599) -- 0:00:36
      435000 -- (-1612.870) (-1612.470) (-1613.342) [-1613.107] * (-1612.498) (-1611.818) [-1612.270] (-1613.287) -- 0:00:36

      Average standard deviation of split frequencies: 0.010744

      435500 -- (-1612.900) [-1613.903] (-1615.100) (-1615.177) * (-1615.369) (-1613.515) [-1611.189] (-1619.768) -- 0:00:36
      436000 -- [-1611.968] (-1612.957) (-1612.215) (-1615.613) * [-1611.632] (-1612.472) (-1614.748) (-1614.773) -- 0:00:37
      436500 -- (-1611.741) (-1615.104) (-1612.408) [-1616.203] * (-1617.083) [-1614.957] (-1613.066) (-1616.314) -- 0:00:37
      437000 -- (-1616.500) (-1615.933) [-1611.882] (-1613.591) * [-1614.479] (-1613.118) (-1615.790) (-1621.737) -- 0:00:37
      437500 -- (-1616.688) (-1616.611) [-1612.675] (-1613.591) * (-1612.543) (-1615.082) (-1617.713) [-1617.320] -- 0:00:37
      438000 -- (-1613.326) (-1611.891) (-1612.207) [-1614.166] * [-1611.359] (-1616.075) (-1613.456) (-1614.213) -- 0:00:37
      438500 -- (-1616.061) [-1614.215] (-1615.209) (-1613.825) * (-1611.266) [-1613.086] (-1614.973) (-1614.037) -- 0:00:37
      439000 -- (-1615.629) (-1612.793) (-1612.371) [-1612.620] * [-1610.938] (-1613.926) (-1621.240) (-1617.517) -- 0:00:37
      439500 -- (-1614.441) [-1613.051] (-1612.356) (-1611.610) * (-1613.887) (-1611.959) [-1613.199] (-1613.343) -- 0:00:36
      440000 -- (-1616.426) (-1612.004) [-1613.593] (-1613.482) * (-1615.627) (-1614.032) (-1612.789) [-1612.201] -- 0:00:36

      Average standard deviation of split frequencies: 0.011366

      440500 -- [-1613.835] (-1612.777) (-1612.196) (-1616.016) * (-1613.466) (-1613.101) (-1613.055) [-1612.193] -- 0:00:36
      441000 -- (-1613.777) (-1616.914) [-1612.059] (-1616.411) * (-1613.982) [-1612.077] (-1614.730) (-1612.751) -- 0:00:36
      441500 -- [-1616.190] (-1617.324) (-1613.281) (-1624.394) * [-1614.988] (-1614.093) (-1612.159) (-1617.941) -- 0:00:36
      442000 -- (-1615.727) [-1612.900] (-1621.278) (-1613.686) * (-1612.294) [-1612.387] (-1613.023) (-1616.751) -- 0:00:36
      442500 -- [-1615.660] (-1612.028) (-1619.522) (-1616.930) * (-1613.590) [-1614.361] (-1612.749) (-1616.582) -- 0:00:36
      443000 -- [-1613.872] (-1611.721) (-1617.217) (-1614.366) * [-1613.302] (-1613.797) (-1613.861) (-1612.550) -- 0:00:36
      443500 -- (-1613.103) [-1613.669] (-1614.562) (-1613.328) * [-1612.810] (-1614.536) (-1612.435) (-1613.474) -- 0:00:36
      444000 -- [-1613.571] (-1611.898) (-1613.866) (-1615.590) * (-1613.231) (-1613.827) (-1613.489) [-1613.076] -- 0:00:36
      444500 -- (-1611.414) [-1611.829] (-1612.017) (-1612.073) * [-1615.729] (-1612.710) (-1613.581) (-1613.932) -- 0:00:36
      445000 -- [-1611.838] (-1611.180) (-1613.404) (-1613.313) * (-1614.512) [-1611.543] (-1611.825) (-1613.764) -- 0:00:36

      Average standard deviation of split frequencies: 0.011032

      445500 -- [-1613.436] (-1611.071) (-1611.833) (-1611.556) * [-1616.497] (-1611.645) (-1614.301) (-1612.720) -- 0:00:36
      446000 -- (-1616.214) [-1611.165] (-1612.037) (-1615.759) * (-1617.379) (-1612.884) (-1613.427) [-1613.682] -- 0:00:36
      446500 -- [-1611.061] (-1612.797) (-1614.003) (-1612.761) * [-1613.364] (-1617.486) (-1612.514) (-1612.110) -- 0:00:35
      447000 -- (-1611.259) [-1615.834] (-1614.425) (-1613.879) * (-1612.818) (-1615.815) [-1614.475] (-1612.120) -- 0:00:35
      447500 -- [-1616.241] (-1614.216) (-1616.332) (-1614.186) * (-1613.490) (-1615.710) (-1615.137) [-1613.423] -- 0:00:35
      448000 -- [-1614.749] (-1615.046) (-1612.622) (-1613.559) * (-1613.932) (-1612.567) [-1613.961] (-1613.511) -- 0:00:35
      448500 -- (-1614.643) [-1613.346] (-1612.248) (-1616.306) * (-1613.118) [-1613.374] (-1612.815) (-1612.508) -- 0:00:35
      449000 -- [-1611.949] (-1614.009) (-1612.611) (-1615.261) * (-1613.322) (-1616.887) [-1612.351] (-1612.347) -- 0:00:35
      449500 -- (-1615.565) (-1614.696) [-1614.651] (-1613.119) * (-1612.753) (-1615.978) (-1611.692) [-1612.267] -- 0:00:35
      450000 -- (-1616.184) (-1614.086) [-1615.754] (-1615.460) * (-1611.346) (-1613.121) (-1612.937) [-1615.815] -- 0:00:35

      Average standard deviation of split frequencies: 0.011114

      450500 -- [-1616.090] (-1613.244) (-1615.957) (-1613.850) * (-1613.835) (-1613.218) [-1614.178] (-1614.507) -- 0:00:35
      451000 -- (-1613.517) [-1611.434] (-1614.352) (-1611.725) * (-1613.488) [-1612.916] (-1612.590) (-1614.521) -- 0:00:35
      451500 -- (-1615.947) [-1611.300] (-1613.881) (-1612.100) * (-1614.576) (-1611.600) (-1614.623) [-1612.237] -- 0:00:36
      452000 -- (-1613.475) (-1611.038) [-1615.028] (-1614.094) * [-1613.575] (-1612.039) (-1614.636) (-1612.234) -- 0:00:36
      452500 -- (-1612.319) (-1612.278) (-1613.624) [-1613.877] * (-1614.725) (-1611.509) (-1611.982) [-1612.951] -- 0:00:36
      453000 -- (-1612.791) (-1613.326) (-1611.652) [-1612.001] * [-1613.005] (-1616.400) (-1613.036) (-1613.546) -- 0:00:36
      453500 -- (-1616.482) (-1615.410) (-1611.264) [-1612.167] * (-1615.857) (-1613.006) (-1611.717) [-1613.638] -- 0:00:36
      454000 -- (-1612.392) (-1611.243) [-1612.775] (-1615.921) * (-1612.578) (-1612.067) [-1611.950] (-1616.927) -- 0:00:36
      454500 -- (-1614.696) (-1611.566) [-1611.107] (-1611.633) * (-1617.093) [-1611.889] (-1612.151) (-1612.185) -- 0:00:36
      455000 -- (-1616.953) [-1611.713] (-1614.305) (-1612.858) * (-1614.975) [-1615.296] (-1613.457) (-1612.282) -- 0:00:35

      Average standard deviation of split frequencies: 0.011372

      455500 -- (-1616.466) (-1612.498) [-1612.584] (-1618.432) * (-1613.972) [-1612.237] (-1611.149) (-1611.967) -- 0:00:35
      456000 -- (-1613.066) [-1614.244] (-1612.591) (-1613.136) * (-1614.029) (-1613.191) [-1611.305] (-1612.446) -- 0:00:35
      456500 -- (-1614.345) [-1613.395] (-1611.657) (-1613.245) * (-1613.995) [-1614.638] (-1613.956) (-1614.178) -- 0:00:35
      457000 -- (-1615.705) (-1611.708) [-1611.515] (-1613.385) * (-1613.300) (-1615.930) [-1612.340] (-1612.205) -- 0:00:35
      457500 -- (-1613.821) [-1614.148] (-1612.497) (-1618.589) * [-1612.357] (-1619.850) (-1615.922) (-1612.707) -- 0:00:35
      458000 -- [-1614.694] (-1612.566) (-1613.173) (-1615.551) * (-1612.668) [-1611.970] (-1615.901) (-1613.579) -- 0:00:35
      458500 -- (-1614.915) [-1611.949] (-1611.806) (-1615.107) * (-1611.478) (-1612.734) (-1615.133) [-1615.660] -- 0:00:35
      459000 -- (-1611.800) [-1612.839] (-1613.072) (-1614.658) * [-1613.829] (-1612.607) (-1611.642) (-1614.140) -- 0:00:35
      459500 -- [-1611.070] (-1612.708) (-1615.990) (-1613.265) * [-1611.614] (-1615.132) (-1618.606) (-1612.475) -- 0:00:35
      460000 -- [-1614.518] (-1611.277) (-1613.888) (-1612.421) * (-1611.615) (-1613.946) [-1611.481] (-1611.228) -- 0:00:35

      Average standard deviation of split frequencies: 0.012280

      460500 -- (-1613.849) (-1612.538) [-1614.107] (-1613.580) * (-1611.988) (-1613.711) [-1611.247] (-1616.643) -- 0:00:35
      461000 -- [-