--- EXPERIMENT NOTES

### Obtaining branch lengths and nucleotide substitution biases under the nucleotide GTR model
* Log(L) = -7602.01, AIC-c = 15274.18 (35 estimated parameters)
* Tree length (expected substitutions/site) for partition 1 :    1.895

### Computing the phylogenetic likelihood function on the grid 
* Determining appropriate tree scaling based on the best score from a  20 x 20 rate grid
* Best scaling achieved for 
	* synonymous rate =  2.815
	* non-synonymous rate =  0.643
* Computing conditional site likelihoods on a 20 x 20 rate grid

### Running an iterative zeroth order variational Bayes procedure to estimate the posterior mean of rate weights
* Using the following settings
	* Dirichlet alpha  : 0.5

### Tabulating site-level results
|     Codon      |   Partition    |     alpha      |      beta      |Posterior prob for positive selection|
|:--------------:|:--------------:|:--------------:|:--------------:|:-----------------------------------:|
|       22       |       1        |        0.486   |        2.120   |       Pos. posterior = 0.9296       |
|      105       |       1        |        0.518   |        2.354   |       Pos. posterior = 0.9680       |
|      143       |       1        |        0.720   |        4.868   |       Pos. posterior = 0.9414       |
|      318       |       1        |        0.568   |        2.653   |       Pos. posterior = 0.9427       |
----
## FUBAR inferred 4 sites subject to diversifying positive selection at posterior probability >= 0.9
Of these,  0.22 are expected to be false positives (95% confidence interval of 0-1 )




 --- EXPERIMENT PROPERTIES

#Wed Jul 03 22:22:08 GMT 2019
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -7315.92         -7338.45
2      -7317.27         -7334.79
--------------------------------------
TOTAL    -7316.39         -7337.78
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         3.189964    0.030597    2.858872    3.541335    3.185306   1114.09   1220.56    1.000
r(A<->C){all}   0.098028    0.000128    0.076557    0.120735    0.097393    926.98   1010.15    1.000
r(A<->G){all}   0.286894    0.000468    0.246291    0.329841    0.286110    571.35    783.87    1.001
r(A<->T){all}   0.054843    0.000055    0.040311    0.068799    0.054529    979.31   1016.49    1.000
r(C<->G){all}   0.087184    0.000152    0.062038    0.110449    0.086801    685.04    768.41    1.000
r(C<->T){all}   0.439049    0.000603    0.392908    0.486050    0.439092    663.92    764.90    1.001
r(G<->T){all}   0.034001    0.000050    0.020436    0.047543    0.033509   1110.04   1112.31    1.000
pi(A){all}      0.320177    0.000147    0.295922    0.343539    0.320033    893.97    903.62    1.000
pi(C){all}      0.182748    0.000084    0.164900    0.200390    0.182638    933.26    971.83    1.000
pi(G){all}      0.229759    0.000115    0.208603    0.250253    0.229774    855.28    953.65    1.000
pi(T){all}      0.267315    0.000133    0.244194    0.288999    0.267294    843.35    857.07    1.000
alpha{1,2}      0.417177    0.001986    0.335366    0.503819    0.413611   1110.98   1150.29    1.000
alpha{3}        3.626105    0.724943    2.192849    5.355623    3.506532   1331.59   1416.30    1.000
pinvar{all}     0.052611    0.000825    0.000033    0.102945    0.051332   1128.33   1208.83    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-6413.554444
Model 2: PositiveSelection	-6413.554444
Model 0: one-ratio	-6563.430284
Model 3: discrete	-6386.390474
Model 7: beta	-6389.565486
Model 8: beta&w>1	-6385.172336


Model 0 vs 1	299.7516799999994

Model 2 vs 1	0.0

Model 8 vs 7	8.786300000001575

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Acromyrmex echinatior (Panamanian leafcutter ant) Formicidae XP 011068254.1)

            Pr(w>1)     post mean +- SE for w

    54 S      0.737         1.229
    67 S      0.880         1.337
    71 K      0.609         1.128
    72 P      0.545         1.075
    73 V      0.803         1.279
   109 Q      0.922         1.368
   110 I      0.769         1.255
   114 L      0.526         1.054
   184 L      0.519         1.017
   211 C      0.796         1.275
   221 R      0.973*        1.405
   250 F      0.766         1.252
   262 Y      0.505         1.043
   283 T      0.756         1.244

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: Acromyrmex echinatior (Panamanian leafcutter ant) Formicidae XP 011068254.1)

            Pr(w>1)     post mean +- SE for w

    54 S      0.626         1.235 +- 0.385
    67 S      0.803         1.378 +- 0.317
    73 V      0.707         1.301 +- 0.363
   109 Q      0.860         1.422 +- 0.280
   110 I      0.660         1.266 +- 0.373
   211 C      0.694         1.292 +- 0.364
   221 R      0.945         1.483 +- 0.209
   250 F      0.653         1.259 +- 0.373
   283 T      0.641         1.249 +- 0.376

>C1
MTTQASKNVKVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDPAT
GVVTSAYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGESNKSKVPV
KVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGQIAPNLGTLYRVD
DDLEPKKKISPVTISNGLAWNIEDDTLYYIDSTPRQVAAYDYNPNNGTIS
NKRIVFDLNKTNLKGLPDGMTIDTDGNLWIALFGGSRVICVDPKTEKVLR
EVEIPTENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGAIFAVTG
LEVHGLLANSFTIMDooooooooo
>C2
MTTQARKNVKVEKVTDTYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDPAT
GVVTSTYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGDSNKSKVSV
KVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGETAPNLGTLYRVD
DDLEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQIAAYDYNPNNGTIS
NKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSQVICVDPKTEKVLY
KVELPAENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGAVFAVKG
LEVRGVLANSFMMIDooooooooo
>C3
MTTQARKNVKVEKVTDTYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDPAT
GVVTSSYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGDSNKSKVPV
KVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGEIAPNLGTLYRVD
DDLEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQIAAYDYNPNNGTIS
NKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSQVICVDPKTEKVLY
KVELPAENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGAVFAVKG
LEVRGVLANSFMMIDooooooooo
>C4
MTTEAHHHLKPKIKIERVTDAYGLSEGPHWDSDAQKLYFVDIYNQYVRRL
DPATGVVTSTYIDHGPVSVVIPVHDSPNKFVVGSGKDVILVNWNSDANQK
VTPYNVLSNLTSGDVRTNDGKADSAGRLWIGTMANEINGQIALDKGSLYR
LDDTLKPKTEITPVSISNGLAWNIEDNTFYYIDSSTREIAAYDFDPNSGT
ISNKRIALNLNHTKLEGLPDGMTIDTDGNLWVALFGGHGLIKVDPHKHKV
LEKIELPARDVSSVAFGGPLLDILYVTTSGHGLTAEERKKTPYAGSVFAI
HNLGVHGILANTFFVNKETNHooo
>C5
MTTQACKNVKVEKVTDTYGLSEGPHWDHHTQKLYFVDIYNQYIRRLDPAT
GVVTSAYIDHGTVGVVVPVDDTVDKLIAGSERDVILITWDGDSNKSKVPV
EVLCSLDSPQSETRINDGKVDSAGRFWLGTMANEVNGVVAPNQGTLYRVD
NDFKPNKEISPVSISNGLAWNIEDNIMYYIDSVTRQVAAYDYNPNNGTIS
NKRIVFDLNKTDLKGLPDGMTIDANGNLWIALFGGSRVIHVDPKTGKVLC
KVELPVENVTSVTFGGPLLDTLYVTTSGYNITVEQRKASPHAGALFAVTG
LGVHGVLANSFMMVNooooooooo
>C6
MNITIYSSIFYIGKLLANHILDPATNAVTSAYIKSGTVGVVVPVDDSTDQ
FAAGVGRDLILVTWDDEQNETNVPTEVLCSVDVGNTQTRINDGKVDSSGR
FWLGTMGENGKGNSIPNIGSFYRIDDDLKPKKEISPVSISNGLAWNIEDD
TFYYIDSPERNVVAYDYNPINGTISNKRIVFNLNNTNLTGVPDGMTIDTD
DNLWIALFGGSHVIKVNPRTGELLCQIKIPAENVTSVTFGGPLLDILYVT
TSGKDLTAEQRKATPHAGAVFAVKGLGVRGSIANMFRMKooooooooooo
oooooooooooooooooooooooo
>C7
MTTEAHVTVKEVTEPYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDTATGV
VTSAYVEHGPVGVVVPAEDTSDKLVAGSGKDLVLVTWDGDEDKEKVPVKV
LSSIEPSSSDTRINDGKVDSSGRFWIGTMANEVNGEIASDKGSLYRIDDT
LKPVKEVTPVSISNGLAWNIEDNTFYYIDSPTRQIAAYDYDPNNGTISNK
RIVFDLSKTNVKGVPDGMTIDTNGNLWVAVYGGHHVLHVNPKTQQLLKKV
KIPAGGVTSVAFGGPLLDILYVTTSGYGLTAKEQKETPHAGSVFAVKGLG
VRGILANSFMMNGLKQTDEEKTDV
>C8
MATQADVTVEKVTDSYGLSEGPHWNHRTQKLYFVDIYNQYIRRLDTATGV
VTSAYIEHGPVGVVVPVDDTTDAFVAGSGRDLILVTWDSDRDDSNATTEV
LCPVDTTHTQTRINDGKVDSFGRFWLGTMANEVNGQILPNQGSLYCIDDE
LKPKVEVSPVSISNGLGWNIEDDTFYYIDSPTRQIAAYNYDPNEGTISNR
RIVFDLNKTDLQGVPDGMTIDTDGNLWIALYGGKHVIHVNPKTGKMLGKV
ELPADNVTSVTFGGPLLDILYATTSSNGLTAEQREATPQAGAVFAIKGLG
VRGILANSFVMNGLKQTMNNoooo
>C9
MMATQENVEVERVTDVYGLSEGPHWDHRTQKLYFVDVYNQYIRRLDPATG
VVTSARINEGTVGVVIPVEDTIDQLIAGVGKDVVLVTWDGDEDESEVPVK
VLCSLDSEQAQTRTNDGKVDSSGRLWIGTMGIETKGMVLPNQGTLYRVDD
DLKPEKEESPVSISNGLAWNMEDNTFYYIDSPTRQVAAYDYQPYNGMICN
KRIVFDLNTTNFQGVPDGMTIDADGNLWIALFGGHHVIQVDPKTGKVLSK
VKLPAENVSSVTFGGSLLDILYVTTSGHNLSSEQRKATPYAGAVFAVKGL
GVRGILANSFVMDooooooooooo
>C10
MTTNVQVKRVTEPYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDVATGVVT
STYINHGPVSVVVPVDDSTDEFVAGSGRDVILVTWNGTENLSNTKPKVLT
TVDLTHTNTRTNDGKADSSGRLWIGTMGDEIDGQPSPPNLGLLSRIDDEM
KHVVEISPVSISNGLAWNIQDDTFYYIDSPTRVIAAYDYDPINGKISNRR
VVFDLNDTDLSGVPDGMTIDTDGNLWIALFGGHHIINVNPKTKQLLRKIK
LPAENVTSAAFGGPLLDILYVTTSGHGLTAEQRKETPYAGSVFAIEGLGV
HGLIANSFKISDLKQKoooooooo
>C11
MATQECERGKVRIEKVTNAYGLSEGPHWDHRTQKLYFVDINNQYIRRLDP
ATGVVTSVYIDHGPVGVVVPVDDTTDQLVAGSGKDIILVTWDGDSDDSQV
PIKVLCSVDFAQAQTRINDGKVDSAGRFWLGTMGQEVNGVAASNQGTLYR
VNEDLHPEKEISPVSISNGLAWNIEDDTFYYIDSPTRQVAAYDYNPNNGT
ICNRRIVFDLNNTDLQGVPDGMTIDADGNLWIALFGGHHVIHVDPKTGQV
LRKVKIPAENVTSVAFGGPLLDILYVTTSGFNLTAEQRKATPHAGAVFAV
KGLKVRGILANSFVMMDooooooo
>C12
MQARENVKVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDPATGV
VTSAYIDHGTIGVAVPLDDSVDQLIAGSGKDVIRVTWDGDSNKSKVPVKV
LCSVDSPQAQTRINDGKVDSAGRFWLGTMGNEVNGKIAPNLGTLYRVDDD
FEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQVAAYDYNPTNGTISNK
RIVFDLNKTNLKGLPDGMTIDTDGNLWIALFGGSRVICVDPKTGNVLSKV
ELPAENVTSVAFGGPLLDTLYVTTSGYNISAEQRQATPHAGAIFAVTGLE
VRGVLANSFIMIDooooooooooo
>C13
MTTQASKNIKVEKVTDIYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDPAT
GVVTSAYIDHGTVGVVVPVDDSVDQLIAGSGKDIILVTWDGDSNKSKVPV
KVLCSVDSPQAQTRINDGKVDSAGRFWLGTMGNEVNGKIAPNLGTLYHVD
DALEPKKEISPVSISNGLAWNIEDNTFYYIDSPTYQVAAYDYNPNNGTIS
NKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSRVICVDPKTEKVLC
KVDIPAENVTSVTFGGPLLDTLYVTTSGFNISAEQRQATPHAGAIFAVTG
LEVRGLLANSFMMINooooooooo
>C14
MTTQVTVDKVTAAYGLSEGPHWDHRTQKLFFVDIQNQYIRRLDIATGVVT
SAYIANGTVGVVIPVDDSNDELVAGVGKDLVLVKWNGDEDDSEPKVKMLC
SLEPPQAETRINDGKVDSTGRFWLGTMGIEVNGVAPPDLGSLYRVDDNLK
PEKEISPVTISNGLAWNSKDDTFYYIDSPTRQVAAYDYDPNLGKISNRRI
VFDLNNTDLKGVPDGMTIDTDGNLWIALFGGSHVIQVDPKTGAVMRKVKI
PADNVTSVTFGGPLLDTLYVTTSGYNLTAEQRELTPDAGAVFAVKGLKTR
GTLANSFVKMDooooooooooooo
>C15
MTTEACKSDRVEVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRRLDP
ATGDVKSVHIDHGPIGVVIPVDDTTDQFVAGAGKDVVLVTWDADEDELGN
VTVLCSLDSAQSDTRVNDGKVDSYGRFWLGTMGNEVNGVIAPNLGTLYRV
DDKLKPMKEISPVSISNGLAWNIEDNTFYYIDSPTRQVAAYDYDPNSGTI
SNKRIVFNLNTTDVKGVPDGMTIDADGNLWIAVFGGHHVIHVDPRTGKML
RKVKIPAENVTSAMFGGPLLDTLYVTTSGHNLTAKQRNATPHAGSVFAVK
NLGVRGILSNSFVRMDoooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=15, Len=355 

C1              -MTTQASK----NVKVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C2              -MTTQARK----NVKVEKVTDTYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C3              -MTTQARK----NVKVEKVTDTYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C4              -MTTEAHHHLKPKIKIERVTDAYGLSEGPHWDSDAQKLYFVDIYNQYVRR
C5              -MTTQACK----NVKVEKVTDTYGLSEGPHWDHHTQKLYFVDIYNQYIRR
C6              -M----------NITI-----------------YSSIFYIGKLLANHI--
C7              -MTTEA------HVTVKEVTEPYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C8              -MATQA------DVTVEKVTDSYGLSEGPHWNHRTQKLYFVDIYNQYIRR
C9              MMATQE------NVEVERVTDVYGLSEGPHWDHRTQKLYFVDVYNQYIRR
C10             -MTT--------NVQVKRVTEPYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C11             -MATQECE--RGKVRIEKVTNAYGLSEGPHWDHRTQKLYFVDINNQYIRR
C12             ---MQARE----NVKVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C13             -MTTQASK----NIKVEKVTDIYGLSEGPHWDHRTQKLYFVDIYNQYIRR
C14             -MTT--------QVTVDKVTAAYGLSEGPHWDHRTQKLFFVDIQNQYIRR
C15             -MTTEACK--SDRVEVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRR
                             : :                  :. ::: .:  :::  

C1              LDPATGVVTSAYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGESNK
C2              LDPATGVVTSTYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGDSNK
C3              LDPATGVVTSSYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGDSNK
C4              LDPATGVVTSTYIDHGPVSVVIPVHDSPNKFVVGSGKDVILVNWNSDANQ
C5              LDPATGVVTSAYIDHGTVGVVVPVDDTVDKLIAGSERDVILITWDGDSNK
C6              LDPATNAVTSAYIKSGTVGVVVPVDDSTDQFAAGVGRDLILVTWDDEQNE
C7              LDTATGVVTSAYVEHGPVGVVVPAEDTSDKLVAGSGKDLVLVTWDGDEDK
C8              LDTATGVVTSAYIEHGPVGVVVPVDDTTDAFVAGSGRDLILVTWDSDRDD
C9              LDPATGVVTSARINEGTVGVVIPVEDTIDQLIAGVGKDVVLVTWDGDEDE
C10             LDVATGVVTSTYINHGPVSVVVPVDDSTDEFVAGSGRDVILVTWNGTENL
C11             LDPATGVVTSVYIDHGPVGVVVPVDDTTDQLVAGSGKDIILVTWDGDSDD
C12             LDPATGVVTSAYIDHGTIGVAVPLDDSVDQLIAGSGKDVIRVTWDGDSNK
C13             LDPATGVVTSAYIDHGTVGVVVPVDDSVDQLIAGSGKDIILVTWDGDSNK
C14             LDIATGVVTSAYIANGTVGVVIPVDDSNDELVAGVGKDLVLVKWNGDEDD
C15             LDPATGDVKSVHIDHGPIGVVIPVDDTTDQFVAGAGKDVVLVTWDADEDE
                ** **. *.*  :  *.:.*.:* .*: : : .*  :*:: :.*:   : 

C1              SKVPVKVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGQIA-PNLG
C2              SKVSVKVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGETA-PNLG
C3              SKVPVKVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGEIA-PNLG
C4              KVTPYNVLSNLTS--GDVRTNDGKADSAGRLWIGTMANEINGQIA-LDKG
C5              SKVPVEVLCSLDSPQSETRINDGKVDSAGRFWLGTMANEVNGVVA-PNQG
C6              TNVPTEVLCSVDVGNTQTRINDGKVDSSGRFWLGTMGENGKGNSI-PNIG
C7              EKVPVKVLSSIEPSSSDTRINDGKVDSSGRFWIGTMANEVNGEIA-SDKG
C8              SNATTEVLCPVDTTHTQTRINDGKVDSFGRFWLGTMANEVNGQIL-PNQG
C9              SEVPVKVLCSLDSEQAQTRTNDGKVDSSGRLWIGTMGIETKGMVL-PNQG
C10             SNTKPKVLTTVDLTHTNTRTNDGKADSSGRLWIGTMGDEIDGQPSPPNLG
C11             SQVPIKVLCSVDFAQAQTRINDGKVDSAGRFWLGTMGQEVNGVAA-SNQG
C12             SKVPVKVLCSVDSPQAQTRINDGKVDSAGRFWLGTMGNEVNGKIA-PNLG
C13             SKVPVKVLCSVDSPQAQTRINDGKVDSAGRFWLGTMGNEVNGKIA-PNLG
C14             SEPKVKMLCSLEPPQAETRINDGKVDSTGRFWLGTMGIEVNGVAP-PDLG
C15             LG-NVTVLCSLDSAQSDTRVNDGKVDSYGRFWLGTMGNEVNGVIA-PNLG
                      :*  :     :.* ****.** **:*:***. : .*     : *

C1              TLYRVDDDLEPKKKISPVTISNGLAWNIEDDTLYYIDSTPRQVAAYDYNP
C2              TLYRVDDDLEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQIAAYDYNP
C3              TLYRVDDDLEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQIAAYDYNP
C4              SLYRLDDTLKPKTEITPVSISNGLAWNIEDNTFYYIDSSTREIAAYDFDP
C5              TLYRVDNDFKPNKEISPVSISNGLAWNIEDNIMYYIDSVTRQVAAYDYNP
C6              SFYRIDDDLKPKKEISPVSISNGLAWNIEDDTFYYIDSPERNVVAYDYNP
C7              SLYRIDDTLKPVKEVTPVSISNGLAWNIEDNTFYYIDSPTRQIAAYDYDP
C8              SLYCIDDELKPKVEVSPVSISNGLGWNIEDDTFYYIDSPTRQIAAYNYDP
C9              TLYRVDDDLKPEKEESPVSISNGLAWNMEDNTFYYIDSPTRQVAAYDYQP
C10             LLSRIDDEMKHVVEISPVSISNGLAWNIQDDTFYYIDSPTRVIAAYDYDP
C11             TLYRVNEDLHPEKEISPVSISNGLAWNIEDDTFYYIDSPTRQVAAYDYNP
C12             TLYRVDDDFEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQVAAYDYNP
C13             TLYHVDDALEPKKEISPVSISNGLAWNIEDNTFYYIDSPTYQVAAYDYNP
C14             SLYRVDDNLKPEKEISPVTISNGLAWNSKDDTFYYIDSPTRQVAAYDYDP
C15             TLYRVDDKLKPMKEISPVSISNGLAWNIEDNTFYYIDSPTRQVAAYDYDP
                 :  ::: :.   : :**:*****.** :*: :*****    :.**:::*

C1              NNGTISNKRIVFDLNKTNLKGLPDGMTIDTDGNLWIALFGGSRVICVDPK
C2              NNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSQVICVDPK
C3              NNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSQVICVDPK
C4              NSGTISNKRIALNLNHTKLEGLPDGMTIDTDGNLWVALFGGHGLIKVDPH
C5              NNGTISNKRIVFDLNKTDLKGLPDGMTIDANGNLWIALFGGSRVIHVDPK
C6              INGTISNKRIVFNLNNTNLTGVPDGMTIDTDDNLWIALFGGSHVIKVNPR
C7              NNGTISNKRIVFDLSKTNVKGVPDGMTIDTNGNLWVAVYGGHHVLHVNPK
C8              NEGTISNRRIVFDLNKTDLQGVPDGMTIDTDGNLWIALYGGKHVIHVNPK
C9              YNGMICNKRIVFDLNTTNFQGVPDGMTIDADGNLWIALFGGHHVIQVDPK
C10             INGKISNRRVVFDLNDTDLSGVPDGMTIDTDGNLWIALFGGHHIINVNPK
C11             NNGTICNRRIVFDLNNTDLQGVPDGMTIDADGNLWIALFGGHHVIHVDPK
C12             TNGTISNKRIVFDLNKTNLKGLPDGMTIDTDGNLWIALFGGSRVICVDPK
C13             NNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSRVICVDPK
C14             NLGKISNRRIVFDLNNTDLKGVPDGMTIDTDGNLWIALFGGSHVIQVDPK
C15             NSGTISNKRIVFNLNTTDVKGVPDGMTIDADGNLWIAVFGGHHVIHVDPR
                  * *.*:*:.::*. *.. *:*******::.***:*::**  :: *:*:

C1              TEKVLREVEIPTENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGA
C2              TEKVLYKVELPAENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGA
C3              TEKVLYKVELPAENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGA
C4              KHKVLEKIELPARDVSSVAFGGPLLDILYVTTSGHGLTAEERKKTPYAGS
C5              TGKVLCKVELPVENVTSVTFGGPLLDTLYVTTSGYNITVEQRKASPHAGA
C6              TGELLCQIKIPAENVTSVTFGGPLLDILYVTTSGKDLTAEQRKATPHAGA
C7              TQQLLKKVKIPAGGVTSVAFGGPLLDILYVTTSGYGLTAKEQKETPHAGS
C8              TGKMLGKVELPADNVTSVTFGGPLLDILYATTSSNGLTAEQREATPQAGA
C9              TGKVLSKVKLPAENVSSVTFGGSLLDILYVTTSGHNLSSEQRKATPYAGA
C10             TKQLLRKIKLPAENVTSAAFGGPLLDILYVTTSGHGLTAEQRKETPYAGS
C11             TGQVLRKVKIPAENVTSVAFGGPLLDILYVTTSGFNLTAEQRKATPHAGA
C12             TGNVLSKVELPAENVTSVAFGGPLLDTLYVTTSGYNISAEQRQATPHAGA
C13             TEKVLCKVDIPAENVTSVTFGGPLLDTLYVTTSGFNISAEQRQATPHAGA
C14             TGAVMRKVKIPADNVTSVTFGGPLLDTLYVTTSGYNLTAEQRELTPDAGA
C15             TGKMLRKVKIPAENVTSAMFGGPLLDTLYVTTSGHNLTAKQRNATPHAGS
                .  :: ::.:*. .*:*. ***.*** **.***. .:: :::: :* **:

C1              IFAVTGLEVHGLLANSFTIMDooooooooo--------------------
C2              VFAVKGLEVRGVLANSFMMIDooooooooo--------------------
C3              VFAVKGLEVRGVLANSFMMIDooooooooo--------------------
C4              VFAIHNLGVHGILANTFFVNKETNHooo----------------------
C5              LFAVTGLGVHGVLANSFMMVNooooooooo--------------------
C6              VFAVKGLGVRGSIANMFRMKoooooooooooooooooooooooooooooo
C7              VFAVKGLGVRGILANSFMMNGLKQTDEEKTDV------------------
C8              VFAIKGLGVRGILANSFVMNGLKQTMNNoooo------------------
C9              VFAVKGLGVRGILANSFVM-Dooooooooooo------------------
C10             VFAIEGLGVHGLIANSFKISDLKQKoooooooo-----------------
C11             VFAVKGLKVRGILANSFVMMDooooooo----------------------
C12             IFAVTGLEVRGVLANSFIMIDooooooooooo------------------
C13             IFAVTGLEVRGLLANSFMMINooooooooo--------------------
C14             VFAVKGLKTRGTLANSFVKMDooooooooooooo----------------
C15             VFAVKNLGVRGILSNSFVRMDoooooooo---------------------
                :**: .* .:* ::* *                                 

C1              -----
C2              -----
C3              -----
C4              -----
C5              -----
C6              ooooo
C7              -----
C8              -----
C9              -----
C10             -----
C11             -----
C12             -----
C13             -----
C14             -----
C15             -----
                     




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
		[Relax Library][TOT=    1][100 %][ELAPSED TIME:    0 sec.]
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 15 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C10 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C11 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C12 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C13 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C14 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C15 Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C7  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C8  Length  324 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C9  Length  324 type PROTEIN Struct Unchecked

	Multi Core Mode: 12 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [91502]

Library Relaxation: Multi_proc [12]
 
Relaxation Summary: [91502]--->[80627]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 30.035 Mb, Max= 33.121 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              NVKVRTQKLYFVDIYNQYILDPATGVVTSAYIDHGTVGVAVPVDDSVDQL
C2              NVKVRTQKLYFVDIYNQYILDPATGVVTSTYIDHGTVGVAVPVDDSVDQL
C3              NVKVRTQKLYFVDIYNQYILDPATGVVTSSYIDHGTVGVAVPVDDSVDQL
C4              KIKIDAQKLYFVDIYNQYVLDPATGVVTSTYIDHGPVSVVIPVHDSPNKF
C5              NVKVHTQKLYFVDIYNQYILDPATGVVTSAYIDHGTVGVVVPVDDTVDKL
C6              NITIYSSIFYIGKLLANHILDPATNAVTSAYIKSGTVGVVVPVDDSTDQF
C7              HVTVRTQKLYFVDIYNQYILDTATGVVTSAYVEHGPVGVVVPAEDTSDKL
C8              DVTVRTQKLYFVDIYNQYILDTATGVVTSAYIEHGPVGVVVPVDDTTDAF
C9              NVEVRTQKLYFVDVYNQYILDPATGVVTSARINEGTVGVVIPVEDTIDQL
C10             NVQVRTQKLYFVDIYNQYILDVATGVVTSTYINHGPVSVVVPVDDSTDEF
C11             KVRIRTQKLYFVDINNQYILDPATGVVTSVYIDHGPVGVVVPVDDTTDQL
C12             NVKVRTQKLYFVDIYNQYILDPATGVVTSAYIDHGTIGVAVPLDDSVDQL
C13             NIKVRTQKLYFVDIYNQYILDPATGVVTSAYIDHGTVGVVVPVDDSVDQL
C14             QVTVRTQKLFFVDIQNQYILDIATGVVTSAYIANGTVGVVIPVDDSNDEL
C15             RVEVRTQKLYFVDIYNQYILDPATGDVKSVHIDHGPIGVVIPVDDTTDQF
                 : : :. ::: .:  :::** **. *.*  :  *.:.*.:* .*: : :

C1              IVGSGKDVILVTWDGESNKSKPVKVLCSVDSAQTRINDGKVDSAGRFWLG
C2              IVGSGKDVILVTWDGDSNKSKSVKVLCSVDSAQTRINDGKVDSAGRFWLG
C3              IVGSGKDVILVTWDGDSNKSKPVKVLCSVDSAQTRINDGKVDSAGRFWLG
C4              VVGSGKDVILVNWNSDANQKVPYNVLSNLTSGDVRTNDGKADSAGRLWIG
C5              IAGSERDVILITWDGDSNKSKPVEVLCSLDSSETRINDGKVDSAGRFWLG
C6              AAGVGRDLILVTWDDEQNETNPTEVLCSVDVTQTRINDGKVDSSGRFWLG
C7              VAGSGKDLVLVTWDGDEDKEKPVKVLSSIEPSDTRINDGKVDSSGRFWIG
C8              VAGSGRDLILVTWDSDRDDSNTTEVLCPVDTTQTRINDGKVDSFGRFWLG
C9              IAGVGKDVVLVTWDGDEDESEPVKVLCSLDSAQTRTNDGKVDSSGRLWIG
C10             VAGSGRDVILVTWNGTENLSNKPKVLTTVDLTNTRTNDGKADSSGRLWIG
C11             VAGSGKDIILVTWDGDSDDSQPIKVLCSVDFAQTRINDGKVDSAGRFWLG
C12             IAGSGKDVIRVTWDGDSNKSKPVKVLCSVDSAQTRINDGKVDSAGRFWLG
C13             IAGSGKDIILVTWDGDSNKSKPVKVLCSVDSAQTRINDGKVDSAGRFWLG
C14             VAGVGKDLVLVKWNGDEDDSEKVKMLCSLEPAETRINDGKVDSTGRFWLG
C15             VAGAGKDVVLVTWDADEDELGNVTVLCSLDSSDTRVNDGKVDSYGRFWLG
                 .*  :*:: :.*:   :      :*  :   :.* ****.** **:*:*

C1              TMGNEVNGQIAPNLGTLYRVDDDLEPKKKISPVTISNGLAWNIEDDTLYY
C2              TMGNEVNGETAPNLGTLYRVDDDLEPKKEISPVTISNGLAWNIEDDTLYY
C3              TMGNEVNGEIAPNLGTLYRVDDDLEPKKEISPVTISNGLAWNIEDDTLYY
C4              TMANEINGQIALDKGSLYRLDDTLKPKTEITPVSISNGLAWNIEDNTFYY
C5              TMANEVNGVVAPNQGTLYRVDNDFKPNKEISPVSISNGLAWNIEDNIMYY
C6              TMGENGKGNSIPNIGSFYRIDDDLKPKKEISPVSISNGLAWNIEDDTFYY
C7              TMANEVNGEIASDKGSLYRIDDTLKPVKEVTPVSISNGLAWNIEDNTFYY
C8              TMANEVNGQILPNQGSLYCIDDELKPKVEVSPVSISNGLGWNIEDDTFYY
C9              TMGIETKGMVLPNQGTLYRVDDDLKPEKEESPVSISNGLAWNMEDNTFYY
C10             TMGDEIDGQPSPNLGLLSRIDDEMKHVVEISPVSISNGLAWNIQDDTFYY
C11             TMGQEVNGVAASNQGTLYRVNEDLHPEKEISPVSISNGLAWNIEDDTFYY
C12             TMGNEVNGKIAPNLGTLYRVDDDFEPKKEISPVTISNGLAWNIEDDTLYY
C13             TMGNEVNGKIAPNLGTLYHVDDALEPKKEISPVSISNGLAWNIEDNTFYY
C14             TMGIEVNGVAPPDLGSLYRVDDNLKPEKEISPVTISNGLAWNSKDDTFYY
C15             TMGNEVNGVIAPNLGTLYRVDDKLKPMKEISPVSISNGLAWNIEDNTFYY
                **. : .*    : * :  ::: :.   : :**:*****.** :*: :**

C1              IDSTPRQVAAYDYNPNNGTISNKRIVFDLNKTNLKGLPDGMTIDTDGNLW
C2              IDSPTRQIAAYDYNPNNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLW
C3              IDSPTRQIAAYDYNPNNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLW
C4              IDSSTREIAAYDFDPNSGTISNKRIALNLNHTKLEGLPDGMTIDTDGNLW
C5              IDSVTRQVAAYDYNPNNGTISNKRIVFDLNKTDLKGLPDGMTIDANGNLW
C6              IDSPERNVVAYDYNPINGTISNKRIVFNLNNTNLTGVPDGMTIDTDDNLW
C7              IDSPTRQIAAYDYDPNNGTISNKRIVFDLSKTNVKGVPDGMTIDTNGNLW
C8              IDSPTRQIAAYNYDPNEGTISNRRIVFDLNKTDLQGVPDGMTIDTDGNLW
C9              IDSPTRQVAAYDYQPYNGMICNKRIVFDLNTTNFQGVPDGMTIDADGNLW
C10             IDSPTRVIAAYDYDPINGKISNRRVVFDLNDTDLSGVPDGMTIDTDGNLW
C11             IDSPTRQVAAYDYNPNNGTICNRRIVFDLNNTDLQGVPDGMTIDADGNLW
C12             IDSPTRQVAAYDYNPTNGTISNKRIVFDLNKTNLKGLPDGMTIDTDGNLW
C13             IDSPTYQVAAYDYNPNNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLW
C14             IDSPTRQVAAYDYDPNLGKISNRRIVFDLNNTDLKGVPDGMTIDTDGNLW
C15             IDSPTRQVAAYDYDPNSGTISNKRIVFNLNTTDVKGVPDGMTIDADGNLW
                ***    :.**:::*  * *.*:*:.::*. *.. *:*******::.***

C1              IALFGGSRVICVDPKTEKVLREVEIPTENVTSVAFGGPLLDTLYVTTSGF
C2              IALFGGSQVICVDPKTEKVLYKVELPAENVTSVAFGGPLLDTLYVTTSGF
C3              IALFGGSQVICVDPKTEKVLYKVELPAENVTSVAFGGPLLDTLYVTTSGF
C4              VALFGGHGLIKVDPHKHKVLEKIELPARDVSSVAFGGPLLDILYVTTSGH
C5              IALFGGSRVIHVDPKTGKVLCKVELPVENVTSVTFGGPLLDTLYVTTSGY
C6              IALFGGSHVIKVNPRTGELLCQIKIPAENVTSVTFGGPLLDILYVTTSGK
C7              VAVYGGHHVLHVNPKTQQLLKKVKIPAGGVTSVAFGGPLLDILYVTTSGY
C8              IALYGGKHVIHVNPKTGKMLGKVELPADNVTSVTFGGPLLDILYATTSSN
C9              IALFGGHHVIQVDPKTGKVLSKVKLPAENVSSVTFGGSLLDILYVTTSGH
C10             IALFGGHHIINVNPKTKQLLRKIKLPAENVTSAAFGGPLLDILYVTTSGH
C11             IALFGGHHVIHVDPKTGQVLRKVKIPAENVTSVAFGGPLLDILYVTTSGF
C12             IALFGGSRVICVDPKTGNVLSKVELPAENVTSVAFGGPLLDTLYVTTSGY
C13             IALFGGSRVICVDPKTEKVLCKVDIPAENVTSVTFGGPLLDTLYVTTSGF
C14             IALFGGSHVIQVDPKTGAVMRKVKIPADNVTSVTFGGPLLDTLYVTTSGY
C15             IAVFGGHHVIHVDPRTGKMLRKVKIPAENVTSAMFGGPLLDTLYVTTSGH
                :*::**  :: *:*:.  :: ::.:*. .*:*. ***.*** **.***. 

C1              NISAEQRQATPYAGAIFAVTGLEVHGLLANSFTIDooooooo
C2              NISAEQRQATPYAGAVFAVKGLEVRGVLANSFMMDooooooo
C3              NISAEQRQATPYAGAVFAVKGLEVRGVLANSFMMDooooooo
C4              GLTAEERKKTPYAGSVFAIHNLGVHGILANTFFVKETNHooo
C5              NITVEQRKASPHAGALFAVTGLGVHGVLANSFMMNooooooo
C6              DLTAEQRKATPHAGAVFAVKGLGVRGSIANMFRMoooooooo
C7              GLTAKEQKETPHAGSVFAVKGLGVRGILANSFMMGLKQTDEE
C8              GLTAEQREATPQAGAVFAIKGLGVRGILANSFVMGLKQTMNN
C9              NLSSEQRKATPYAGAVFAVKGLGVRGILANSFVMDooooooo
C10             GLTAEQRKETPYAGSVFAIEGLGVHGLIANSFKIDLKQKooo
C11             NLTAEQRKATPHAGAVFAVKGLKVRGILANSFVMDooooooo
C12             NISAEQRQATPHAGAIFAVTGLEVRGVLANSFIMDooooooo
C13             NISAEQRQATPHAGAIFAVTGLEVRGLLANSFMMNooooooo
C14             NLTAEQRELTPDAGAVFAVKGLKTRGTLANSFVKDooooooo
C15             NLTAKQRNATPHAGSVFAVKNLGVRGILSNSFVRDooooooo
                .:: :::: :* **::**: .* .:* ::* *          




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:94 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# SEQ_INDEX C12 11
# SEQ_INDEX C13 12
# SEQ_INDEX C14 13
# SEQ_INDEX C15 14
# PW_SEQ_DISTANCES 
BOT	    0    1	 92.59  C1	  C2	 92.59
TOP	    1    0	 92.59  C2	  C1	 92.59
BOT	    0    2	 93.21  C1	  C3	 93.21
TOP	    2    0	 93.21  C3	  C1	 93.21
BOT	    0    3	 65.00  C1	  C4	 65.00
TOP	    3    0	 65.00  C4	  C1	 65.00
BOT	    0    4	 83.33  C1	  C5	 83.33
TOP	    4    0	 83.33  C5	  C1	 83.33
BOT	    0    5	 67.89  C1	  C6	 67.89
TOP	    5    0	 67.89  C6	  C1	 67.89
BOT	    0    6	 67.08  C1	  C7	 67.08
TOP	    6    0	 67.08  C7	  C1	 67.08
BOT	    0    7	 70.19  C1	  C8	 70.19
TOP	    7    0	 70.19  C8	  C1	 70.19
BOT	    0    8	 75.39  C1	  C9	 75.39
TOP	    8    0	 75.39  C9	  C1	 75.39
BOT	    0    9	 68.44  C1	 C10	 68.44
TOP	    9    0	 68.44 C10	  C1	 68.44
BOT	    0   10	 79.50  C1	 C11	 79.50
TOP	   10    0	 79.50 C11	  C1	 79.50
BOT	    0   11	 91.30  C1	 C12	 91.30
TOP	   11    0	 91.30 C12	  C1	 91.30
BOT	    0   12	 91.05  C1	 C13	 91.05
TOP	   12    0	 91.05 C13	  C1	 91.05
BOT	    0   13	 75.00  C1	 C14	 75.00
TOP	   13    0	 75.00 C14	  C1	 75.00
BOT	    0   14	 74.84  C1	 C15	 74.84
TOP	   14    0	 74.84 C15	  C1	 74.84
BOT	    1    2	 99.07  C2	  C3	 99.07
TOP	    2    1	 99.07  C3	  C2	 99.07
BOT	    1    3	 66.25  C2	  C4	 66.25
TOP	    3    1	 66.25  C4	  C2	 66.25
BOT	    1    4	 84.57  C2	  C5	 84.57
TOP	    4    1	 84.57  C5	  C2	 84.57
BOT	    1    5	 68.23  C2	  C6	 68.23
TOP	    5    1	 68.23  C6	  C2	 68.23
BOT	    1    6	 69.57  C2	  C7	 69.57
TOP	    6    1	 69.57  C7	  C2	 69.57
BOT	    1    7	 73.29  C2	  C8	 73.29
TOP	    7    1	 73.29  C8	  C2	 73.29
BOT	    1    8	 77.57  C2	  C9	 77.57
TOP	    8    1	 77.57  C9	  C2	 77.57
BOT	    1    9	 70.00  C2	 C10	 70.00
TOP	    9    1	 70.00 C10	  C2	 70.00
BOT	    1   10	 81.06  C2	 C11	 81.06
TOP	   10    1	 81.06 C11	  C2	 81.06
BOT	    1   11	 92.24  C2	 C12	 92.24
TOP	   11    1	 92.24 C12	  C2	 92.24
BOT	    1   12	 91.36  C2	 C13	 91.36
TOP	   12    1	 91.36 C13	  C2	 91.36
BOT	    1   13	 76.25  C2	 C14	 76.25
TOP	   13    1	 76.25 C14	  C2	 76.25
BOT	    1   14	 76.09  C2	 C15	 76.09
TOP	   14    1	 76.09 C15	  C2	 76.09
BOT	    2    3	 66.56  C3	  C4	 66.56
TOP	    3    2	 66.56  C4	  C3	 66.56
BOT	    2    4	 84.88  C3	  C5	 84.88
TOP	    4    2	 84.88  C5	  C3	 84.88
BOT	    2    5	 68.56  C3	  C6	 68.56
TOP	    5    2	 68.56  C6	  C3	 68.56
BOT	    2    6	 70.19  C3	  C7	 70.19
TOP	    6    2	 70.19  C7	  C3	 70.19
BOT	    2    7	 73.60  C3	  C8	 73.60
TOP	    7    2	 73.60  C8	  C3	 73.60
BOT	    2    8	 77.88  C3	  C9	 77.88
TOP	    8    2	 77.88  C9	  C3	 77.88
BOT	    2    9	 69.69  C3	 C10	 69.69
TOP	    9    2	 69.69 C10	  C3	 69.69
BOT	    2   10	 81.37  C3	 C11	 81.37
TOP	   10    2	 81.37 C11	  C3	 81.37
BOT	    2   11	 92.86  C3	 C12	 92.86
TOP	   11    2	 92.86 C12	  C3	 92.86
BOT	    2   12	 91.98  C3	 C13	 91.98
TOP	   12    2	 91.98 C13	  C3	 91.98
BOT	    2   13	 76.25  C3	 C14	 76.25
TOP	   13    2	 76.25 C14	  C3	 76.25
BOT	    2   14	 76.40  C3	 C15	 76.40
TOP	   14    2	 76.40 C15	  C3	 76.40
BOT	    3    4	 64.06  C4	  C5	 64.06
TOP	    4    3	 64.06  C5	  C4	 64.06
BOT	    3    5	 56.27  C4	  C6	 56.27
TOP	    5    3	 56.27  C6	  C4	 56.27
BOT	    3    6	 66.04  C4	  C7	 66.04
TOP	    6    3	 66.04  C7	  C4	 66.04
BOT	    3    7	 63.84  C4	  C8	 63.84
TOP	    7    3	 63.84  C8	  C4	 63.84
BOT	    3    8	 63.41  C4	  C9	 63.41
TOP	    8    3	 63.41  C9	  C4	 63.41
BOT	    3    9	 67.09  C4	 C10	 67.09
TOP	    9    3	 67.09 C10	  C4	 67.09
BOT	    3   10	 63.04  C4	 C11	 63.04
TOP	   10    3	 63.04 C11	  C4	 63.04
BOT	    3   11	 63.21  C4	 C12	 63.21
TOP	   11    3	 63.21 C12	  C4	 63.21
BOT	    3   12	 65.00  C4	 C13	 65.00
TOP	   12    3	 65.00 C13	  C4	 65.00
BOT	    3   13	 60.44  C4	 C14	 60.44
TOP	   13    3	 60.44 C14	  C4	 60.44
BOT	    3   14	 65.73  C4	 C15	 65.73
TOP	   14    3	 65.73 C15	  C4	 65.73
BOT	    4    5	 66.56  C5	  C6	 66.56
TOP	    5    4	 66.56  C6	  C5	 66.56
BOT	    4    6	 69.25  C5	  C7	 69.25
TOP	    6    4	 69.25  C7	  C5	 69.25
BOT	    4    7	 71.74  C5	  C8	 71.74
TOP	    7    4	 71.74  C8	  C5	 71.74
BOT	    4    8	 76.32  C5	  C9	 76.32
TOP	    8    4	 76.32  C9	  C5	 76.32
BOT	    4    9	 65.62  C5	 C10	 65.62
TOP	    9    4	 65.62 C10	  C5	 65.62
BOT	    4   10	 78.57  C5	 C11	 78.57
TOP	   10    4	 78.57 C11	  C5	 78.57
BOT	    4   11	 84.78  C5	 C12	 84.78
TOP	   11    4	 84.78 C12	  C5	 84.78
BOT	    4   12	 86.11  C5	 C13	 86.11
TOP	   12    4	 86.11 C13	  C5	 86.11
BOT	    4   13	 72.81  C5	 C14	 72.81
TOP	   13    4	 72.81 C14	  C5	 72.81
BOT	    4   14	 75.78  C5	 C15	 75.78
TOP	   14    4	 75.78 C15	  C5	 75.78
BOT	    5    6	 60.13  C6	  C7	 60.13
TOP	    6    5	 60.13  C7	  C6	 60.13
BOT	    5    7	 66.78  C6	  C8	 66.78
TOP	    7    5	 66.78  C8	  C6	 66.78
BOT	    5    8	 68.33  C6	  C9	 68.33
TOP	    8    5	 68.33  C9	  C6	 68.33
BOT	    5    9	 64.57  C6	 C10	 64.57
TOP	    9    5	 64.57 C10	  C6	 64.57
BOT	    5   10	 70.37  C6	 C11	 70.37
TOP	   10    5	 70.37 C11	  C6	 70.37
BOT	    5   11	 68.67  C6	 C12	 68.67
TOP	   11    5	 68.67 C12	  C6	 68.67
BOT	    5   12	 70.23  C6	 C13	 70.23
TOP	   12    5	 70.23 C13	  C6	 70.23
BOT	    5   13	 65.68  C6	 C14	 65.68
TOP	   13    5	 65.68 C14	  C6	 65.68
BOT	    5   14	 65.66  C6	 C15	 65.66
TOP	   14    5	 65.66 C15	  C6	 65.66
BOT	    6    7	 72.84  C7	  C8	 72.84
TOP	    7    6	 72.84  C8	  C7	 72.84
BOT	    6    8	 68.11  C7	  C9	 68.11
TOP	    8    6	 68.11  C9	  C7	 68.11
BOT	    6    9	 67.70  C7	 C10	 67.70
TOP	    9    6	 67.70 C10	  C7	 67.70
BOT	    6   10	 71.56  C7	 C11	 71.56
TOP	   10    6	 71.56 C11	  C7	 71.56
BOT	    6   11	 68.01  C7	 C12	 68.01
TOP	   11    6	 68.01 C12	  C7	 68.01
BOT	    6   12	 70.19  C7	 C13	 70.19
TOP	   12    6	 70.19 C13	  C7	 70.19
BOT	    6   13	 68.32  C7	 C14	 68.32
TOP	   13    6	 68.32 C14	  C7	 68.32
BOT	    6   14	 71.88  C7	 C15	 71.88
TOP	   14    6	 71.88 C15	  C7	 71.88
BOT	    7    8	 70.59  C8	  C9	 70.59
TOP	    8    7	 70.59  C9	  C8	 70.59
BOT	    7    9	 72.05  C8	 C10	 72.05
TOP	    9    7	 72.05 C10	  C8	 72.05
BOT	    7   10	 75.31  C8	 C11	 75.31
TOP	   10    7	 75.31 C11	  C8	 75.31
BOT	    7   11	 71.43  C8	 C12	 71.43
TOP	   11    7	 71.43 C12	  C8	 71.43
BOT	    7   12	 72.98  C8	 C13	 72.98
TOP	   12    7	 72.98 C13	  C8	 72.98
BOT	    7   13	 71.12  C8	 C14	 71.12
TOP	   13    7	 71.12 C14	  C8	 71.12
BOT	    7   14	 71.56  C8	 C15	 71.56
TOP	   14    7	 71.56 C15	  C8	 71.56
BOT	    8    9	 69.16  C9	 C10	 69.16
TOP	    9    8	 69.16 C10	  C9	 69.16
BOT	    8   10	 80.25  C9	 C11	 80.25
TOP	   10    8	 80.25 C11	  C9	 80.25
BOT	    8   11	 77.57  C9	 C12	 77.57
TOP	   11    8	 77.57 C12	  C9	 77.57
BOT	    8   12	 77.57  C9	 C13	 77.57
TOP	   12    8	 77.57 C13	  C9	 77.57
BOT	    8   13	 75.70  C9	 C14	 75.70
TOP	   13    8	 75.70 C14	  C9	 75.70
BOT	    8   14	 77.43  C9	 C15	 77.43
TOP	   14    8	 77.43 C15	  C9	 77.43
BOT	    9   10	 70.13 C10	 C11	 70.13
TOP	   10    9	 70.13 C11	 C10	 70.13
BOT	    9   11	 67.50 C10	 C12	 67.50
TOP	   11    9	 67.50 C12	 C10	 67.50
BOT	    9   12	 67.81 C10	 C13	 67.81
TOP	   12    9	 67.81 C13	 C10	 67.81
BOT	    9   13	 68.42 C10	 C14	 68.42
TOP	   13    9	 68.42 C14	 C10	 68.42
BOT	    9   14	 67.92 C10	 C15	 67.92
TOP	   14    9	 67.92 C15	 C10	 67.92
BOT	   10   11	 80.62 C11	 C12	 80.62
TOP	   11   10	 80.62 C12	 C11	 80.62
BOT	   10   12	 81.37 C11	 C13	 81.37
TOP	   12   10	 81.37 C13	 C11	 81.37
BOT	   10   13	 78.93 C11	 C14	 78.93
TOP	   13   10	 78.93 C14	 C11	 78.93
BOT	   10   14	 79.26 C11	 C15	 79.26
TOP	   14   10	 79.26 C15	 C11	 79.26
BOT	   11   12	 90.99 C12	 C13	 90.99
TOP	   12   11	 90.99 C13	 C12	 90.99
BOT	   11   13	 75.62 C12	 C14	 75.62
TOP	   13   11	 75.62 C14	 C12	 75.62
BOT	   11   14	 75.31 C12	 C15	 75.31
TOP	   14   11	 75.31 C15	 C12	 75.31
BOT	   12   13	 76.25 C13	 C14	 76.25
TOP	   13   12	 76.25 C14	 C13	 76.25
BOT	   12   14	 77.02 C13	 C15	 77.02
TOP	   14   12	 77.02 C15	 C13	 77.02
BOT	   13   14	 75.79 C14	 C15	 75.79
TOP	   14   13	 75.79 C15	 C14	 75.79
AVG	 0	  C1	   *	 78.20
AVG	 1	  C2	   *	 79.87
AVG	 2	  C3	   *	 80.18
AVG	 3	  C4	   *	 64.00
AVG	 4	  C5	   *	 76.03
AVG	 5	  C6	   *	 66.28
AVG	 6	  C7	   *	 68.63
AVG	 7	  C8	   *	 71.24
AVG	 8	  C9	   *	 73.95
AVG	 9	 C10	   *	 68.29
AVG	 10	 C11	   *	 76.52
AVG	 11	 C12	   *	 78.58
AVG	 12	 C13	   *	 79.28
AVG	 13	 C14	   *	 72.61
AVG	 14	 C15	   *	 73.62
TOT	 TOT	   *	 73.82
CLUSTAL W (1.83) multiple sequence alignment

C1              ---ATGACGACGCAGGCGAGTAAA------------AATGTGAAAGTCGA
C2              ---ATGACGACGCAGGCGCGTAAA------------AATGTAAAAGTTGA
C3              ---ATGACGACGCAGGCGCGTAAA------------AATGTAAAAGTTGA
C4              ---ATGACAACGGAAGCTCATCATCACCTCAAACCTAAAATTAAGATAGA
C5              ---ATGACGACGCAGGCATGCAAA------------AATGTGAAAGTTGA
C6              ---ATG------------------------------AATATTACAATT--
C7              ---ATGACAACGGAAGCT------------------CATGTGACAGTAAA
C8              ---ATGGCAACTCAAGCT------------------GATGTAACAGTAGA
C9              ATGATGGCAACGCAAGAA------------------AATGTAGAAGTCGA
C10             ---ATGACGACA------------------------AACGTGCAAGTGAA
C11             ---ATGGCGACGCAAGAATGCGAA------AGAGGAAAAGTAAGAATCGA
C12             ---------ATGCAGGCGCGTGAA------------AATGTGAAAGTCGA
C13             ---ATGACGACGCAGGCGAGTAAA------------AATATAAAAGTCGA
C14             ---ATGACTACG------------------------CAAGTGACCGTCGA
C15             ---ATGACCACGGAGGCATGTAAA------AGTGATAGAGTGGAAGTTGA
                                                     . .*    .*   

C1              AAAAGTAACAGATGCTTATGGCCTTTCCGAAGGCCCTCATTGGGACCATC
C2              AAAAGTGACAGATACTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
C3              AAAAGTGACAGATACTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
C4              GCGAGTGACAGACGCTTATGGCCTTTCCGAGGGTCCTCACTGGGATTCTG
C5              AAAAGTGACAGATACTTACGGCCTTTCCGAAGGTCCTCATTGGGACCATC
C6              -------------------------------------------------T
C7              GGAAGTGACAGAACCTTATGGCCTTTCCGAAGGTCCTCACTGGGACCATC
C8              GAAGGTGACGGATTCTTACGGCCTCTCCGAGGGTCCTCATTGGAACCATC
C9              AAGGGTGACAGACGTTTATGGCCTTTCCGAAGGACCTCATTGGGACCACC
C10             GAGAGTGACGGAGCCTTACGGTCTCTCCGAAGGGCCTCACTGGGATCATC
C11             GAAGGTGACAAATGCTTATGGCCTCTCCGAGGGACCTCACTGGGATCACC
C12             AAAAGTGACAGATGCTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
C13             AAAAGTGACAGATATTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
C14             TAAGGTGACAGCTGCTTACGGCCTCTCCGAGGGTCCCCACTGGGACCATC
C15             GAAGGTGACAGATGCTTACGGCCTTTCCGAAGGCCCTCACTGGGACCATC
                                                                  

C1              GTACTCAAAAATTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
C2              GTACTCAAAAATTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
C3              GTACTCAAAAATTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
C4              ACGCTCAAAAGTTGTACTTTGTTGACATATATAATCAGTACGTACGTAGA
C5              ATACTCAAAAGTTGTATTTTGTTGATATATACAATCAGTATATACGCAGG
C6              ATTCATCTATATTTTACATAGGCAAGTTGTTGGCAAATCACATA------
C7              GAACTCAAAAGTTATACTTTGTCGATATATATAACCAGTACATACGTAGA
C8              GTACTCAAAAGTTATACTTTGTTGATATCTACAATCAGTACATACGTAGA
C9              GTACTCAAAAATTGTATTTCGTTGATGTATACAATCAATACATTCGCAGA
C10             GTACTCAAAAGTTGTACTTCGTCGATATCTACAACCAGTACATACGTAGA
C11             GCACTCAAAAATTGTATTTTGTTGACATAAATAATCAGTATATACGCAGG
C12             GTACTCAAAAGTTGTATTTTGTTGACATATATAATCAGTATATACGCAGA
C13             GTACTCAAAAGTTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
C14             GTACCCAAAAGTTGTTCTTCGTTGACATACAGAATCAGTACATCCGCCGG
C15             GCACCCAAAAGTTATATTTCGTTGACATATACAATCAGTACATACGCAGG
                .  *  .:*:.** *: :* *  .*  *  : .. .*  * .*       

C1              CTAGATCCCGCAACAGGTGTTGTGACCAGCGCATACATAGATCATGGGAC
C2              CTAGATCCCGCAACAGGTGTTGTGACCAGCACATACATAGATCATGGGAC
C3              TTAGATCCCGCAACAGGTGTTGTGACCAGCTCATACATAGATCATGGGAC
C4              CTGGATCCTGCGACAGGTGTTGTAACCAGCACTTACATAGACCACGGTCC
C5              CTAGATCCCGCAACAGGTGTTGTGACCAGTGCATACATAGATCATGGAAC
C6              CTAGACCCTGCAACAAATGCTGTAACTAGTGCATACATAAAAAGTGGTAC
C7              CTGGACACTGCAACCGGTGTTGTAACCAGTGCCTATGTAGAACATGGCCC
C8              CTAGACACCGCAACAGGCGTAGTGACCAGTGCGTACATAGAGCACGGTCC
C9              TTAGATCCTGCGACAGGTGTTGTGACTAGTGCACGCATAAATGAAGGCAC
C10             CTAGACGTTGCGACAGGTGTTGTGACAAGTACATACATAAATCATGGCCC
C11             CTAGATCCGGCAACAGGTGTTGTGACCAGCGTGTACATAGATCACGGGCC
C12             CTAGATCCCGCAACAGGTGTTGTGACCAGTGCATACATAGATCATGGGAC
C13             CTAGATCCCGCAACAGGTGTTGTGACCAGCGCATACATAGATCATGGGAC
C14             CTAGATATCGCAACGGGTGTTGTGACCAGTGCATACATAGCAAACGGGAC
C15             TTAGATCCTGCAACAGGTGATGTGAAGAGCGTGCACATAGATCACGGGCC
                 *.**    **.** .. * :**.*. **     . .**..  . ** .*

C1              TGTAGGAGTTGCTGTACCTGTGGATGACAGTGTTGACCAACTTATAGTGG
C2              TGTAGGAGTTGCTGTACCTGTGGATGACAGCGTTGATCAACTTATAGTAG
C3              TGTAGGAGTTGCTGTACCTGTGGATGACAGCGTTGATCAACTTATAGTAG
C4              TGTTAGTGTTGTGATACCTGTGCATGATAGTCCTAATAAATTCGTAGTTG
C5              TGTAGGAGTTGTTGTACCTGTGGATGACACTGTTGACAAACTTATAGCAG
C6              TGTTGGTGTTGTTGTACCTGTGGACGATTCTACTGATCAATTTGCAGCAG
C7              TGTTGGAGTTGTTGTACCTGCAGAAGATACGAGTGATAAACTCGTAGCAG
C8              TGTCGGAGTGGTTGTACCTGTGGATGACACAACCGATGCATTCGTAGCGG
C9              TGTTGGAGTCGTAATACCTGTGGAGGATACTATTGATCAACTGATAGCAG
C10             CGTTTCAGTTGTAGTGCCTGTGGATGATTCAACAGACGAATTTGTAGCTG
C11             TGTAGGAGTTGTTGTACCTGTGGACGATACAACTGACCAACTGGTAGCAG
C12             TATAGGAGTTGCTGTACCTTTGGATGACAGTGTTGACCAACTTATAGCAG
C13             TGTAGGAGTTGTTGTACCTGTGGATGACAGTGTTGACCAACTTATAGCAG
C14             CGTTGGAGTTGTCATACCAGTGGACGACTCGAATGATGAACTTGTAGCAG
C15             TATTGGAGTTGTTATACCCGTGGATGACACGACTGACCAGTTTGTAGCAG
                 .*   :** *  .*.**   . * ** :     .*  .. * . **  *

C1              GTTCAGGAAAAGATGTTATTCTTGTTACATGGGATGGAGAAAGCAATAAA
C2              GTTCAGGAAAAGATGTTATTCTTGTTACATGGGATGGAGACAGCAATAAA
C3              GTTCAGGAAAAGATGTTATTCTTGTTACATGGGATGGAGACAGCAATAAA
C4              GTAGTGGAAAAGATGTTATTTTAGTCAACTGGAATTCAGATGCAAATCAG
C5              GTTCAGAAAGAGATGTTATTCTCATTACGTGGGATGGAGACAGCAATAAA
C6              GTGTTGGAAGAGATCTTATATTGGTTACATGGGATGATGAGCAGAATGAG
C7              GTTCTGGAAAAGATCTCGTTCTTGTCACCTGGGACGGAGATGAGGATAAG
C8              GCTCTGGAAGAGATCTTATTCTCGTCACGTGGGACAGTGATAGGGATGAC
C9              GTGTGGGGAAAGATGTTGTTCTTGTTACATGGGACGGAGACGAAGATGAA
C10             GTTCCGGAAGAGATGTTATTCTTGTTACTTGGAACGGAACGGAAAATCTG
C11             GTTCGGGAAAAGATATTATTCTTGTTACGTGGGATGGAGACAGTGATGAT
C12             GTTCAGGAAAAGATGTTATTCGTGTTACATGGGACGGAGACAGCAATAAA
C13             GTTCAGGAAAAGATATTATTCTTGTTACATGGGACGGAGACAGCAATAAA
C14             GTGTGGGAAAAGATCTTGTTCTCGTGAAGTGGAACGGAGACGAGGATGAT
C15             GTGCGGGAAAAGATGTTGTTCTCGTTACGTGGGACGCGGACGAAGATGAA
                *    *..*.**** * .*:   .* *. ***.*    ..    .** : 

C1              TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTGAGGCTCA
C2              TCTAAGGTATCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTGAGGCTCA
C3              TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTGAGGCTCA
C4              AAAGTGACACCATACAATGTTCTGAGTAATCTTACATCT------GGCGA
C5              TCTAAGGTACCAGTCGAAGTGTTGTGTTCACTCGACTCTCCTCAGTCTGA
C6              ACGAATGTACCAACTGAAGTACTATGTTCTGTTGATGTGGGAAATACTCA
C7              GAGAAAGTTCCAGTCAAAGTACTGTCTTCTATCGAACCTTCTTCTAGCGA
C8              TCAAACGCTACAACCGAGGTACTGTGTCCCGTGGACACTACTCATACTCA
C9              TCGGAAGTACCAGTCAAAGTGTTGTGCTCCCTTGATTCCGAGCAGGCGCA
C10             TCAAATACAAAACCCAAGGTGTTAACTACTGTGGATCTTACCCACACCAA
C11             TCGCAGGTACCGATCAAAGTGTTGTGTTCAGTTGACTTTGCACAGGCTCA
C12             TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTCAGGCTCA
C13             TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTCAGGCTCA
C14             TCGGAGCCGAAGGTCAAAATGCTATGCTCGCTCGAGCCTCCTCAGGCTGA
C15             TTGGGG---AACGTCACAGTGTTGTGTTCGCTCGACTCTGCTCAGTCTGA
                          .    .. .*  *.:   .  * ..              *

C1              AACGAGAATTAATGATGGAAAAGTGGACTCGGCTGGAAGATTTTGGCTCG
C2              AACGAGAATTAATGATGGAAAAGTGGATTCTGCTGGAAGATTTTGGCTCG
C3              AACGAGAATTAATGATGGAAAAGTGGATTCTGCTGGAAGATTTTGGCTCG
C4              CGTAAGAACTAATGATGGAAAAGCGGATTCAGCTGGAAGATTATGGATTG
C5              AACAAGAATTAATGATGGAAAAGTGGACTCAGCAGGAAGATTTTGGCTTG
C6              AACAAGAATCAATGATGGAAAGGTTGACTCCTCAGGAAGATTTTGGCTAG
C7              TACAAGAATCAATGATGGAAAAGTAGATTCATCTGGAAGATTTTGGATTG
C8              AACGAGGATTAACGACGGAAAAGTTGATTCATTTGGAAGATTTTGGCTGG
C9              AACAAGAACCAATGATGGAAAGGTTGATTCATCCGGAAGACTTTGGATCG
C10             TACAAGAACCAATGATGGAAAGGCCGATTCGTCCGGAAGACTTTGGATCG
C11             AACGAGAATCAATGATGGAAAGGTGGATTCAGCTGGAAGATTTTGGCTCG
C12             AACGAGAATTAATGATGGAAAAGTGGACTCGGCTGGAAGATTTTGGCTCG
C13             AACGAGAATTAATGATGGAAAAGTAGACTCGGCTGGAAGATTTTGGCTCG
C14             GACAAGGATCAACGATGGCAAGGTGGACTCAACCGGAAGATTTTGGCTCG
C15             CACAAGGGTCAATGACGGCAAGGTGGACTCGTATGGAAGATTTTGGCTTG
                 . .**..  ** ** **.**.*  ** **    ****** *:***.* *

C1              GTACTATGGGTAACGAAGTCAATGGACAGATAGCT---CCCAATTTAGGA
C2              GTACTATGGGTAACGAAGTCAATGGAGAGACAGCT---CCCAATTTAGGA
C3              GTACTATGGGTAACGAAGTCAATGGAGAGATAGCT---CCCAATTTAGGA
C4              GTACTATGGCGAATGAAATTAATGGACAGATAGCT---CTTGATAAGGGA
C5              GTACTATGGCAAATGAAGTTAATGGAGTGGTAGCT---CCCAATCAAGGA
C6              GAACTATGGGTGAAAATGGCAAAGGAAATTCAATT---CCTAATATAGGA
C7              GTACTATGGCGAATGAAGTTAATGGAGAGATAGCT---TCTGATAAGGGA
C8              GCACCATGGCTAATGAGGTGAATGGACAGATACTT---CCTAATCAAGGT
C9              GTACTATGGGTATAGAAACCAAGGGAATGGTTCTT---CCTAATCAGGGA
C10             GCACTATGGGTGACGAAATTGATGGACAACCGTCGCCGCCAAACCTAGGA
C11             GTACTATGGGTCAGGAAGTCAATGGAGTGGCAGCT---TCCAATCAAGGA
C12             GTACTATGGGTAACGAAGTAAATGGAAAGATAGCT---CCCAATTTAGGG
C13             GTACTATGGGTAACGAAGTCAATGGAAAGATAGCT---CCCAATTTAGGA
C14             GTACTATGGGCATCGAGGTCAATGGAGTGGCGCCT---CCCGATCTAGGA
C15             GTACTATGGGTAACGAAGTCAATGGAGTGATAGCT---CCCAATCTAGGA
                * ** ****   : .* .  .* *** :             .*  :.** 

C1              ACATTATATCGCGTCGATGATGATCTTGAGCCAAAAAAGAAAATATCGCC
C2              ACATTATATCGCGTTGATGATGATCTTGAGCCAAAAAAGGAAATATCGCC
C3              ACATTATATCGCGTTGATGATGATCTTGAGCCAAAAAAGGAAATATCGCC
C4              TCATTATATCGCCTTGATGATACGCTTAAACCTAAAACAGAAATAACCCC
C5              ACGTTATATCGTGTTGATAATGATTTTAAGCCTAATAAAGAAATATCGCC
C6              TCATTTTATCGCATTGATGATGACTTGAAGCCCAAAAAAGAAATATCTCC
C7              TCATTATATCGCATTGATGATACGCTTAAACCTGTAAAGGAAGTAACTCC
C8              TCGTTATACTGCATAGACGACGAGCTGAAACCTAAGGTGGAAGTATCGCC
C9              ACGTTATATCGCGTTGATGACGATCTTAAACCTGAAAAAGAAGAATCACC
C10             TTATTATCCCGCATTGACGATGAGATGAAACACGTGGTAGAGATAAGTCC
C11             ACATTATATCGCGTCAATGAGGATCTTCACCCTGAGAAGGAGATCTCACC
C12             ACATTATATCGCGTTGATGATGATTTTGAGCCAAAAAAGGAAATATCACC
C13             ACATTATATCACGTTGATGATGCTCTTGAGCCAAAAAAGGAAATATCACC
C14             TCGTTGTACCGCGTTGACGACAATCTTAAACCTGAAAAGGAAATATCGCC
C15             ACGTTGTATCGCGTTGACGACAAGCTTAAGCCTATGAAGGAAATATCGCC
                : .** *.  .  * .* .* ..  *  * *. .: . ..*..:.:  **

C1              TGTTACAATAAGTAATGGATTGGCATGGAATATTGAAGACGACACTTTGT
C2              TGTTACAATAAGTAATGGATTGGCATGGAATATTGAAGACGACACTTTGT
C3              TGTTACAATAAGTAATGGATTGGCATGGAATATTGAAGACGACACTTTGT
C4              TGTTTCAATAAGTAATGGATTAGCGTGGAATATCGAAGACAATACTTTCT
C5              TGTTTCAATAAGTAATGGATTGGCATGGAACATTGAAGACAATATTATGT
C6              TGTTTCAATAAGCAATGGATTAGCATGGAATATCGAAGATGATACTTTCT
C7              TGTTTCAATAAGTAACGGATTAGCATGGAATATCGAGGACAATACTTTCT
C8              CGTTTCGATAAGTAACGGATTAGGGTGGAACATCGAGGATGACACCTTTT
C9              CGTTTCAATAAGTAATGGATTAGCGTGGAATATGGAAGATAATACCTTTT
C10             TGTTTCCATTAGTAATGGATTGGCGTGGAATATCCAGGACGACACTTTCT
C11             TGTTTCAATAAGCAATGGATTGGCATGGAATATTGAAGATGACACCTTCT
C12             TGTTACAATAAGTAACGGATTGGCATGGAATATAGAAGATGACACTTTGT
C13             TGTTTCAATAAGTAATGGATTGGCATGGAATATAGAAGACAACACTTTCT
C14             CGTTACGATAAGTAACGGATTGGCGTGGAATAGCAAAGATGACACTTTCT
C15             GGTTTCGATAAGTAACGGATTGGCATGGAATATTGAAGACAACACCTTCT
                 ***:* **:** ** *****.* .***** *   *.** .* *  :* *

C1              ATTATATTGATTCAACTCCTCGTCAGGTTGCAGCGTATGATTACAATCCG
C2              ATTATATTGATTCACCTACTCGTCAGATTGCAGCGTATGATTACAATCCG
C3              ATTATATTGATTCACCTACTCGTCAGATTGCAGCGTATGATTACAATCCG
C4              ATTACATTGATTCAAGTACACGTGAGATTGCAGCATACGATTTTGATCCG
C5              ATTATATTGATTCAGTTACTCGTCAAGTTGCAGCATATGATTACAATCCG
C6              ATTATATTGATTCACCTGAACGTAATGTTGTGGCGTATGATTATAATCCA
C7              ATTACATTGATTCACCTACACGTCAGATTGCAGCATATGATTATGATCCG
C8              ATTATATCGATTCACCTACACGTCAGATCGCGGCGTACAATTACGATCCG
C9              ATTATATTGACTCACCCACGCGACAAGTCGCAGCGTACGATTATCAACCG
C10             ATTACATTGATTCGCCCACGCGTGTAATCGCGGCGTATGACTACGATCCG
C11             ATTATATTGACTCGCCTACTCGTCAGGTTGCAGCGTACGATTACAATCCA
C12             ATTATATTGATTCACCTACTCGTCAGGTTGCAGCGTATGATTACAATCCG
C13             ATTATATTGACTCACCTACTTATCAGGTTGCAGCGTATGATTACAATCCG
C14             ATTATATTGACTCACCTACGCGCCAAGTTGCGGCCTATGATTACGATCCG
C15             ACTATATTGACTCACCTACTCGTCAGGTTGCAGCGTATGATTACGATCCG
                * ** ** ** **.    .  .  : .* * .** ** .* *:  *:**.

C1              AATAATGGGACAATATCTAATAAGAGGATTGTATTTGATCTCAATAAGAC
C2              AATAATGGGACAATATCTAATAAGAGGATTGTATTCGATCTCAATAAGAC
C3              AATAATGGGACAATATCTAATAAGAGGATTGTATTCGATCTCAATAAGAC
C4              AATAGTGGGACAATATCTAATAAAAGGATTGCACTTAATTTGAATCACAC
C5              AATAATGGAACAATATCTAATAAGAGAATTGTATTTGATCTCAATAAGAC
C6              ATTAATGGAACAATATCTAATAAGAGGATTGTGTTCAACTTGAACAATAC
C7              AATAATGGGACAATATCTAATAAGAGGATTGTATTTGACCTGAGTAAAAC
C8              AATGAAGGAACAATATCTAACAGGAGAATTGTATTCGATTTGAACAAAAC
C9              TATAATGGGATGATTTGTAACAAGAGGATTGTATTTGACCTTAACACAAC
C10             ATTAACGGGAAAATCAGTAACAGAAGAGTTGTATTTGATTTGAACGACAC
C11             AATAATGGAACAATATGTAACAGGAGGATTGTATTTGACCTTAATAACAC
C12             ACTAATGGGACAATATCTAATAAGAGGATTGTATTCGATCTCAATAAGAC
C13             AATAATGGGACAATATCTAATAAGAGGATTGTATTTGATCTCAATAAGAC
C14             AATCTCGGGAAAATATCTAACAGGAGGATTGTGTTTGATCTTAACAACAC
C15             AATAGTGGAACAATATCTAACAAGAGGATTGTATTCAATCTCAACACTAC
                : *   **.* .** : *** *..**..*** . * .*  * *.  . **

C1              TAATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
C2              TGATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
C3              TGATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
C4              TAAGCTAGAAGGATTACCTGATGGAATGACCATAGATACAGATGGCAATC
C5              TGATTTGAAAGGATTACCCGATGGAATGACTATAGATGCAAATGGCAATC
C6              TAATTTAACTGGAGTGCCTGATGGAATGACCATAGATACAGATGATAATC
C7              TAATGTGAAAGGAGTACCAGATGGAATGACCATAGATACAAATGGCAATC
C8              CGATTTGCAAGGAGTGCCCGATGGAATGACCATAGATACAGATGGGAATT
C9              AAACTTCCAAGGAGTACCTGACGGAATGACTATAGATGCAGATGGTAATC
C10             TGACCTCAGCGGAGTACCTGATGGAATGACCATAGATACAGATGGCAATC
C11             TGATCTCCAAGGAGTGCCCGATGGAATGACCATAGATGCGGATGGTAATC
C12             TAATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
C13             TGATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
C14             TGATCTCAAAGGGGTTCCCGATGGAATGACCATAGATACCGATGGCAATC
C15             CGATGTGAAAGGAGTACCCGATGGAATGACCATAGATGCAGATGGCAATC
                 .*  *    **. * ** ** ******** ******.* .***. *** 

C1              TTTGGATAGCATTATTTGGTGGATCTCGAGTTATTTGCGTGGATCCGAAA
C2              TTTGGATAGCATTATTTGGTGGATCTCAAGTTATTTGTGTGGATCCGAAA
C3              TTTGGATAGCATTATTTGGTGGATCTCAAGTTATTTGTGTAGATCCGAAA
C4              TTTGGGTAGCATTGTTTGGAGGACATGGTCTCATCAAAGTGGATCCACAC
C5              TTTGGATAGCATTATTTGGTGGATCTCGTGTTATTCACGTGGACCCGAAA
C6              TTTGGATAGCACTATTTGGTGGAAGTCATGTTATCAAAGTAAATCCGAGA
C7              TTTGGGTAGCAGTATATGGAGGACATCATGTCCTCCATGTGAATCCAAAA
C8              TATGGATAGCACTATACGGTGGAAAGCACGTCATCCATGTGAATCCGAAA
C9              TTTGGATAGCACTATTTGGTGGACATCATGTCATCCAGGTGGATCCGAAA
C10             TCTGGATAGCGCTGTTCGGTGGACATCATATTATCAATGTAAATCCCAAA
C11             TCTGGATAGCACTATTTGGAGGACATCATGTAATTCATGTAGATCCTAAA
C12             TTTGGATAGCATTATTTGGTGGATCTCGAGTTATTTGCGTAGATCCGAAA
C13             TTTGGATAGCATTATTTGGTGGATCTCGAGTTATTTGCGTGGATCCGAAA
C14             TTTGGATAGCACTATTTGGCGGATCTCATGTCATTCAGGTGGATCCAAAA
C15             TTTGGATAGCAGTATTTGGTGGACATCACGTCATACACGTGGATCCGAGA
                * ***.****. *.*: ** ***    .  * .*  . **..* ** ...

C1              ACAGAAAAAGTATTACGCGAAGTTGAGATTCCAACTGAAAACGTAACCAG
C2              ACAGAAAAAGTATTATACAAAGTTGAGCTTCCAGCTGAAAACGTAACCAG
C3              ACAGAAAAAGTATTATACAAAGTTGAGCTTCCAGCTGAAAACGTAACCAG
C4              AAACACAAAGTGCTGGAAAAAATTGAGCTTCCTGCTAGAGATGTATCTAG
C5              ACAGGAAAAGTATTATGCAAAGTTGAGCTTCCGGTTGAAAACGTAACCAG
C6              ACAGGAGAATTATTGTGTCAAATCAAGATTCCAGCTGAAAATGTAACTAG
C7              ACACAACAACTGTTGAAAAAAGTTAAGATTCCAGCTGGAGGTGTAACCAG
C8              ACAGGAAAAATGCTAGGTAAAGTTGAGCTCCCGGCCGACAATGTAACCAG
C9              ACAGGAAAAGTTTTAAGTAAAGTTAAGCTTCCAGCTGAAAACGTATCCAG
C10             ACGAAACAACTGCTGCGCAAAATTAAGCTCCCAGCTGAAAATGTGACCAG
C11             ACAGGACAAGTATTACGCAAAGTTAAGATACCGGCTGAAAATGTAACCAG
C12             ACAGGAAATGTATTATCCAAAGTTGAGCTTCCAGCTGAAAACGTAACCAG
C13             ACAGAAAAAGTATTATGCAAAGTTGACATTCCAGCTGAAAACGTAACCAG
C14             ACAGGAGCAGTAATGCGCAAAGTTAAGATTCCGGCTGACAATGTAACCAG
C15             ACAGGAAAGATGTTACGCAAAGTTAAGATCCCAGCTGAAAACGTAACCAG
                *.. .. .  *  *.    **.* .* .* ** .  ..... **.:* **

C1              TGTCGCATTCGGCGGTCCACTTCTAGATACTTTGTATGTGACCACATCTG
C2              TGTCGCATTCGGTGGTCCGCTTCTAGATACCTTGTATGTGACCACATCTG
C3              TGTCGCATTCGGTGGTCCGCTTCTAGATACCTTGTATGTGACCACATCTG
C4              TGTTGCCTTTGGTGGTCCGCTTCTCGATATTTTATATGTAACTACATCAG
C5              TGTCACATTCGGCGGTCCGCTTCTGGATACTTTGTACGTGACCACATCTG
C6              TGTTACATTTGGAGGCCCGCTTCTTGACATTCTTTATGTGACCACCTCAG
C7              TGTCGCCTTTGGTGGTCCACTTCTTGATATTCTGTATGTGACTACCTCGG
C8              TGTCACATTCGGTGGTCCGCTTCTCGATATTCTATATGCCACAACCTCCA
C9              TGTTACATTCGGCGGTTCGCTCCTTGACATCCTATACGTAACTACATCGG
C10             TGCTGCATTTGGTGGTCCGCTTCTCGATATTTTGTACGTGACTACATCGG
C11             CGTTGCGTTTGGCGGTCCGCTACTAGACATTTTGTACGTGACTACATCGG
C12             TGTCGCATTCGGCGGTCCGCTTCTAGATACTTTGTATGTGACCACATCTG
C13             TGTCACATTCGGCGGTCCACTTCTAGATACTTTGTATGTAACCACATCTG
C14             CGTCACGTTCGGCGGTCCGCTTCTGGATACTTTGTACGTGACCACGTCGG
C15             TGCCATGTTCGGCGGTCCGCTTCTGGATACTTTGTACGTGACCACATCGG
                 *  .  ** ** **  *.** ** ** *   * ** *  ** ** ** .

C1              GTTTCAATATAAGTGCAGAGCAACGACAAGCGACTCCTTACGCTGGTGCT
C2              GTTTCAATATAAGTGCAGAACAACGACAAGCGACTCCTTACGCTGGTGCT
C3              GTTTCAATATAAGTGCAGAACAACGACAAGCAACTCCTTACGCTGGTGCT
C4              GTCATGGTTTAACTGCAGAAGAGCGAAAGAAGACTCCCTATGCTGGTTCC
C5              GCTACAATATAACTGTAGAGCAACGAAAAGCATCTCCTCACGCTGGTGCT
C6              GCAAGGATTTAACTGCAGAACAACGAAAGGCGACTCCTCATGCGGGTGCT
C7              GCTATGGTTTAACTGCAAAAGAGCAAAAAGAGACTCCCCATGCTGGCTCC
C8              GCAATGGTTTAACCGCTGAGCAGCGGGAAGCGACTCCCCAAGCTGGTGCA
C9              GCCACAATCTAAGTTCAGAACAACGAAAAGCGACTCCTTATGCCGGTGCG
C10             GTCATGGTTTAACCGCGGAACAGCGAAAAGAGACACCTTACGCTGGCTCC
C11             GTTTTAATTTAACTGCAGAACAACGAAAAGCGACTCCTCACGCTGGTGCT
C12             GTTACAATATAAGTGCAGAGCAACGACAAGCAACTCCTCACGCTGGTGCT
C13             GTTTCAACATAAGTGCAGAGCAACGACAAGCAACTCCTCACGCTGGTGCT
C14             GCTATAATTTAACTGCGGAGCAACGAGAACTGACTCCTGACGCGGGTGCG
C15             GCCACAATTTAACTGCAAAGCAACGAAATGCGACTCCTCACGCTGGTTCT
                *  : ..  ***     .*. *.*.. *   .:*:**  * ** **  * 

C1              ATATTCGCGGTGACAGGTTTAGAAGTTCATGGACTACTTGCAAATTCATT
C2              GTATTCGCGGTGAAAGGTTTAGAAGTTCGTGGAGTTCTTGCAAATTCATT
C3              GTATTCGCGGTGAAAGGTTTAGAAGTTCGTGGAGTTCTTGCAAATTCATT
C4              GTGTTTGCAATTCATAACTTGGGAGTTCATGGGATTCTTGCAAATACCTT
C5              TTATTCGCGGTGACAGGCCTAGGAGTTCATGGAGTTCTTGCAAATTCATT
C6              GTATTTGCTGTAAAAGGCTTAGGAGTTCGCGGAAGTATCGCGAATATGTT
C7              GTATTCGCAGTGAAGGGCTTGGGAGTTCGTGGAATTCTTGCAAATTCGTT
C8              GTTTTCGCGATAAAAGGTTTGGGAGTTCGTGGAATTCTTGCAAATTCCTT
C9              GTATTTGCGGTGAAAGGCTTAGGAGTTCGCGGAATTCTCGCAAATTCATT
C10             GTATTCGCGATAGAAGGCTTGGGTGTTCACGGACTCATTGCAAACTCGTT
C11             GTATTCGCAGTGAAAGGTTTAAAAGTTCGTGGAATTCTCGCAAATTCGTT
C12             ATATTCGCGGTGACAGGCCTAGAAGTTCGTGGAGTTCTTGCAAATTCATT
C13             ATATTCGCGGTGACAGGTTTAGAAGTTCGTGGACTACTTGCAAATTCATT
C14             GTATTCGCGGTGAAAGGCTTAAAAACTCGCGGAACTCTCGCGAATTCGTT
C15             GTATTCGCGGTAAAAAACCTAGGAGTTCGTGGAATTCTCTCGAATTCGTT
                 * ** ** .*  . ..  *...:. **. **.   .*  *.** :  **

C1              TACGATAATGGAT-------------------------------------
C2              TATGATGATAGAT-------------------------------------
C3              TATGATGATAGAT-------------------------------------
C4              TTTTGTTAATAAAGAGACGAATCAT-------------------------
C5              TATGATGGTGAAT-------------------------------------
C6              TCGGATGAAA----------------------------------------
C7              TATGATGAACGGACTAAAGCAAACAGATGAGGAAAAGACAGATGTG----
C8              CGTGATGAACGGCTTAAAGCAGACTATGAATAAC----------------
C9              TGTGATG---GAC-------------------------------------
C10             CAAGATAAGTGATTTGAAACAAAAG-------------------------
C11             TGTGATGATGGAT-------------------------------------
C12             TATAATGATAGAT-------------------------------------
C13             TATGATGATAAAT-------------------------------------
C14             CGTGAAAATGGAT-------------------------------------
C15             TGTGAGGATGGAT-------------------------------------
                    .                                             

C1              --------------------------------------------------
C2              --------------------------------------------------
C3              --------------------------------------------------
C4              --------------------------------------------------
C5              --------------------------------------------------
C6              --------------------------------------------------
C7              --------------------------------------------------
C8              --------------------------------------------------
C9              --------------------------------------------------
C10             --------------------------------------------------
C11             --------------------------------------------------
C12             --------------------------------------------------
C13             --------------------------------------------------
C14             --------------------------------------------------
C15             --------------------------------------------------
                                                                  

C1              ---------------
C2              ---------------
C3              ---------------
C4              ---------------
C5              ---------------
C6              ---------------
C7              ---------------
C8              ---------------
C9              ---------------
C10             ---------------
C11             ---------------
C12             ---------------
C13             ---------------
C14             ---------------
C15             ---------------
                               



>C1
---ATGACGACGCAGGCGAGTAAA------------AATGTGAAAGTCGA
AAAAGTAACAGATGCTTATGGCCTTTCCGAAGGCCCTCATTGGGACCATC
GTACTCAAAAATTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
CTAGATCCCGCAACAGGTGTTGTGACCAGCGCATACATAGATCATGGGAC
TGTAGGAGTTGCTGTACCTGTGGATGACAGTGTTGACCAACTTATAGTGG
GTTCAGGAAAAGATGTTATTCTTGTTACATGGGATGGAGAAAGCAATAAA
TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTGAGGCTCA
AACGAGAATTAATGATGGAAAAGTGGACTCGGCTGGAAGATTTTGGCTCG
GTACTATGGGTAACGAAGTCAATGGACAGATAGCT---CCCAATTTAGGA
ACATTATATCGCGTCGATGATGATCTTGAGCCAAAAAAGAAAATATCGCC
TGTTACAATAAGTAATGGATTGGCATGGAATATTGAAGACGACACTTTGT
ATTATATTGATTCAACTCCTCGTCAGGTTGCAGCGTATGATTACAATCCG
AATAATGGGACAATATCTAATAAGAGGATTGTATTTGATCTCAATAAGAC
TAATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
TTTGGATAGCATTATTTGGTGGATCTCGAGTTATTTGCGTGGATCCGAAA
ACAGAAAAAGTATTACGCGAAGTTGAGATTCCAACTGAAAACGTAACCAG
TGTCGCATTCGGCGGTCCACTTCTAGATACTTTGTATGTGACCACATCTG
GTTTCAATATAAGTGCAGAGCAACGACAAGCGACTCCTTACGCTGGTGCT
ATATTCGCGGTGACAGGTTTAGAAGTTCATGGACTACTTGCAAATTCATT
TACGATAATGGAT-------------------------------------
--------------------------------------------------
---------------
>C2
---ATGACGACGCAGGCGCGTAAA------------AATGTAAAAGTTGA
AAAAGTGACAGATACTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
GTACTCAAAAATTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
CTAGATCCCGCAACAGGTGTTGTGACCAGCACATACATAGATCATGGGAC
TGTAGGAGTTGCTGTACCTGTGGATGACAGCGTTGATCAACTTATAGTAG
GTTCAGGAAAAGATGTTATTCTTGTTACATGGGATGGAGACAGCAATAAA
TCTAAGGTATCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTGAGGCTCA
AACGAGAATTAATGATGGAAAAGTGGATTCTGCTGGAAGATTTTGGCTCG
GTACTATGGGTAACGAAGTCAATGGAGAGACAGCT---CCCAATTTAGGA
ACATTATATCGCGTTGATGATGATCTTGAGCCAAAAAAGGAAATATCGCC
TGTTACAATAAGTAATGGATTGGCATGGAATATTGAAGACGACACTTTGT
ATTATATTGATTCACCTACTCGTCAGATTGCAGCGTATGATTACAATCCG
AATAATGGGACAATATCTAATAAGAGGATTGTATTCGATCTCAATAAGAC
TGATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
TTTGGATAGCATTATTTGGTGGATCTCAAGTTATTTGTGTGGATCCGAAA
ACAGAAAAAGTATTATACAAAGTTGAGCTTCCAGCTGAAAACGTAACCAG
TGTCGCATTCGGTGGTCCGCTTCTAGATACCTTGTATGTGACCACATCTG
GTTTCAATATAAGTGCAGAACAACGACAAGCGACTCCTTACGCTGGTGCT
GTATTCGCGGTGAAAGGTTTAGAAGTTCGTGGAGTTCTTGCAAATTCATT
TATGATGATAGAT-------------------------------------
--------------------------------------------------
---------------
>C3
---ATGACGACGCAGGCGCGTAAA------------AATGTAAAAGTTGA
AAAAGTGACAGATACTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
GTACTCAAAAATTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
TTAGATCCCGCAACAGGTGTTGTGACCAGCTCATACATAGATCATGGGAC
TGTAGGAGTTGCTGTACCTGTGGATGACAGCGTTGATCAACTTATAGTAG
GTTCAGGAAAAGATGTTATTCTTGTTACATGGGATGGAGACAGCAATAAA
TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTGAGGCTCA
AACGAGAATTAATGATGGAAAAGTGGATTCTGCTGGAAGATTTTGGCTCG
GTACTATGGGTAACGAAGTCAATGGAGAGATAGCT---CCCAATTTAGGA
ACATTATATCGCGTTGATGATGATCTTGAGCCAAAAAAGGAAATATCGCC
TGTTACAATAAGTAATGGATTGGCATGGAATATTGAAGACGACACTTTGT
ATTATATTGATTCACCTACTCGTCAGATTGCAGCGTATGATTACAATCCG
AATAATGGGACAATATCTAATAAGAGGATTGTATTCGATCTCAATAAGAC
TGATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
TTTGGATAGCATTATTTGGTGGATCTCAAGTTATTTGTGTAGATCCGAAA
ACAGAAAAAGTATTATACAAAGTTGAGCTTCCAGCTGAAAACGTAACCAG
TGTCGCATTCGGTGGTCCGCTTCTAGATACCTTGTATGTGACCACATCTG
GTTTCAATATAAGTGCAGAACAACGACAAGCAACTCCTTACGCTGGTGCT
GTATTCGCGGTGAAAGGTTTAGAAGTTCGTGGAGTTCTTGCAAATTCATT
TATGATGATAGAT-------------------------------------
--------------------------------------------------
---------------
>C4
---ATGACAACGGAAGCTCATCATCACCTCAAACCTAAAATTAAGATAGA
GCGAGTGACAGACGCTTATGGCCTTTCCGAGGGTCCTCACTGGGATTCTG
ACGCTCAAAAGTTGTACTTTGTTGACATATATAATCAGTACGTACGTAGA
CTGGATCCTGCGACAGGTGTTGTAACCAGCACTTACATAGACCACGGTCC
TGTTAGTGTTGTGATACCTGTGCATGATAGTCCTAATAAATTCGTAGTTG
GTAGTGGAAAAGATGTTATTTTAGTCAACTGGAATTCAGATGCAAATCAG
AAAGTGACACCATACAATGTTCTGAGTAATCTTACATCT------GGCGA
CGTAAGAACTAATGATGGAAAAGCGGATTCAGCTGGAAGATTATGGATTG
GTACTATGGCGAATGAAATTAATGGACAGATAGCT---CTTGATAAGGGA
TCATTATATCGCCTTGATGATACGCTTAAACCTAAAACAGAAATAACCCC
TGTTTCAATAAGTAATGGATTAGCGTGGAATATCGAAGACAATACTTTCT
ATTACATTGATTCAAGTACACGTGAGATTGCAGCATACGATTTTGATCCG
AATAGTGGGACAATATCTAATAAAAGGATTGCACTTAATTTGAATCACAC
TAAGCTAGAAGGATTACCTGATGGAATGACCATAGATACAGATGGCAATC
TTTGGGTAGCATTGTTTGGAGGACATGGTCTCATCAAAGTGGATCCACAC
AAACACAAAGTGCTGGAAAAAATTGAGCTTCCTGCTAGAGATGTATCTAG
TGTTGCCTTTGGTGGTCCGCTTCTCGATATTTTATATGTAACTACATCAG
GTCATGGTTTAACTGCAGAAGAGCGAAAGAAGACTCCCTATGCTGGTTCC
GTGTTTGCAATTCATAACTTGGGAGTTCATGGGATTCTTGCAAATACCTT
TTTTGTTAATAAAGAGACGAATCAT-------------------------
--------------------------------------------------
---------------
>C5
---ATGACGACGCAGGCATGCAAA------------AATGTGAAAGTTGA
AAAAGTGACAGATACTTACGGCCTTTCCGAAGGTCCTCATTGGGACCATC
ATACTCAAAAGTTGTATTTTGTTGATATATACAATCAGTATATACGCAGG
CTAGATCCCGCAACAGGTGTTGTGACCAGTGCATACATAGATCATGGAAC
TGTAGGAGTTGTTGTACCTGTGGATGACACTGTTGACAAACTTATAGCAG
GTTCAGAAAGAGATGTTATTCTCATTACGTGGGATGGAGACAGCAATAAA
TCTAAGGTACCAGTCGAAGTGTTGTGTTCACTCGACTCTCCTCAGTCTGA
AACAAGAATTAATGATGGAAAAGTGGACTCAGCAGGAAGATTTTGGCTTG
GTACTATGGCAAATGAAGTTAATGGAGTGGTAGCT---CCCAATCAAGGA
ACGTTATATCGTGTTGATAATGATTTTAAGCCTAATAAAGAAATATCGCC
TGTTTCAATAAGTAATGGATTGGCATGGAACATTGAAGACAATATTATGT
ATTATATTGATTCAGTTACTCGTCAAGTTGCAGCATATGATTACAATCCG
AATAATGGAACAATATCTAATAAGAGAATTGTATTTGATCTCAATAAGAC
TGATTTGAAAGGATTACCCGATGGAATGACTATAGATGCAAATGGCAATC
TTTGGATAGCATTATTTGGTGGATCTCGTGTTATTCACGTGGACCCGAAA
ACAGGAAAAGTATTATGCAAAGTTGAGCTTCCGGTTGAAAACGTAACCAG
TGTCACATTCGGCGGTCCGCTTCTGGATACTTTGTACGTGACCACATCTG
GCTACAATATAACTGTAGAGCAACGAAAAGCATCTCCTCACGCTGGTGCT
TTATTCGCGGTGACAGGCCTAGGAGTTCATGGAGTTCTTGCAAATTCATT
TATGATGGTGAAT-------------------------------------
--------------------------------------------------
---------------
>C6
---ATG------------------------------AATATTACAATT--
-------------------------------------------------T
ATTCATCTATATTTTACATAGGCAAGTTGTTGGCAAATCACATA------
CTAGACCCTGCAACAAATGCTGTAACTAGTGCATACATAAAAAGTGGTAC
TGTTGGTGTTGTTGTACCTGTGGACGATTCTACTGATCAATTTGCAGCAG
GTGTTGGAAGAGATCTTATATTGGTTACATGGGATGATGAGCAGAATGAG
ACGAATGTACCAACTGAAGTACTATGTTCTGTTGATGTGGGAAATACTCA
AACAAGAATCAATGATGGAAAGGTTGACTCCTCAGGAAGATTTTGGCTAG
GAACTATGGGTGAAAATGGCAAAGGAAATTCAATT---CCTAATATAGGA
TCATTTTATCGCATTGATGATGACTTGAAGCCCAAAAAAGAAATATCTCC
TGTTTCAATAAGCAATGGATTAGCATGGAATATCGAAGATGATACTTTCT
ATTATATTGATTCACCTGAACGTAATGTTGTGGCGTATGATTATAATCCA
ATTAATGGAACAATATCTAATAAGAGGATTGTGTTCAACTTGAACAATAC
TAATTTAACTGGAGTGCCTGATGGAATGACCATAGATACAGATGATAATC
TTTGGATAGCACTATTTGGTGGAAGTCATGTTATCAAAGTAAATCCGAGA
ACAGGAGAATTATTGTGTCAAATCAAGATTCCAGCTGAAAATGTAACTAG
TGTTACATTTGGAGGCCCGCTTCTTGACATTCTTTATGTGACCACCTCAG
GCAAGGATTTAACTGCAGAACAACGAAAGGCGACTCCTCATGCGGGTGCT
GTATTTGCTGTAAAAGGCTTAGGAGTTCGCGGAAGTATCGCGAATATGTT
TCGGATGAAA----------------------------------------
--------------------------------------------------
---------------
>C7
---ATGACAACGGAAGCT------------------CATGTGACAGTAAA
GGAAGTGACAGAACCTTATGGCCTTTCCGAAGGTCCTCACTGGGACCATC
GAACTCAAAAGTTATACTTTGTCGATATATATAACCAGTACATACGTAGA
CTGGACACTGCAACCGGTGTTGTAACCAGTGCCTATGTAGAACATGGCCC
TGTTGGAGTTGTTGTACCTGCAGAAGATACGAGTGATAAACTCGTAGCAG
GTTCTGGAAAAGATCTCGTTCTTGTCACCTGGGACGGAGATGAGGATAAG
GAGAAAGTTCCAGTCAAAGTACTGTCTTCTATCGAACCTTCTTCTAGCGA
TACAAGAATCAATGATGGAAAAGTAGATTCATCTGGAAGATTTTGGATTG
GTACTATGGCGAATGAAGTTAATGGAGAGATAGCT---TCTGATAAGGGA
TCATTATATCGCATTGATGATACGCTTAAACCTGTAAAGGAAGTAACTCC
TGTTTCAATAAGTAACGGATTAGCATGGAATATCGAGGACAATACTTTCT
ATTACATTGATTCACCTACACGTCAGATTGCAGCATATGATTATGATCCG
AATAATGGGACAATATCTAATAAGAGGATTGTATTTGACCTGAGTAAAAC
TAATGTGAAAGGAGTACCAGATGGAATGACCATAGATACAAATGGCAATC
TTTGGGTAGCAGTATATGGAGGACATCATGTCCTCCATGTGAATCCAAAA
ACACAACAACTGTTGAAAAAAGTTAAGATTCCAGCTGGAGGTGTAACCAG
TGTCGCCTTTGGTGGTCCACTTCTTGATATTCTGTATGTGACTACCTCGG
GCTATGGTTTAACTGCAAAAGAGCAAAAAGAGACTCCCCATGCTGGCTCC
GTATTCGCAGTGAAGGGCTTGGGAGTTCGTGGAATTCTTGCAAATTCGTT
TATGATGAACGGACTAAAGCAAACAGATGAGGAAAAGACAGATGTG----
--------------------------------------------------
---------------
>C8
---ATGGCAACTCAAGCT------------------GATGTAACAGTAGA
GAAGGTGACGGATTCTTACGGCCTCTCCGAGGGTCCTCATTGGAACCATC
GTACTCAAAAGTTATACTTTGTTGATATCTACAATCAGTACATACGTAGA
CTAGACACCGCAACAGGCGTAGTGACCAGTGCGTACATAGAGCACGGTCC
TGTCGGAGTGGTTGTACCTGTGGATGACACAACCGATGCATTCGTAGCGG
GCTCTGGAAGAGATCTTATTCTCGTCACGTGGGACAGTGATAGGGATGAC
TCAAACGCTACAACCGAGGTACTGTGTCCCGTGGACACTACTCATACTCA
AACGAGGATTAACGACGGAAAAGTTGATTCATTTGGAAGATTTTGGCTGG
GCACCATGGCTAATGAGGTGAATGGACAGATACTT---CCTAATCAAGGT
TCGTTATACTGCATAGACGACGAGCTGAAACCTAAGGTGGAAGTATCGCC
CGTTTCGATAAGTAACGGATTAGGGTGGAACATCGAGGATGACACCTTTT
ATTATATCGATTCACCTACACGTCAGATCGCGGCGTACAATTACGATCCG
AATGAAGGAACAATATCTAACAGGAGAATTGTATTCGATTTGAACAAAAC
CGATTTGCAAGGAGTGCCCGATGGAATGACCATAGATACAGATGGGAATT
TATGGATAGCACTATACGGTGGAAAGCACGTCATCCATGTGAATCCGAAA
ACAGGAAAAATGCTAGGTAAAGTTGAGCTCCCGGCCGACAATGTAACCAG
TGTCACATTCGGTGGTCCGCTTCTCGATATTCTATATGCCACAACCTCCA
GCAATGGTTTAACCGCTGAGCAGCGGGAAGCGACTCCCCAAGCTGGTGCA
GTTTTCGCGATAAAAGGTTTGGGAGTTCGTGGAATTCTTGCAAATTCCTT
CGTGATGAACGGCTTAAAGCAGACTATGAATAAC----------------
--------------------------------------------------
---------------
>C9
ATGATGGCAACGCAAGAA------------------AATGTAGAAGTCGA
AAGGGTGACAGACGTTTATGGCCTTTCCGAAGGACCTCATTGGGACCACC
GTACTCAAAAATTGTATTTCGTTGATGTATACAATCAATACATTCGCAGA
TTAGATCCTGCGACAGGTGTTGTGACTAGTGCACGCATAAATGAAGGCAC
TGTTGGAGTCGTAATACCTGTGGAGGATACTATTGATCAACTGATAGCAG
GTGTGGGGAAAGATGTTGTTCTTGTTACATGGGACGGAGACGAAGATGAA
TCGGAAGTACCAGTCAAAGTGTTGTGCTCCCTTGATTCCGAGCAGGCGCA
AACAAGAACCAATGATGGAAAGGTTGATTCATCCGGAAGACTTTGGATCG
GTACTATGGGTATAGAAACCAAGGGAATGGTTCTT---CCTAATCAGGGA
ACGTTATATCGCGTTGATGACGATCTTAAACCTGAAAAAGAAGAATCACC
CGTTTCAATAAGTAATGGATTAGCGTGGAATATGGAAGATAATACCTTTT
ATTATATTGACTCACCCACGCGACAAGTCGCAGCGTACGATTATCAACCG
TATAATGGGATGATTTGTAACAAGAGGATTGTATTTGACCTTAACACAAC
AAACTTCCAAGGAGTACCTGACGGAATGACTATAGATGCAGATGGTAATC
TTTGGATAGCACTATTTGGTGGACATCATGTCATCCAGGTGGATCCGAAA
ACAGGAAAAGTTTTAAGTAAAGTTAAGCTTCCAGCTGAAAACGTATCCAG
TGTTACATTCGGCGGTTCGCTCCTTGACATCCTATACGTAACTACATCGG
GCCACAATCTAAGTTCAGAACAACGAAAAGCGACTCCTTATGCCGGTGCG
GTATTTGCGGTGAAAGGCTTAGGAGTTCGCGGAATTCTCGCAAATTCATT
TGTGATG---GAC-------------------------------------
--------------------------------------------------
---------------
>C10
---ATGACGACA------------------------AACGTGCAAGTGAA
GAGAGTGACGGAGCCTTACGGTCTCTCCGAAGGGCCTCACTGGGATCATC
GTACTCAAAAGTTGTACTTCGTCGATATCTACAACCAGTACATACGTAGA
CTAGACGTTGCGACAGGTGTTGTGACAAGTACATACATAAATCATGGCCC
CGTTTCAGTTGTAGTGCCTGTGGATGATTCAACAGACGAATTTGTAGCTG
GTTCCGGAAGAGATGTTATTCTTGTTACTTGGAACGGAACGGAAAATCTG
TCAAATACAAAACCCAAGGTGTTAACTACTGTGGATCTTACCCACACCAA
TACAAGAACCAATGATGGAAAGGCCGATTCGTCCGGAAGACTTTGGATCG
GCACTATGGGTGACGAAATTGATGGACAACCGTCGCCGCCAAACCTAGGA
TTATTATCCCGCATTGACGATGAGATGAAACACGTGGTAGAGATAAGTCC
TGTTTCCATTAGTAATGGATTGGCGTGGAATATCCAGGACGACACTTTCT
ATTACATTGATTCGCCCACGCGTGTAATCGCGGCGTATGACTACGATCCG
ATTAACGGGAAAATCAGTAACAGAAGAGTTGTATTTGATTTGAACGACAC
TGACCTCAGCGGAGTACCTGATGGAATGACCATAGATACAGATGGCAATC
TCTGGATAGCGCTGTTCGGTGGACATCATATTATCAATGTAAATCCCAAA
ACGAAACAACTGCTGCGCAAAATTAAGCTCCCAGCTGAAAATGTGACCAG
TGCTGCATTTGGTGGTCCGCTTCTCGATATTTTGTACGTGACTACATCGG
GTCATGGTTTAACCGCGGAACAGCGAAAAGAGACACCTTACGCTGGCTCC
GTATTCGCGATAGAAGGCTTGGGTGTTCACGGACTCATTGCAAACTCGTT
CAAGATAAGTGATTTGAAACAAAAG-------------------------
--------------------------------------------------
---------------
>C11
---ATGGCGACGCAAGAATGCGAA------AGAGGAAAAGTAAGAATCGA
GAAGGTGACAAATGCTTATGGCCTCTCCGAGGGACCTCACTGGGATCACC
GCACTCAAAAATTGTATTTTGTTGACATAAATAATCAGTATATACGCAGG
CTAGATCCGGCAACAGGTGTTGTGACCAGCGTGTACATAGATCACGGGCC
TGTAGGAGTTGTTGTACCTGTGGACGATACAACTGACCAACTGGTAGCAG
GTTCGGGAAAAGATATTATTCTTGTTACGTGGGATGGAGACAGTGATGAT
TCGCAGGTACCGATCAAAGTGTTGTGTTCAGTTGACTTTGCACAGGCTCA
AACGAGAATCAATGATGGAAAGGTGGATTCAGCTGGAAGATTTTGGCTCG
GTACTATGGGTCAGGAAGTCAATGGAGTGGCAGCT---TCCAATCAAGGA
ACATTATATCGCGTCAATGAGGATCTTCACCCTGAGAAGGAGATCTCACC
TGTTTCAATAAGCAATGGATTGGCATGGAATATTGAAGATGACACCTTCT
ATTATATTGACTCGCCTACTCGTCAGGTTGCAGCGTACGATTACAATCCA
AATAATGGAACAATATGTAACAGGAGGATTGTATTTGACCTTAATAACAC
TGATCTCCAAGGAGTGCCCGATGGAATGACCATAGATGCGGATGGTAATC
TCTGGATAGCACTATTTGGAGGACATCATGTAATTCATGTAGATCCTAAA
ACAGGACAAGTATTACGCAAAGTTAAGATACCGGCTGAAAATGTAACCAG
CGTTGCGTTTGGCGGTCCGCTACTAGACATTTTGTACGTGACTACATCGG
GTTTTAATTTAACTGCAGAACAACGAAAAGCGACTCCTCACGCTGGTGCT
GTATTCGCAGTGAAAGGTTTAAAAGTTCGTGGAATTCTCGCAAATTCGTT
TGTGATGATGGAT-------------------------------------
--------------------------------------------------
---------------
>C12
---------ATGCAGGCGCGTGAA------------AATGTGAAAGTCGA
AAAAGTGACAGATGCTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
GTACTCAAAAGTTGTATTTTGTTGACATATATAATCAGTATATACGCAGA
CTAGATCCCGCAACAGGTGTTGTGACCAGTGCATACATAGATCATGGGAC
TATAGGAGTTGCTGTACCTTTGGATGACAGTGTTGACCAACTTATAGCAG
GTTCAGGAAAAGATGTTATTCGTGTTACATGGGACGGAGACAGCAATAAA
TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTCAGGCTCA
AACGAGAATTAATGATGGAAAAGTGGACTCGGCTGGAAGATTTTGGCTCG
GTACTATGGGTAACGAAGTAAATGGAAAGATAGCT---CCCAATTTAGGG
ACATTATATCGCGTTGATGATGATTTTGAGCCAAAAAAGGAAATATCACC
TGTTACAATAAGTAACGGATTGGCATGGAATATAGAAGATGACACTTTGT
ATTATATTGATTCACCTACTCGTCAGGTTGCAGCGTATGATTACAATCCG
ACTAATGGGACAATATCTAATAAGAGGATTGTATTCGATCTCAATAAGAC
TAATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
TTTGGATAGCATTATTTGGTGGATCTCGAGTTATTTGCGTAGATCCGAAA
ACAGGAAATGTATTATCCAAAGTTGAGCTTCCAGCTGAAAACGTAACCAG
TGTCGCATTCGGCGGTCCGCTTCTAGATACTTTGTATGTGACCACATCTG
GTTACAATATAAGTGCAGAGCAACGACAAGCAACTCCTCACGCTGGTGCT
ATATTCGCGGTGACAGGCCTAGAAGTTCGTGGAGTTCTTGCAAATTCATT
TATAATGATAGAT-------------------------------------
--------------------------------------------------
---------------
>C13
---ATGACGACGCAGGCGAGTAAA------------AATATAAAAGTCGA
AAAAGTGACAGATATTTACGGCCTTTCCGAAGGCCCTCATTGGGATCATC
GTACTCAAAAGTTGTATTTTGTTGACATATACAATCAGTATATACGCAGG
CTAGATCCCGCAACAGGTGTTGTGACCAGCGCATACATAGATCATGGGAC
TGTAGGAGTTGTTGTACCTGTGGATGACAGTGTTGACCAACTTATAGCAG
GTTCAGGAAAAGATATTATTCTTGTTACATGGGACGGAGACAGCAATAAA
TCTAAGGTACCAGTCAAAGTGTTGTGTTCGGTCGATTCTCCTCAGGCTCA
AACGAGAATTAATGATGGAAAAGTAGACTCGGCTGGAAGATTTTGGCTCG
GTACTATGGGTAACGAAGTCAATGGAAAGATAGCT---CCCAATTTAGGA
ACATTATATCACGTTGATGATGCTCTTGAGCCAAAAAAGGAAATATCACC
TGTTTCAATAAGTAATGGATTGGCATGGAATATAGAAGACAACACTTTCT
ATTATATTGACTCACCTACTTATCAGGTTGCAGCGTATGATTACAATCCG
AATAATGGGACAATATCTAATAAGAGGATTGTATTTGATCTCAATAAGAC
TGATTTGAAAGGATTACCTGATGGAATGACTATAGATACAGATGGCAATC
TTTGGATAGCATTATTTGGTGGATCTCGAGTTATTTGCGTGGATCCGAAA
ACAGAAAAAGTATTATGCAAAGTTGACATTCCAGCTGAAAACGTAACCAG
TGTCACATTCGGCGGTCCACTTCTAGATACTTTGTATGTAACCACATCTG
GTTTCAACATAAGTGCAGAGCAACGACAAGCAACTCCTCACGCTGGTGCT
ATATTCGCGGTGACAGGTTTAGAAGTTCGTGGACTACTTGCAAATTCATT
TATGATGATAAAT-------------------------------------
--------------------------------------------------
---------------
>C14
---ATGACTACG------------------------CAAGTGACCGTCGA
TAAGGTGACAGCTGCTTACGGCCTCTCCGAGGGTCCCCACTGGGACCATC
GTACCCAAAAGTTGTTCTTCGTTGACATACAGAATCAGTACATCCGCCGG
CTAGATATCGCAACGGGTGTTGTGACCAGTGCATACATAGCAAACGGGAC
CGTTGGAGTTGTCATACCAGTGGACGACTCGAATGATGAACTTGTAGCAG
GTGTGGGAAAAGATCTTGTTCTCGTGAAGTGGAACGGAGACGAGGATGAT
TCGGAGCCGAAGGTCAAAATGCTATGCTCGCTCGAGCCTCCTCAGGCTGA
GACAAGGATCAACGATGGCAAGGTGGACTCAACCGGAAGATTTTGGCTCG
GTACTATGGGCATCGAGGTCAATGGAGTGGCGCCT---CCCGATCTAGGA
TCGTTGTACCGCGTTGACGACAATCTTAAACCTGAAAAGGAAATATCGCC
CGTTACGATAAGTAACGGATTGGCGTGGAATAGCAAAGATGACACTTTCT
ATTATATTGACTCACCTACGCGCCAAGTTGCGGCCTATGATTACGATCCG
AATCTCGGGAAAATATCTAACAGGAGGATTGTGTTTGATCTTAACAACAC
TGATCTCAAAGGGGTTCCCGATGGAATGACCATAGATACCGATGGCAATC
TTTGGATAGCACTATTTGGCGGATCTCATGTCATTCAGGTGGATCCAAAA
ACAGGAGCAGTAATGCGCAAAGTTAAGATTCCGGCTGACAATGTAACCAG
CGTCACGTTCGGCGGTCCGCTTCTGGATACTTTGTACGTGACCACGTCGG
GCTATAATTTAACTGCGGAGCAACGAGAACTGACTCCTGACGCGGGTGCG
GTATTCGCGGTGAAAGGCTTAAAAACTCGCGGAACTCTCGCGAATTCGTT
CGTGAAAATGGAT-------------------------------------
--------------------------------------------------
---------------
>C15
---ATGACCACGGAGGCATGTAAA------AGTGATAGAGTGGAAGTTGA
GAAGGTGACAGATGCTTACGGCCTTTCCGAAGGCCCTCACTGGGACCATC
GCACCCAAAAGTTATATTTCGTTGACATATACAATCAGTACATACGCAGG
TTAGATCCTGCAACAGGTGATGTGAAGAGCGTGCACATAGATCACGGGCC
TATTGGAGTTGTTATACCCGTGGATGACACGACTGACCAGTTTGTAGCAG
GTGCGGGAAAAGATGTTGTTCTCGTTACGTGGGACGCGGACGAAGATGAA
TTGGGG---AACGTCACAGTGTTGTGTTCGCTCGACTCTGCTCAGTCTGA
CACAAGGGTCAATGACGGCAAGGTGGACTCGTATGGAAGATTTTGGCTTG
GTACTATGGGTAACGAAGTCAATGGAGTGATAGCT---CCCAATCTAGGA
ACGTTGTATCGCGTTGACGACAAGCTTAAGCCTATGAAGGAAATATCGCC
GGTTTCGATAAGTAACGGATTGGCATGGAATATTGAAGACAACACCTTCT
ACTATATTGACTCACCTACTCGTCAGGTTGCAGCGTATGATTACGATCCG
AATAGTGGAACAATATCTAACAAGAGGATTGTATTCAATCTCAACACTAC
CGATGTGAAAGGAGTACCCGATGGAATGACCATAGATGCAGATGGCAATC
TTTGGATAGCAGTATTTGGTGGACATCACGTCATACACGTGGATCCGAGA
ACAGGAAAGATGTTACGCAAAGTTAAGATCCCAGCTGAAAACGTAACCAG
TGCCATGTTCGGCGGTCCGCTTCTGGATACTTTGTACGTGACCACATCGG
GCCACAATTTAACTGCAAAGCAACGAAATGCGACTCCTCACGCTGGTTCT
GTATTCGCGGTAAAAAACCTAGGAGTTCGTGGAATTCTCTCGAATTCGTT
TGTGAGGATGGAT-------------------------------------
--------------------------------------------------
---------------
>C1
oMTTQASKooooNVKVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDPATGVVTSAYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGESNK
SKVPVKVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGQIAoPNLG
TLYRVDDDLEPKKKISPVTISNGLAWNIEDDTLYYIDSTPRQVAAYDYNP
NNGTISNKRIVFDLNKTNLKGLPDGMTIDTDGNLWIALFGGSRVICVDPK
TEKVLREVEIPTENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGA
IFAVTGLEVHGLLANSFTIMDooooooooooo
>C2
oMTTQARKooooNVKVEKVTDTYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDPATGVVTSTYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGDSNK
SKVSVKVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGETAoPNLG
TLYRVDDDLEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQIAAYDYNP
NNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSQVICVDPK
TEKVLYKVELPAENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGA
VFAVKGLEVRGVLANSFMMIDooooooooooo
>C3
oMTTQARKooooNVKVEKVTDTYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDPATGVVTSSYIDHGTVGVAVPVDDSVDQLIVGSGKDVILVTWDGDSNK
SKVPVKVLCSVDSPEAQTRINDGKVDSAGRFWLGTMGNEVNGEIAoPNLG
TLYRVDDDLEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQIAAYDYNP
NNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSQVICVDPK
TEKVLYKVELPAENVTSVAFGGPLLDTLYVTTSGFNISAEQRQATPYAGA
VFAVKGLEVRGVLANSFMMIDooooooooooo
>C4
oMTTEAHHHLKPKIKIERVTDAYGLSEGPHWDSDAQKLYFVDIYNQYVRR
LDPATGVVTSTYIDHGPVSVVIPVHDSPNKFVVGSGKDVILVNWNSDANQ
KVTPYNVLSNLTSooGDVRTNDGKADSAGRLWIGTMANEINGQIAoLDKG
SLYRLDDTLKPKTEITPVSISNGLAWNIEDNTFYYIDSSTREIAAYDFDP
NSGTISNKRIALNLNHTKLEGLPDGMTIDTDGNLWVALFGGHGLIKVDPH
KHKVLEKIELPARDVSSVAFGGPLLDILYVTTSGHGLTAEERKKTPYAGS
VFAIHNLGVHGILANTFFVNKETNHooooooo
>C5
oMTTQACKooooNVKVEKVTDTYGLSEGPHWDHHTQKLYFVDIYNQYIRR
LDPATGVVTSAYIDHGTVGVVVPVDDTVDKLIAGSERDVILITWDGDSNK
SKVPVEVLCSLDSPQSETRINDGKVDSAGRFWLGTMANEVNGVVAoPNQG
TLYRVDNDFKPNKEISPVSISNGLAWNIEDNIMYYIDSVTRQVAAYDYNP
NNGTISNKRIVFDLNKTDLKGLPDGMTIDANGNLWIALFGGSRVIHVDPK
TGKVLCKVELPVENVTSVTFGGPLLDTLYVTTSGYNITVEQRKASPHAGA
LFAVTGLGVHGVLANSFMMVNooooooooooo
>C6
oMooooooooooNITIoooooooooooooooooYSSIFYIGKLLANHIoo
LDPATNAVTSAYIKSGTVGVVVPVDDSTDQFAAGVGRDLILVTWDDEQNE
TNVPTEVLCSVDVGNTQTRINDGKVDSSGRFWLGTMGENGKGNSIoPNIG
SFYRIDDDLKPKKEISPVSISNGLAWNIEDDTFYYIDSPERNVVAYDYNP
INGTISNKRIVFNLNNTNLTGVPDGMTIDTDDNLWIALFGGSHVIKVNPR
TGELLCQIKIPAENVTSVTFGGPLLDILYVTTSGKDLTAEQRKATPHAGA
VFAVKGLGVRGSIANMFRMKoooooooooooo
>C7
oMTTEAooooooHVTVKEVTEPYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDTATGVVTSAYVEHGPVGVVVPAEDTSDKLVAGSGKDLVLVTWDGDEDK
EKVPVKVLSSIEPSSSDTRINDGKVDSSGRFWIGTMANEVNGEIAoSDKG
SLYRIDDTLKPVKEVTPVSISNGLAWNIEDNTFYYIDSPTRQIAAYDYDP
NNGTISNKRIVFDLSKTNVKGVPDGMTIDTNGNLWVAVYGGHHVLHVNPK
TQQLLKKVKIPAGGVTSVAFGGPLLDILYVTTSGYGLTAKEQKETPHAGS
VFAVKGLGVRGILANSFMMNGLKQTDEEKTDV
>C8
oMATQAooooooDVTVEKVTDSYGLSEGPHWNHRTQKLYFVDIYNQYIRR
LDTATGVVTSAYIEHGPVGVVVPVDDTTDAFVAGSGRDLILVTWDSDRDD
SNATTEVLCPVDTTHTQTRINDGKVDSFGRFWLGTMANEVNGQILoPNQG
SLYCIDDELKPKVEVSPVSISNGLGWNIEDDTFYYIDSPTRQIAAYNYDP
NEGTISNRRIVFDLNKTDLQGVPDGMTIDTDGNLWIALYGGKHVIHVNPK
TGKMLGKVELPADNVTSVTFGGPLLDILYATTSSNGLTAEQREATPQAGA
VFAIKGLGVRGILANSFVMNGLKQTMNNoooo
>C9
MMATQEooooooNVEVERVTDVYGLSEGPHWDHRTQKLYFVDVYNQYIRR
LDPATGVVTSARINEGTVGVVIPVEDTIDQLIAGVGKDVVLVTWDGDEDE
SEVPVKVLCSLDSEQAQTRTNDGKVDSSGRLWIGTMGIETKGMVLoPNQG
TLYRVDDDLKPEKEESPVSISNGLAWNMEDNTFYYIDSPTRQVAAYDYQP
YNGMICNKRIVFDLNTTNFQGVPDGMTIDADGNLWIALFGGHHVIQVDPK
TGKVLSKVKLPAENVSSVTFGGSLLDILYVTTSGHNLSSEQRKATPYAGA
VFAVKGLGVRGILANSFVMoDooooooooooo
>C10
oMTTooooooooNVQVKRVTEPYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDVATGVVTSTYINHGPVSVVVPVDDSTDEFVAGSGRDVILVTWNGTENL
SNTKPKVLTTVDLTHTNTRTNDGKADSSGRLWIGTMGDEIDGQPSPPNLG
LLSRIDDEMKHVVEISPVSISNGLAWNIQDDTFYYIDSPTRVIAAYDYDP
INGKISNRRVVFDLNDTDLSGVPDGMTIDTDGNLWIALFGGHHIINVNPK
TKQLLRKIKLPAENVTSAAFGGPLLDILYVTTSGHGLTAEQRKETPYAGS
VFAIEGLGVHGLIANSFKISDLKQKooooooo
>C11
oMATQECEooRGKVRIEKVTNAYGLSEGPHWDHRTQKLYFVDINNQYIRR
LDPATGVVTSVYIDHGPVGVVVPVDDTTDQLVAGSGKDIILVTWDGDSDD
SQVPIKVLCSVDFAQAQTRINDGKVDSAGRFWLGTMGQEVNGVAAoSNQG
TLYRVNEDLHPEKEISPVSISNGLAWNIEDDTFYYIDSPTRQVAAYDYNP
NNGTICNRRIVFDLNNTDLQGVPDGMTIDADGNLWIALFGGHHVIHVDPK
TGQVLRKVKIPAENVTSVAFGGPLLDILYVTTSGFNLTAEQRKATPHAGA
VFAVKGLKVRGILANSFVMMDooooooooooo
>C12
oooMQAREooooNVKVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDPATGVVTSAYIDHGTIGVAVPLDDSVDQLIAGSGKDVIRVTWDGDSNK
SKVPVKVLCSVDSPQAQTRINDGKVDSAGRFWLGTMGNEVNGKIAoPNLG
TLYRVDDDFEPKKEISPVTISNGLAWNIEDDTLYYIDSPTRQVAAYDYNP
TNGTISNKRIVFDLNKTNLKGLPDGMTIDTDGNLWIALFGGSRVICVDPK
TGNVLSKVELPAENVTSVAFGGPLLDTLYVTTSGYNISAEQRQATPHAGA
IFAVTGLEVRGVLANSFIMIDooooooooooo
>C13
oMTTQASKooooNIKVEKVTDIYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDPATGVVTSAYIDHGTVGVVVPVDDSVDQLIAGSGKDIILVTWDGDSNK
SKVPVKVLCSVDSPQAQTRINDGKVDSAGRFWLGTMGNEVNGKIAoPNLG
TLYHVDDALEPKKEISPVSISNGLAWNIEDNTFYYIDSPTYQVAAYDYNP
NNGTISNKRIVFDLNKTDLKGLPDGMTIDTDGNLWIALFGGSRVICVDPK
TEKVLCKVDIPAENVTSVTFGGPLLDTLYVTTSGFNISAEQRQATPHAGA
IFAVTGLEVRGLLANSFMMINooooooooooo
>C14
oMTTooooooooQVTVDKVTAAYGLSEGPHWDHRTQKLFFVDIQNQYIRR
LDIATGVVTSAYIANGTVGVVIPVDDSNDELVAGVGKDLVLVKWNGDEDD
SEPKVKMLCSLEPPQAETRINDGKVDSTGRFWLGTMGIEVNGVAPoPDLG
SLYRVDDNLKPEKEISPVTISNGLAWNSKDDTFYYIDSPTRQVAAYDYDP
NLGKISNRRIVFDLNNTDLKGVPDGMTIDTDGNLWIALFGGSHVIQVDPK
TGAVMRKVKIPADNVTSVTFGGPLLDTLYVTTSGYNLTAEQRELTPDAGA
VFAVKGLKTRGTLANSFVKMDooooooooooo
>C15
oMTTEACKooSDRVEVEKVTDAYGLSEGPHWDHRTQKLYFVDIYNQYIRR
LDPATGDVKSVHIDHGPIGVVIPVDDTTDQFVAGAGKDVVLVTWDADEDE
LGoNVTVLCSLDSAQSDTRVNDGKVDSYGRFWLGTMGNEVNGVIAoPNLG
TLYRVDDKLKPMKEISPVSISNGLAWNIEDNTFYYIDSPTRQVAAYDYDP
NSGTISNKRIVFNLNTTDVKGVPDGMTIDADGNLWIAVFGGHHVIHVDPR
TGKMLRKVKIPAENVTSAMFGGPLLDTLYVTTSGHNLTAKQRNATPHAGS
VFAVKNLGVRGILSNSFVRMDooooooooooo


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 15 taxa and 1065 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon  1 -> C1
      Taxon  2 -> C2
      Taxon  3 -> C3
      Taxon  4 -> C4
      Taxon  5 -> C5
      Taxon  6 -> C6
      Taxon  7 -> C7
      Taxon  8 -> C8
      Taxon  9 -> C9
      Taxon 10 -> C10
      Taxon 11 -> C11
      Taxon 12 -> C12
      Taxon 13 -> C13
      Taxon 14 -> C14
      Taxon 15 -> C15
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1562189796
      Setting output file names to "/data/results/formicoidea_gene1/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1735527816
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 2410964564
      Seed = 59495890
      Swapseed = 1562189796
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 189 unique site patterns
      Division 2 has 142 unique site patterns
      Division 3 has 288 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -9663.864370 -- -26.563281
         Chain 2 -- -9798.107645 -- -26.563281
         Chain 3 -- -9669.493811 -- -26.563281
         Chain 4 -- -9534.225770 -- -26.563281

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -9518.700117 -- -26.563281
         Chain 2 -- -9495.581492 -- -26.563281
         Chain 3 -- -9969.078583 -- -26.563281
         Chain 4 -- -9665.349012 -- -26.563281


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-9663.864] (-9798.108) (-9669.494) (-9534.226) * [-9518.700] (-9495.581) (-9969.079) (-9665.349) 
        500 -- (-7725.194) [-7658.005] (-7831.767) (-7768.715) * (-7813.227) (-7768.772) (-7716.649) [-7619.766] -- 0:33:19
       1000 -- (-7545.583) [-7524.210] (-7620.403) (-7656.407) * (-7638.938) (-7529.900) (-7497.394) [-7436.511] -- 0:33:18
       1500 -- (-7468.170) [-7416.783] (-7562.816) (-7586.984) * (-7534.486) (-7401.877) (-7471.490) [-7347.901] -- 0:33:17
       2000 -- (-7408.458) [-7360.797] (-7491.236) (-7527.424) * (-7494.895) (-7352.480) (-7440.256) [-7329.517] -- 0:24:57
       2500 -- (-7391.403) [-7351.219] (-7421.287) (-7468.200) * (-7429.084) (-7342.903) (-7375.866) [-7323.405] -- 0:26:36
       3000 -- [-7363.642] (-7336.069) (-7387.793) (-7473.054) * (-7361.691) (-7345.290) (-7348.389) [-7314.515] -- 0:27:41
       3500 -- [-7331.516] (-7345.138) (-7383.592) (-7435.531) * (-7340.032) (-7343.528) (-7348.529) [-7327.190] -- 0:23:43
       4000 -- (-7334.005) [-7328.993] (-7364.049) (-7396.340) * [-7325.654] (-7341.843) (-7366.199) (-7326.291) -- 0:24:54
       4500 -- (-7325.460) [-7325.042] (-7346.240) (-7356.648) * [-7324.504] (-7335.029) (-7348.351) (-7328.034) -- 0:25:48
       5000 -- (-7329.753) (-7332.582) [-7347.652] (-7336.030) * (-7324.067) [-7330.694] (-7338.786) (-7324.918) -- 0:26:32

      Average standard deviation of split frequencies: 0.086424

       5500 -- (-7322.576) (-7337.012) [-7334.207] (-7347.768) * (-7335.594) (-7331.234) (-7331.547) [-7322.708] -- 0:24:06
       6000 -- [-7323.500] (-7334.236) (-7330.068) (-7326.253) * [-7328.460] (-7330.050) (-7319.939) (-7326.157) -- 0:24:51
       6500 -- (-7318.120) (-7330.354) [-7326.333] (-7324.724) * (-7322.199) (-7326.365) (-7329.659) [-7322.456] -- 0:25:28
       7000 -- (-7317.443) (-7337.330) (-7339.246) [-7329.326] * [-7323.590] (-7326.605) (-7330.142) (-7326.162) -- 0:26:00
       7500 -- (-7338.612) (-7316.708) [-7322.270] (-7317.411) * (-7331.070) (-7326.835) (-7337.620) [-7320.243] -- 0:24:15
       8000 -- (-7336.110) (-7337.557) [-7326.599] (-7325.350) * (-7322.682) (-7322.892) (-7324.018) [-7322.165] -- 0:24:48
       8500 -- (-7336.768) (-7328.457) [-7323.981] (-7327.558) * (-7323.253) (-7315.189) [-7316.942] (-7327.772) -- 0:25:16
       9000 -- (-7338.101) (-7327.278) [-7320.711] (-7332.514) * (-7330.914) (-7316.896) (-7322.286) [-7319.908] -- 0:23:51
       9500 -- (-7338.727) (-7327.225) (-7329.345) [-7327.985] * [-7320.807] (-7324.395) (-7321.364) (-7322.636) -- 0:24:19
      10000 -- (-7325.616) [-7323.972] (-7326.181) (-7326.850) * [-7322.135] (-7325.773) (-7324.116) (-7320.724) -- 0:24:45

      Average standard deviation of split frequencies: 0.041595

      10500 -- (-7324.669) [-7322.246] (-7320.268) (-7334.026) * (-7330.907) (-7324.481) [-7322.864] (-7321.528) -- 0:25:07
      11000 -- (-7331.066) (-7325.532) (-7330.646) [-7321.990] * (-7327.612) (-7327.945) [-7329.655] (-7332.739) -- 0:23:58
      11500 -- (-7321.664) [-7326.978] (-7329.659) (-7325.273) * [-7319.221] (-7326.334) (-7320.485) (-7320.985) -- 0:24:21
      12000 -- [-7325.881] (-7333.866) (-7326.686) (-7321.057) * (-7329.718) (-7327.159) (-7329.211) [-7319.482] -- 0:24:42
      12500 -- (-7328.142) [-7324.397] (-7330.232) (-7322.614) * (-7330.503) [-7328.917] (-7328.608) (-7325.234) -- 0:25:01
      13000 -- (-7330.718) (-7326.368) (-7331.658) [-7322.970] * (-7333.010) (-7322.104) (-7330.761) [-7317.302] -- 0:24:02
      13500 -- (-7320.540) [-7318.709] (-7333.423) (-7334.638) * (-7326.564) [-7322.133] (-7330.177) (-7316.855) -- 0:24:21
      14000 -- [-7334.159] (-7321.630) (-7322.723) (-7319.353) * [-7330.186] (-7326.956) (-7327.593) (-7317.629) -- 0:24:39
      14500 -- (-7327.724) [-7321.335] (-7333.542) (-7330.879) * (-7323.686) [-7324.191] (-7328.470) (-7322.158) -- 0:24:55
      15000 -- [-7326.897] (-7323.427) (-7322.706) (-7319.590) * (-7328.284) [-7325.439] (-7338.202) (-7319.936) -- 0:24:04

      Average standard deviation of split frequencies: 0.020797

      15500 -- [-7321.738] (-7332.680) (-7323.837) (-7331.093) * (-7320.321) [-7324.663] (-7330.251) (-7318.255) -- 0:24:20
      16000 -- [-7316.947] (-7326.220) (-7325.309) (-7320.897) * (-7328.412) [-7315.255] (-7342.653) (-7326.237) -- 0:24:36
      16500 -- [-7316.037] (-7330.190) (-7341.517) (-7321.854) * (-7316.613) (-7321.737) [-7319.687] (-7326.564) -- 0:23:50
      17000 -- (-7327.584) [-7326.125] (-7333.506) (-7320.458) * (-7331.135) (-7319.583) (-7329.433) [-7327.590] -- 0:24:05
      17500 -- (-7323.820) (-7329.200) (-7337.098) [-7320.523] * (-7333.620) (-7325.712) [-7322.821] (-7330.621) -- 0:24:19
      18000 -- (-7319.156) (-7326.535) (-7337.513) [-7318.055] * (-7328.735) (-7321.609) [-7322.368] (-7333.866) -- 0:24:33
      18500 -- (-7327.000) (-7337.834) [-7323.383] (-7327.168) * [-7317.855] (-7324.715) (-7324.433) (-7330.386) -- 0:23:52
      19000 -- (-7336.171) (-7331.771) (-7319.165) [-7328.289] * (-7320.512) (-7332.257) (-7318.925) [-7326.670] -- 0:24:05
      19500 -- (-7328.473) (-7320.669) (-7329.061) [-7320.651] * (-7319.218) (-7328.081) (-7317.954) [-7327.453] -- 0:24:18
      20000 -- (-7319.830) [-7324.142] (-7329.086) (-7324.588) * [-7327.157] (-7327.196) (-7324.760) (-7330.252) -- 0:24:30

      Average standard deviation of split frequencies: 0.049221

      20500 -- [-7316.756] (-7326.465) (-7323.894) (-7321.906) * (-7325.669) (-7326.819) [-7324.477] (-7334.249) -- 0:23:53
      21000 -- (-7321.521) (-7327.238) (-7330.994) [-7324.636] * (-7332.041) [-7327.315] (-7328.239) (-7329.033) -- 0:24:05
      21500 -- [-7317.972] (-7335.966) (-7316.920) (-7334.719) * (-7331.336) (-7328.035) [-7322.913] (-7334.053) -- 0:24:16
      22000 -- (-7324.076) (-7327.085) [-7317.812] (-7333.387) * (-7325.962) (-7329.224) [-7329.406] (-7318.234) -- 0:24:27
      22500 -- (-7325.662) (-7323.277) (-7327.181) [-7328.816] * (-7322.693) (-7334.510) [-7326.350] (-7324.352) -- 0:23:53
      23000 -- (-7330.400) (-7323.166) (-7322.219) [-7324.490] * (-7327.895) [-7318.408] (-7330.780) (-7332.249) -- 0:24:04
      23500 -- (-7324.561) [-7324.534] (-7327.986) (-7332.838) * (-7323.723) (-7325.625) (-7328.952) [-7317.831] -- 0:24:14
      24000 -- (-7325.222) (-7319.730) [-7323.917] (-7331.933) * (-7324.966) [-7330.137] (-7332.526) (-7325.327) -- 0:24:24
      24500 -- (-7322.171) [-7320.942] (-7325.385) (-7339.599) * (-7320.128) (-7335.082) [-7326.627] (-7321.638) -- 0:23:53
      25000 -- (-7318.821) (-7319.041) [-7322.685] (-7326.533) * (-7321.816) (-7321.574) [-7324.590] (-7326.256) -- 0:24:03

      Average standard deviation of split frequencies: 0.048954

      25500 -- (-7326.820) [-7315.600] (-7324.209) (-7319.427) * (-7337.168) (-7333.382) [-7315.965] (-7320.593) -- 0:24:12
      26000 -- (-7320.707) [-7319.604] (-7325.501) (-7322.640) * (-7320.745) (-7337.303) [-7332.599] (-7329.375) -- 0:23:43
      26500 -- (-7320.241) (-7324.668) (-7326.671) [-7332.018] * (-7328.633) (-7325.120) [-7316.977] (-7331.233) -- 0:23:52
      27000 -- (-7322.149) (-7330.005) [-7316.148] (-7325.839) * (-7329.970) (-7323.008) (-7332.368) [-7321.103] -- 0:24:01
      27500 -- (-7331.826) [-7321.470] (-7319.789) (-7323.702) * [-7331.569] (-7321.111) (-7333.476) (-7321.258) -- 0:24:09
      28000 -- [-7322.486] (-7320.814) (-7322.985) (-7331.613) * (-7331.419) [-7327.653] (-7330.737) (-7321.584) -- 0:23:43
      28500 -- (-7336.845) (-7331.006) [-7332.073] (-7329.661) * (-7329.274) (-7332.799) [-7324.321] (-7325.057) -- 0:23:51
      29000 -- (-7332.919) (-7331.722) [-7328.127] (-7322.756) * [-7325.304] (-7328.525) (-7322.470) (-7319.526) -- 0:23:59
      29500 -- (-7321.447) (-7329.990) (-7328.236) [-7325.012] * (-7334.541) (-7323.742) (-7317.704) [-7316.194] -- 0:24:07
      30000 -- (-7321.611) [-7326.958] (-7324.453) (-7333.454) * (-7325.001) (-7329.433) (-7325.135) [-7323.199] -- 0:23:42

      Average standard deviation of split frequencies: 0.043554

      30500 -- (-7327.555) [-7324.806] (-7316.273) (-7332.190) * (-7323.492) (-7333.726) (-7324.082) [-7329.523] -- 0:23:50
      31000 -- (-7337.914) [-7321.769] (-7330.619) (-7329.459) * (-7326.586) [-7331.357] (-7322.358) (-7326.712) -- 0:23:57
      31500 -- (-7321.964) [-7317.810] (-7321.336) (-7324.611) * (-7334.791) [-7324.189] (-7323.810) (-7324.393) -- 0:24:05
      32000 -- (-7320.849) [-7324.243] (-7325.045) (-7326.454) * (-7323.646) (-7330.128) [-7323.519] (-7323.510) -- 0:23:41
      32500 -- [-7322.419] (-7328.396) (-7328.429) (-7327.252) * (-7322.611) [-7320.874] (-7322.691) (-7326.424) -- 0:23:48
      33000 -- [-7325.851] (-7334.470) (-7326.760) (-7333.401) * (-7323.704) (-7330.482) (-7328.895) [-7328.523] -- 0:23:55
      33500 -- (-7326.108) (-7331.029) (-7333.926) [-7324.994] * [-7328.042] (-7333.517) (-7326.555) (-7335.054) -- 0:24:02
      34000 -- (-7322.125) (-7324.255) (-7334.732) [-7321.992] * (-7327.463) (-7339.527) [-7321.473] (-7321.406) -- 0:23:40
      34500 -- [-7332.158] (-7318.323) (-7330.093) (-7331.778) * [-7324.798] (-7330.414) (-7335.174) (-7321.012) -- 0:23:47
      35000 -- [-7320.174] (-7322.023) (-7330.838) (-7328.510) * (-7322.116) [-7324.519] (-7340.590) (-7320.255) -- 0:23:53

      Average standard deviation of split frequencies: 0.040739

      35500 -- (-7327.206) [-7323.577] (-7320.595) (-7324.326) * [-7324.816] (-7321.122) (-7329.147) (-7329.685) -- 0:23:32
      36000 -- (-7331.633) (-7329.646) [-7323.715] (-7317.964) * (-7323.697) [-7319.170] (-7329.486) (-7333.401) -- 0:23:39
      36500 -- [-7325.447] (-7324.740) (-7331.857) (-7325.313) * [-7315.014] (-7329.708) (-7327.793) (-7329.385) -- 0:23:45
      37000 -- (-7327.260) (-7327.405) [-7330.194] (-7326.868) * (-7333.671) (-7322.761) (-7318.674) [-7325.375] -- 0:23:51
      37500 -- (-7332.484) (-7329.140) [-7328.205] (-7337.263) * (-7318.884) (-7329.438) [-7321.171] (-7342.228) -- 0:23:31
      38000 -- (-7331.562) (-7331.736) [-7326.731] (-7326.742) * (-7334.615) (-7321.512) [-7330.464] (-7338.435) -- 0:23:37
      38500 -- (-7335.862) [-7319.458] (-7324.451) (-7325.919) * (-7329.985) (-7318.547) [-7335.296] (-7336.197) -- 0:23:43
      39000 -- (-7324.581) (-7319.434) [-7315.945] (-7330.666) * [-7329.923] (-7327.390) (-7336.486) (-7328.384) -- 0:23:49
      39500 -- [-7329.190] (-7336.150) (-7321.183) (-7327.622) * (-7318.501) [-7327.360] (-7340.396) (-7328.299) -- 0:23:30
      40000 -- (-7333.764) (-7327.818) (-7332.892) [-7322.258] * (-7321.569) (-7316.001) [-7324.897] (-7333.796) -- 0:23:36

      Average standard deviation of split frequencies: 0.038640

      40500 -- (-7319.934) [-7320.899] (-7329.134) (-7328.445) * [-7323.003] (-7334.233) (-7331.998) (-7326.570) -- 0:23:41
      41000 -- (-7321.422) [-7322.567] (-7321.134) (-7329.311) * (-7327.900) (-7332.671) (-7326.110) [-7325.680] -- 0:23:46
      41500 -- (-7318.998) [-7319.454] (-7334.817) (-7334.142) * [-7326.136] (-7336.544) (-7324.170) (-7331.648) -- 0:23:28
      42000 -- (-7331.014) (-7324.568) (-7328.953) [-7329.848] * (-7336.340) (-7326.098) [-7324.821] (-7337.010) -- 0:23:34
      42500 -- (-7324.808) [-7327.664] (-7325.073) (-7333.516) * (-7326.556) (-7319.512) (-7326.843) [-7318.468] -- 0:23:39
      43000 -- (-7324.270) [-7322.682] (-7331.202) (-7340.137) * (-7329.939) (-7326.759) (-7327.492) [-7330.190] -- 0:23:44
      43500 -- (-7327.529) [-7317.756] (-7320.003) (-7335.362) * (-7325.808) (-7323.544) [-7322.130] (-7328.138) -- 0:23:27
      44000 -- (-7333.171) (-7325.500) (-7323.956) [-7326.569] * (-7342.670) (-7325.868) [-7331.217] (-7336.143) -- 0:23:32
      44500 -- (-7323.504) (-7331.644) (-7324.951) [-7319.588] * [-7321.324] (-7329.745) (-7332.617) (-7321.095) -- 0:23:37
      45000 -- (-7331.427) (-7329.748) [-7318.523] (-7326.238) * (-7316.649) [-7325.220] (-7324.686) (-7327.081) -- 0:23:20

      Average standard deviation of split frequencies: 0.032362

      45500 -- (-7326.934) (-7327.794) [-7319.299] (-7333.431) * [-7319.674] (-7330.411) (-7325.478) (-7326.671) -- 0:23:25
      46000 -- [-7317.198] (-7322.728) (-7325.927) (-7328.702) * (-7316.164) (-7328.563) [-7321.555] (-7321.200) -- 0:23:30
      46500 -- (-7331.571) (-7342.892) [-7326.217] (-7328.190) * (-7322.725) (-7339.411) [-7328.066] (-7325.517) -- 0:23:34
      47000 -- [-7324.596] (-7321.095) (-7325.372) (-7336.307) * [-7320.009] (-7341.785) (-7335.895) (-7328.598) -- 0:23:19
      47500 -- [-7327.873] (-7325.378) (-7338.216) (-7326.646) * [-7315.097] (-7326.384) (-7318.314) (-7324.918) -- 0:23:23
      48000 -- (-7329.330) (-7335.644) (-7337.378) [-7327.591] * (-7328.246) (-7336.167) (-7313.208) [-7327.723] -- 0:23:28
      48500 -- (-7324.199) [-7323.036] (-7327.695) (-7320.497) * (-7326.542) [-7326.948] (-7316.850) (-7327.656) -- 0:23:32
      49000 -- (-7318.125) (-7323.514) (-7335.789) [-7323.240] * (-7326.137) (-7325.583) [-7322.134] (-7337.301) -- 0:23:17
      49500 -- (-7323.518) [-7316.201] (-7335.263) (-7325.536) * [-7326.930] (-7324.661) (-7326.982) (-7335.196) -- 0:23:21
      50000 -- (-7320.573) (-7333.468) [-7324.692] (-7325.969) * (-7328.767) [-7322.112] (-7334.157) (-7328.201) -- 0:23:26

      Average standard deviation of split frequencies: 0.031013

      50500 -- (-7324.998) (-7333.725) (-7326.891) [-7318.163] * (-7337.903) [-7326.185] (-7328.049) (-7337.390) -- 0:23:30
      51000 -- (-7330.477) (-7325.452) [-7318.050] (-7316.031) * (-7330.547) [-7317.346] (-7328.367) (-7326.857) -- 0:23:15
      51500 -- (-7330.327) (-7322.262) (-7333.591) [-7319.785] * [-7317.146] (-7317.527) (-7321.870) (-7319.913) -- 0:23:19
      52000 -- (-7322.169) (-7322.623) [-7340.353] (-7320.542) * [-7323.321] (-7331.326) (-7329.256) (-7326.807) -- 0:23:23
      52500 -- (-7327.964) [-7331.451] (-7333.726) (-7325.155) * (-7316.852) (-7318.659) (-7327.449) [-7322.635] -- 0:23:27
      53000 -- (-7339.562) (-7325.243) (-7331.130) [-7320.846] * (-7327.986) (-7323.754) [-7321.541] (-7319.948) -- 0:23:13
      53500 -- (-7332.179) (-7321.311) (-7327.603) [-7330.712] * (-7326.442) (-7331.316) (-7332.749) [-7316.304] -- 0:23:17
      54000 -- (-7334.336) (-7327.343) (-7326.669) [-7321.066] * (-7331.208) [-7320.785] (-7327.815) (-7341.353) -- 0:23:21
      54500 -- (-7319.841) [-7319.190] (-7328.265) (-7333.439) * [-7327.313] (-7323.090) (-7328.295) (-7340.029) -- 0:23:25
      55000 -- [-7320.041] (-7329.818) (-7331.291) (-7321.918) * (-7325.060) (-7326.371) (-7326.705) [-7324.770] -- 0:23:11

      Average standard deviation of split frequencies: 0.033672

      55500 -- (-7330.515) (-7321.446) (-7324.740) [-7326.239] * [-7329.236] (-7335.070) (-7321.148) (-7325.289) -- 0:23:15
      56000 -- (-7324.842) (-7327.668) [-7327.407] (-7337.400) * (-7322.893) (-7328.695) (-7321.873) [-7319.059] -- 0:23:19
      56500 -- [-7329.551] (-7328.154) (-7329.094) (-7327.949) * (-7330.689) (-7332.606) [-7325.366] (-7322.781) -- 0:23:06
      57000 -- [-7332.373] (-7324.240) (-7333.254) (-7330.231) * (-7339.051) [-7326.482] (-7329.049) (-7318.351) -- 0:23:09
      57500 -- (-7320.182) [-7320.208] (-7328.804) (-7329.329) * (-7331.140) (-7327.225) (-7332.044) [-7317.770] -- 0:23:13
      58000 -- (-7325.434) [-7316.505] (-7326.362) (-7334.997) * (-7323.975) (-7321.552) (-7322.811) [-7328.390] -- 0:23:16
      58500 -- (-7334.789) (-7325.108) (-7319.881) [-7325.347] * (-7318.945) (-7326.322) (-7336.871) [-7322.950] -- 0:23:04
      59000 -- [-7327.095] (-7329.040) (-7324.455) (-7329.084) * (-7325.981) (-7317.628) [-7333.946] (-7336.137) -- 0:23:07
      59500 -- (-7332.384) [-7324.744] (-7324.640) (-7337.605) * (-7318.963) [-7322.011] (-7337.576) (-7333.785) -- 0:23:10
      60000 -- (-7331.379) (-7329.678) [-7328.721] (-7335.684) * [-7318.375] (-7322.701) (-7332.650) (-7322.547) -- 0:23:14

      Average standard deviation of split frequencies: 0.033672

      60500 -- (-7331.737) [-7323.009] (-7331.369) (-7332.434) * (-7325.697) [-7324.836] (-7328.622) (-7323.569) -- 0:23:02
      61000 -- (-7328.545) (-7322.505) (-7336.139) [-7326.473] * [-7318.693] (-7335.967) (-7327.846) (-7324.592) -- 0:23:05
      61500 -- (-7333.069) [-7330.710] (-7334.264) (-7328.127) * (-7326.280) (-7325.797) (-7326.693) [-7326.471] -- 0:23:08
      62000 -- [-7329.098] (-7329.959) (-7329.232) (-7322.823) * [-7323.077] (-7322.147) (-7334.586) (-7324.457) -- 0:22:56
      62500 -- (-7335.188) (-7336.590) (-7325.362) [-7325.868] * (-7326.659) (-7338.028) (-7337.024) [-7333.258] -- 0:23:00
      63000 -- (-7329.104) [-7324.205] (-7328.182) (-7321.014) * (-7328.758) (-7323.619) [-7328.454] (-7342.947) -- 0:23:03
      63500 -- (-7325.437) (-7328.694) (-7329.522) [-7329.538] * (-7323.046) [-7321.956] (-7331.781) (-7336.344) -- 0:23:06
      64000 -- (-7318.593) [-7322.875] (-7325.337) (-7340.067) * (-7322.050) (-7327.284) (-7333.048) [-7330.716] -- 0:22:54
      64500 -- (-7338.137) (-7323.880) [-7323.615] (-7330.659) * [-7320.819] (-7329.405) (-7332.959) (-7333.956) -- 0:22:57
      65000 -- (-7334.240) [-7323.943] (-7320.659) (-7326.847) * (-7326.062) (-7334.550) [-7334.684] (-7322.851) -- 0:23:00

      Average standard deviation of split frequencies: 0.025563

      65500 -- (-7327.905) (-7318.802) [-7323.007] (-7330.214) * (-7332.348) (-7325.500) [-7328.859] (-7329.432) -- 0:23:03
      66000 -- (-7323.057) [-7324.865] (-7326.787) (-7334.996) * (-7328.379) [-7326.721] (-7325.757) (-7326.284) -- 0:22:52
      66500 -- (-7320.466) [-7318.679] (-7328.756) (-7331.380) * (-7329.076) [-7324.000] (-7337.193) (-7325.944) -- 0:22:55
      67000 -- (-7318.487) [-7322.796] (-7334.621) (-7328.428) * (-7320.961) (-7320.479) [-7327.517] (-7328.209) -- 0:22:58
      67500 -- [-7322.049] (-7326.194) (-7343.734) (-7322.991) * (-7322.710) (-7318.183) (-7328.521) [-7331.289] -- 0:23:01
      68000 -- (-7323.507) (-7328.747) (-7338.004) [-7321.311] * [-7321.007] (-7318.434) (-7328.261) (-7334.266) -- 0:22:50
      68500 -- (-7329.024) [-7318.079] (-7342.026) (-7325.807) * [-7321.020] (-7327.690) (-7326.879) (-7329.498) -- 0:22:53
      69000 -- (-7325.549) (-7333.629) (-7336.056) [-7322.515] * (-7316.521) [-7320.476] (-7332.411) (-7330.643) -- 0:22:56
      69500 -- [-7317.290] (-7320.486) (-7335.103) (-7321.065) * (-7320.910) [-7323.357] (-7331.615) (-7336.786) -- 0:22:59
      70000 -- (-7321.162) (-7323.532) [-7318.482] (-7328.114) * (-7326.387) (-7333.094) (-7335.307) [-7333.026] -- 0:22:48

      Average standard deviation of split frequencies: 0.026332

      70500 -- (-7328.697) [-7320.186] (-7329.875) (-7319.188) * (-7328.847) (-7321.213) [-7329.582] (-7329.772) -- 0:22:51
      71000 -- [-7318.460] (-7327.209) (-7323.646) (-7316.670) * (-7329.703) (-7327.495) [-7329.105] (-7328.038) -- 0:22:53
      71500 -- (-7320.701) (-7318.192) (-7324.712) [-7334.831] * (-7329.392) [-7324.627] (-7320.368) (-7336.124) -- 0:22:43
      72000 -- (-7318.375) (-7320.297) (-7328.057) [-7328.599] * (-7330.241) (-7321.800) [-7324.443] (-7326.518) -- 0:22:46
      72500 -- (-7321.041) [-7316.953] (-7327.984) (-7340.211) * (-7331.713) (-7331.303) (-7328.969) [-7331.503] -- 0:22:48
      73000 -- [-7324.190] (-7325.768) (-7337.620) (-7328.252) * (-7328.052) (-7331.370) [-7319.435] (-7329.936) -- 0:22:51
      73500 -- (-7321.924) (-7328.020) [-7319.524] (-7321.045) * (-7340.954) [-7326.103] (-7327.490) (-7331.317) -- 0:22:41
      74000 -- (-7327.847) (-7337.530) (-7322.333) [-7322.522] * (-7330.182) [-7330.954] (-7320.361) (-7328.057) -- 0:22:43
      74500 -- (-7328.671) (-7330.074) (-7322.514) [-7319.176] * (-7332.378) (-7318.868) [-7322.571] (-7330.417) -- 0:22:46
      75000 -- (-7330.326) (-7318.462) (-7325.904) [-7324.861] * [-7326.166] (-7331.277) (-7321.285) (-7325.038) -- 0:22:49

      Average standard deviation of split frequencies: 0.028222

      75500 -- [-7326.581] (-7316.444) (-7323.125) (-7325.939) * (-7325.438) (-7330.911) [-7325.565] (-7330.168) -- 0:22:39
      76000 -- (-7323.941) [-7320.047] (-7321.175) (-7327.170) * (-7326.946) (-7324.772) [-7320.092] (-7333.254) -- 0:22:41
      76500 -- (-7336.527) (-7328.095) [-7324.161] (-7329.875) * (-7324.622) [-7326.337] (-7319.832) (-7325.071) -- 0:22:44
      77000 -- (-7332.898) [-7322.492] (-7326.695) (-7328.450) * [-7322.021] (-7326.466) (-7329.224) (-7347.004) -- 0:22:46
      77500 -- (-7323.913) (-7322.864) (-7325.705) [-7324.645] * (-7319.496) [-7323.884] (-7333.735) (-7334.335) -- 0:22:36
      78000 -- (-7324.193) (-7327.915) [-7320.406] (-7329.952) * (-7330.488) [-7324.042] (-7326.336) (-7330.705) -- 0:22:39
      78500 -- (-7329.116) (-7322.937) [-7317.539] (-7317.243) * [-7318.072] (-7326.712) (-7325.584) (-7326.638) -- 0:22:41
      79000 -- [-7322.911] (-7331.614) (-7323.514) (-7322.590) * [-7320.628] (-7324.319) (-7328.840) (-7332.849) -- 0:22:32
      79500 -- [-7327.015] (-7343.636) (-7329.931) (-7327.956) * (-7326.411) [-7325.345] (-7328.232) (-7323.194) -- 0:22:34
      80000 -- (-7337.371) (-7333.449) [-7316.632] (-7323.292) * (-7332.237) [-7327.566] (-7340.465) (-7330.322) -- 0:22:37

      Average standard deviation of split frequencies: 0.025528

      80500 -- (-7320.894) (-7325.747) [-7318.856] (-7327.466) * (-7332.972) [-7317.742] (-7333.789) (-7326.686) -- 0:22:39
      81000 -- [-7320.736] (-7323.697) (-7330.862) (-7331.153) * (-7327.929) [-7323.199] (-7333.959) (-7320.363) -- 0:22:30
      81500 -- [-7329.046] (-7325.159) (-7322.799) (-7348.345) * (-7322.901) (-7324.172) (-7326.341) [-7315.066] -- 0:22:32
      82000 -- (-7326.105) (-7324.704) [-7334.391] (-7328.853) * (-7330.977) [-7325.490] (-7329.101) (-7331.729) -- 0:22:34
      82500 -- (-7324.245) (-7322.165) (-7333.736) [-7324.492] * (-7329.513) (-7325.195) [-7321.619] (-7334.221) -- 0:22:36
      83000 -- (-7321.932) (-7320.692) [-7320.931] (-7325.666) * (-7327.098) [-7318.091] (-7329.791) (-7332.423) -- 0:22:27
      83500 -- [-7325.535] (-7327.736) (-7322.748) (-7335.097) * (-7328.545) (-7336.133) [-7322.733] (-7332.302) -- 0:22:30
      84000 -- (-7332.539) (-7331.316) [-7320.964] (-7325.939) * (-7323.839) [-7337.558] (-7325.651) (-7330.468) -- 0:22:32
      84500 -- (-7325.214) (-7332.378) [-7322.088] (-7344.540) * (-7328.617) [-7331.666] (-7325.540) (-7327.096) -- 0:22:34
      85000 -- [-7330.479] (-7330.908) (-7325.696) (-7339.389) * (-7334.794) (-7329.897) (-7327.307) [-7324.543] -- 0:22:25

      Average standard deviation of split frequencies: 0.024811

      85500 -- [-7326.851] (-7324.673) (-7326.505) (-7322.114) * (-7331.875) (-7335.732) [-7329.949] (-7331.177) -- 0:22:27
      86000 -- (-7321.086) (-7327.722) (-7326.181) [-7317.266] * [-7319.863] (-7333.531) (-7326.543) (-7330.608) -- 0:22:29
      86500 -- (-7325.589) (-7325.415) (-7318.425) [-7324.132] * [-7319.346] (-7329.208) (-7341.080) (-7322.083) -- 0:22:21
      87000 -- (-7330.707) (-7326.873) (-7322.333) [-7325.091] * [-7315.438] (-7325.184) (-7334.893) (-7328.336) -- 0:22:23
      87500 -- [-7321.874] (-7326.135) (-7326.852) (-7331.225) * (-7319.332) (-7322.487) (-7329.820) [-7315.370] -- 0:22:25
      88000 -- [-7324.086] (-7331.256) (-7323.276) (-7321.045) * (-7327.841) [-7318.838] (-7322.114) (-7331.075) -- 0:22:27
      88500 -- (-7332.293) (-7324.066) [-7319.854] (-7320.284) * (-7326.805) (-7325.895) (-7324.718) [-7330.449] -- 0:22:18
      89000 -- (-7318.198) (-7324.233) (-7335.349) [-7320.967] * (-7334.487) (-7328.786) (-7327.840) [-7320.008] -- 0:22:20
      89500 -- (-7318.546) (-7336.365) [-7324.776] (-7333.187) * (-7324.363) [-7328.855] (-7315.869) (-7329.366) -- 0:22:22
      90000 -- [-7316.472] (-7329.366) (-7325.096) (-7336.194) * [-7329.601] (-7323.526) (-7322.383) (-7324.148) -- 0:22:24

      Average standard deviation of split frequencies: 0.017787

      90500 -- (-7332.284) (-7342.075) [-7319.002] (-7332.962) * (-7322.322) (-7322.679) (-7324.520) [-7318.706] -- 0:22:16
      91000 -- [-7322.006] (-7329.718) (-7335.641) (-7338.089) * (-7327.548) [-7324.597] (-7329.287) (-7320.431) -- 0:22:18
      91500 -- (-7341.753) (-7328.471) (-7327.888) [-7314.565] * (-7322.803) (-7335.313) (-7330.017) [-7319.176] -- 0:22:20
      92000 -- (-7328.970) (-7317.203) (-7325.201) [-7318.839] * (-7336.100) (-7325.024) (-7322.323) [-7323.565] -- 0:22:12
      92500 -- (-7332.435) (-7320.209) (-7322.841) [-7323.065] * (-7323.182) (-7320.290) (-7343.961) [-7319.831] -- 0:22:14
      93000 -- (-7324.414) [-7331.210] (-7318.460) (-7320.949) * (-7325.504) (-7332.107) (-7343.174) [-7323.575] -- 0:22:16
      93500 -- (-7339.166) [-7328.827] (-7328.251) (-7323.971) * [-7319.810] (-7320.413) (-7330.223) (-7324.188) -- 0:22:17
      94000 -- (-7331.537) (-7325.333) [-7320.823] (-7319.532) * [-7318.452] (-7321.460) (-7321.514) (-7321.547) -- 0:22:10
      94500 -- (-7322.278) (-7322.897) (-7315.392) [-7325.339] * [-7328.982] (-7318.841) (-7326.598) (-7327.764) -- 0:22:11
      95000 -- (-7330.414) [-7321.926] (-7334.644) (-7333.477) * (-7318.900) (-7325.907) [-7326.428] (-7325.299) -- 0:22:13

      Average standard deviation of split frequencies: 0.013698

      95500 -- (-7324.971) [-7330.049] (-7323.300) (-7318.244) * [-7324.665] (-7327.676) (-7322.517) (-7324.688) -- 0:22:15
      96000 -- (-7330.031) (-7340.396) (-7324.981) [-7328.047] * (-7322.918) (-7327.495) [-7321.203] (-7328.378) -- 0:22:07
      96500 -- (-7325.196) (-7331.516) [-7333.326] (-7327.290) * (-7326.696) (-7318.019) [-7325.651] (-7332.015) -- 0:22:09
      97000 -- (-7330.455) (-7333.738) (-7329.395) [-7330.409] * (-7323.081) [-7321.708] (-7334.170) (-7327.295) -- 0:22:11
      97500 -- (-7332.168) (-7318.883) (-7329.238) [-7322.803] * [-7327.830] (-7325.817) (-7335.454) (-7328.681) -- 0:22:12
      98000 -- (-7334.888) (-7322.947) [-7328.297] (-7337.182) * (-7332.139) (-7320.587) [-7338.139] (-7327.525) -- 0:22:05
      98500 -- (-7328.170) (-7327.105) [-7321.116] (-7339.138) * (-7323.766) [-7314.127] (-7336.133) (-7329.291) -- 0:22:07
      99000 -- (-7325.025) (-7329.856) [-7323.837] (-7336.503) * [-7328.114] (-7334.198) (-7331.949) (-7322.592) -- 0:22:08
      99500 -- (-7325.631) (-7327.148) [-7315.825] (-7333.791) * (-7326.770) (-7333.284) (-7326.907) [-7323.407] -- 0:22:01
      100000 -- (-7327.695) (-7322.634) [-7319.304] (-7326.810) * [-7317.829] (-7331.660) (-7322.893) (-7327.366) -- 0:22:03

      Average standard deviation of split frequencies: 0.014541

      100500 -- (-7321.430) (-7327.381) [-7318.136] (-7327.014) * [-7325.893] (-7329.427) (-7323.782) (-7330.453) -- 0:22:04
      101000 -- (-7322.290) (-7333.932) (-7327.291) [-7329.405] * (-7334.269) (-7324.192) [-7317.034] (-7328.041) -- 0:22:06
      101500 -- [-7318.913] (-7330.113) (-7335.934) (-7323.771) * (-7330.201) (-7342.281) [-7320.007] (-7330.053) -- 0:21:58
      102000 -- (-7320.031) (-7328.659) (-7333.591) [-7322.415] * (-7323.512) (-7335.941) (-7323.701) [-7323.897] -- 0:22:00
      102500 -- (-7326.070) (-7328.376) [-7338.742] (-7335.988) * (-7335.846) (-7336.043) [-7328.817] (-7334.023) -- 0:22:02
      103000 -- [-7322.803] (-7321.146) (-7331.519) (-7327.538) * (-7324.747) (-7322.133) [-7325.703] (-7329.835) -- 0:22:03
      103500 -- [-7320.591] (-7318.453) (-7322.008) (-7321.087) * (-7327.264) (-7337.492) [-7318.489] (-7327.281) -- 0:21:56
      104000 -- (-7331.713) (-7323.608) [-7327.610] (-7330.485) * (-7322.100) (-7334.591) (-7322.425) [-7319.464] -- 0:21:58
      104500 -- (-7331.145) [-7333.484] (-7323.970) (-7325.388) * (-7333.721) (-7326.376) (-7323.232) [-7327.522] -- 0:21:59
      105000 -- (-7339.349) [-7322.248] (-7325.651) (-7318.221) * (-7318.141) (-7335.008) (-7322.975) [-7321.851] -- 0:22:01

      Average standard deviation of split frequencies: 0.013810

      105500 -- (-7325.505) [-7327.598] (-7338.165) (-7327.479) * (-7332.756) (-7329.169) [-7328.148] (-7325.297) -- 0:21:54
      106000 -- (-7334.332) [-7336.179] (-7330.100) (-7332.662) * [-7326.936] (-7322.016) (-7322.206) (-7339.600) -- 0:21:55
      106500 -- (-7331.597) (-7320.526) [-7324.470] (-7321.202) * (-7331.057) (-7325.810) [-7324.317] (-7335.603) -- 0:21:57
      107000 -- [-7319.862] (-7330.479) (-7337.043) (-7333.407) * (-7324.083) (-7340.457) [-7334.882] (-7325.302) -- 0:21:50
      107500 -- (-7322.577) [-7324.127] (-7321.797) (-7325.070) * (-7336.097) (-7325.715) (-7329.736) [-7317.068] -- 0:21:51
      108000 -- [-7323.838] (-7323.874) (-7328.986) (-7336.317) * [-7327.582] (-7328.682) (-7332.098) (-7326.288) -- 0:21:53
      108500 -- (-7323.510) (-7324.432) (-7329.198) [-7323.997] * (-7324.066) [-7326.459] (-7330.793) (-7332.879) -- 0:21:54
      109000 -- (-7324.463) (-7323.311) (-7315.453) [-7321.111] * (-7323.167) [-7322.095] (-7333.816) (-7329.456) -- 0:21:47
      109500 -- [-7329.707] (-7317.942) (-7331.697) (-7332.569) * [-7317.928] (-7324.466) (-7327.708) (-7342.683) -- 0:21:49
      110000 -- (-7330.730) [-7316.065] (-7320.039) (-7328.138) * [-7326.522] (-7317.591) (-7326.330) (-7330.122) -- 0:21:50

      Average standard deviation of split frequencies: 0.012555

      110500 -- (-7324.311) (-7320.205) (-7323.911) [-7313.944] * (-7345.130) (-7321.643) (-7323.762) [-7326.100] -- 0:21:52
      111000 -- [-7321.880] (-7328.347) (-7321.069) (-7320.997) * (-7336.910) (-7325.678) (-7325.916) [-7319.754] -- 0:21:45
      111500 -- (-7322.751) (-7324.010) [-7317.565] (-7325.026) * (-7318.170) [-7319.357] (-7322.452) (-7331.816) -- 0:21:46
      112000 -- [-7319.407] (-7338.348) (-7322.699) (-7322.741) * (-7319.953) [-7318.910] (-7316.558) (-7327.444) -- 0:21:48
      112500 -- (-7320.363) (-7337.052) [-7319.150] (-7326.052) * (-7332.213) (-7333.134) (-7324.130) [-7324.657] -- 0:21:49
      113000 -- (-7330.213) (-7320.501) [-7316.850] (-7319.772) * (-7325.493) (-7333.604) (-7336.339) [-7324.494] -- 0:21:43
      113500 -- (-7332.926) (-7322.544) (-7326.319) [-7316.223] * [-7322.068] (-7338.246) (-7325.252) (-7317.248) -- 0:21:44
      114000 -- (-7333.256) (-7330.404) (-7321.036) [-7320.137] * (-7323.689) (-7326.678) (-7323.030) [-7318.979] -- 0:21:45
      114500 -- (-7328.390) (-7321.126) (-7330.604) [-7324.189] * (-7326.301) (-7329.383) (-7326.375) [-7340.510] -- 0:21:39
      115000 -- [-7323.555] (-7324.392) (-7322.869) (-7326.419) * (-7320.822) [-7332.975] (-7334.216) (-7339.401) -- 0:21:40

      Average standard deviation of split frequencies: 0.012833

      115500 -- (-7320.262) (-7342.060) [-7328.103] (-7322.313) * [-7324.163] (-7329.830) (-7331.808) (-7335.142) -- 0:21:41
      116000 -- (-7324.751) (-7343.600) (-7322.897) [-7327.825] * [-7325.936] (-7328.331) (-7338.818) (-7334.451) -- 0:21:43
      116500 -- (-7319.924) [-7328.243] (-7328.477) (-7328.491) * (-7324.133) [-7317.259] (-7332.802) (-7329.157) -- 0:21:36
      117000 -- [-7319.713] (-7330.801) (-7326.579) (-7329.000) * [-7323.517] (-7323.471) (-7329.395) (-7321.892) -- 0:21:38
      117500 -- [-7323.508] (-7322.178) (-7321.364) (-7323.945) * [-7323.505] (-7339.415) (-7324.721) (-7328.713) -- 0:21:39
      118000 -- [-7322.020] (-7336.723) (-7324.605) (-7337.964) * (-7328.064) (-7331.006) [-7332.344] (-7321.139) -- 0:21:40
      118500 -- (-7332.475) (-7325.969) [-7326.672] (-7326.233) * (-7332.626) (-7331.297) (-7326.723) [-7328.440] -- 0:21:34
      119000 -- (-7324.503) (-7339.234) (-7325.111) [-7330.505] * [-7333.914] (-7336.910) (-7325.380) (-7324.928) -- 0:21:35
      119500 -- (-7328.910) (-7332.999) [-7321.778] (-7335.620) * (-7331.366) (-7331.328) [-7335.009] (-7326.690) -- 0:21:36
      120000 -- (-7332.685) (-7327.791) [-7322.981] (-7330.175) * (-7330.453) (-7329.222) [-7331.562] (-7322.484) -- 0:21:38

      Average standard deviation of split frequencies: 0.012748

      120500 -- (-7336.832) [-7334.963] (-7329.066) (-7326.359) * (-7324.321) [-7322.354] (-7329.612) (-7326.071) -- 0:21:31
      121000 -- (-7323.528) (-7330.936) [-7317.883] (-7334.715) * (-7327.526) [-7324.297] (-7328.035) (-7335.031) -- 0:21:33
      121500 -- (-7316.975) [-7324.229] (-7330.888) (-7326.195) * (-7326.028) (-7330.906) (-7329.551) [-7320.092] -- 0:21:34
      122000 -- (-7333.373) (-7320.658) [-7329.401] (-7329.246) * (-7332.034) [-7325.822] (-7328.875) (-7328.319) -- 0:21:28
      122500 -- (-7317.975) [-7323.816] (-7327.588) (-7329.601) * (-7317.194) (-7322.020) (-7330.928) [-7318.824] -- 0:21:29
      123000 -- (-7329.538) (-7323.238) [-7327.353] (-7327.854) * (-7322.956) (-7325.881) (-7332.568) [-7323.161] -- 0:21:30
      123500 -- [-7328.445] (-7327.786) (-7332.453) (-7326.638) * (-7323.424) (-7329.798) [-7326.486] (-7320.241) -- 0:21:31
      124000 -- (-7329.051) (-7321.587) [-7325.402] (-7321.471) * [-7324.364] (-7323.579) (-7347.941) (-7328.648) -- 0:21:25
      124500 -- [-7329.199] (-7334.721) (-7331.123) (-7328.479) * (-7328.699) [-7325.836] (-7346.181) (-7327.315) -- 0:21:26
      125000 -- (-7324.169) [-7324.438] (-7332.201) (-7325.680) * (-7331.184) [-7324.784] (-7327.010) (-7330.254) -- 0:21:28

      Average standard deviation of split frequencies: 0.015556

      125500 -- (-7325.945) [-7331.494] (-7334.423) (-7325.759) * (-7333.864) [-7323.909] (-7331.528) (-7337.106) -- 0:21:29
      126000 -- (-7318.211) [-7325.166] (-7335.037) (-7330.563) * (-7338.482) (-7324.603) [-7319.896] (-7325.331) -- 0:21:23
      126500 -- [-7315.144] (-7335.000) (-7323.451) (-7337.063) * (-7323.845) (-7331.898) [-7323.910] (-7345.558) -- 0:21:24
      127000 -- [-7318.114] (-7331.314) (-7320.905) (-7335.403) * [-7323.499] (-7320.596) (-7326.073) (-7341.167) -- 0:21:25
      127500 -- (-7319.916) [-7326.329] (-7333.575) (-7323.034) * (-7322.588) (-7317.287) [-7324.824] (-7328.033) -- 0:21:26
      128000 -- [-7318.004] (-7325.037) (-7320.974) (-7328.380) * [-7329.666] (-7318.447) (-7327.730) (-7332.796) -- 0:21:20
      128500 -- (-7324.282) (-7337.315) (-7328.126) [-7323.737] * [-7327.092] (-7318.858) (-7328.089) (-7324.017) -- 0:21:21
      129000 -- (-7331.641) (-7322.628) (-7322.438) [-7326.273] * (-7322.599) [-7319.594] (-7332.938) (-7320.172) -- 0:21:22
      129500 -- [-7323.411] (-7324.716) (-7332.502) (-7336.383) * (-7322.028) [-7331.475] (-7329.361) (-7319.863) -- 0:21:23
      130000 -- (-7327.459) (-7325.408) [-7323.659] (-7323.403) * [-7324.532] (-7321.642) (-7324.871) (-7324.402) -- 0:21:18

      Average standard deviation of split frequencies: 0.016140

      130500 -- (-7338.143) (-7330.831) (-7324.447) [-7331.395] * [-7320.481] (-7332.511) (-7323.176) (-7326.826) -- 0:21:19
      131000 -- (-7339.809) (-7323.463) [-7329.726] (-7323.761) * (-7319.987) (-7325.427) [-7316.665] (-7326.013) -- 0:21:20
      131500 -- (-7327.275) (-7330.701) (-7323.201) [-7323.893] * [-7324.103] (-7333.270) (-7318.337) (-7328.997) -- 0:21:14
      132000 -- (-7331.358) [-7325.691] (-7333.546) (-7335.657) * (-7317.329) (-7332.749) (-7325.154) [-7330.410] -- 0:21:15
      132500 -- (-7324.120) (-7350.139) (-7335.527) [-7320.652] * (-7333.465) (-7327.328) (-7326.238) [-7324.101] -- 0:21:16
      133000 -- (-7318.735) (-7335.978) [-7329.895] (-7335.594) * (-7322.217) (-7333.023) [-7335.311] (-7323.363) -- 0:21:17
      133500 -- [-7316.311] (-7323.941) (-7323.167) (-7332.760) * (-7328.962) [-7323.174] (-7326.986) (-7329.699) -- 0:21:12
      134000 -- [-7316.350] (-7326.972) (-7333.823) (-7329.401) * (-7321.795) (-7324.813) (-7325.187) [-7320.505] -- 0:21:13
      134500 -- [-7316.444] (-7327.906) (-7334.729) (-7331.830) * [-7316.813] (-7333.770) (-7329.223) (-7317.691) -- 0:21:14
      135000 -- (-7325.547) (-7326.201) [-7323.378] (-7332.851) * (-7324.781) [-7319.365] (-7331.550) (-7325.536) -- 0:21:15

      Average standard deviation of split frequencies: 0.016176

      135500 -- (-7323.458) (-7328.432) [-7314.602] (-7331.128) * [-7324.201] (-7325.602) (-7323.534) (-7326.481) -- 0:21:09
      136000 -- (-7330.950) (-7320.773) [-7319.784] (-7329.382) * (-7325.138) (-7331.192) (-7330.217) [-7319.010] -- 0:21:10
      136500 -- (-7325.509) [-7321.534] (-7331.488) (-7323.798) * (-7336.906) [-7319.984] (-7324.999) (-7322.453) -- 0:21:11
      137000 -- [-7320.253] (-7323.965) (-7332.647) (-7331.244) * (-7323.313) (-7326.067) (-7331.964) [-7321.350] -- 0:21:12
      137500 -- (-7324.699) (-7327.192) [-7332.446] (-7324.680) * (-7323.774) (-7329.576) [-7323.334] (-7321.358) -- 0:21:07
      138000 -- (-7323.585) (-7323.658) (-7325.514) [-7332.819] * [-7320.609] (-7332.377) (-7325.203) (-7321.343) -- 0:21:08
      138500 -- (-7328.128) [-7330.085] (-7329.086) (-7331.620) * [-7323.366] (-7331.739) (-7326.474) (-7338.579) -- 0:21:08
      139000 -- (-7320.112) (-7324.456) (-7331.933) [-7317.988] * [-7323.696] (-7320.146) (-7327.163) (-7329.887) -- 0:21:03
      139500 -- [-7327.003] (-7320.859) (-7333.508) (-7316.915) * [-7325.964] (-7331.406) (-7333.970) (-7326.350) -- 0:21:04
      140000 -- (-7339.423) [-7331.954] (-7325.990) (-7338.245) * (-7331.308) (-7325.457) (-7325.735) [-7327.508] -- 0:21:05

      Average standard deviation of split frequencies: 0.018167

      140500 -- (-7324.897) (-7323.286) [-7318.479] (-7320.670) * (-7323.478) [-7325.258] (-7321.172) (-7323.602) -- 0:21:06
      141000 -- (-7330.726) [-7323.160] (-7318.760) (-7321.814) * (-7334.024) (-7333.426) (-7325.711) [-7319.934] -- 0:21:01
      141500 -- (-7333.464) (-7320.401) (-7321.914) [-7323.849] * (-7340.605) [-7323.436] (-7341.880) (-7329.783) -- 0:21:01
      142000 -- (-7328.386) [-7319.711] (-7315.790) (-7322.972) * (-7322.560) (-7322.766) [-7325.634] (-7324.578) -- 0:21:02
      142500 -- (-7328.333) [-7327.811] (-7326.030) (-7330.356) * [-7324.119] (-7328.872) (-7326.841) (-7333.304) -- 0:21:03
      143000 -- (-7319.164) (-7324.197) (-7333.890) [-7319.883] * [-7325.770] (-7324.114) (-7325.213) (-7327.303) -- 0:20:58
      143500 -- (-7318.981) (-7331.693) (-7331.623) [-7313.744] * [-7319.093] (-7326.114) (-7323.393) (-7331.423) -- 0:20:59
      144000 -- (-7328.275) (-7331.560) (-7330.793) [-7317.657] * [-7318.225] (-7328.189) (-7322.864) (-7329.650) -- 0:21:00
      144500 -- (-7326.642) (-7335.401) (-7328.798) [-7323.354] * (-7332.550) [-7320.329] (-7317.630) (-7336.514) -- 0:21:01
      145000 -- (-7323.072) (-7331.690) [-7320.096] (-7331.055) * (-7330.283) [-7320.161] (-7330.879) (-7322.225) -- 0:20:55

      Average standard deviation of split frequencies: 0.017400

      145500 -- (-7323.847) (-7337.695) [-7327.054] (-7323.054) * (-7327.474) (-7320.121) [-7322.277] (-7334.414) -- 0:20:56
      146000 -- (-7328.530) (-7330.690) (-7321.079) [-7315.242] * (-7328.924) [-7318.200] (-7328.012) (-7326.567) -- 0:20:57
      146500 -- (-7326.470) (-7327.404) [-7320.231] (-7322.356) * [-7326.462] (-7334.855) (-7323.164) (-7334.547) -- 0:20:52
      147000 -- (-7320.752) (-7330.162) (-7322.293) [-7319.369] * (-7321.127) (-7327.778) (-7330.342) [-7321.992] -- 0:20:53
      147500 -- [-7319.310] (-7332.566) (-7319.118) (-7319.357) * (-7332.682) [-7325.402] (-7336.420) (-7321.737) -- 0:20:54
      148000 -- (-7331.829) (-7325.585) [-7326.035] (-7326.292) * (-7333.806) (-7334.205) [-7325.359] (-7329.969) -- 0:20:54
      148500 -- (-7342.282) (-7323.104) (-7323.908) [-7322.947] * (-7329.690) [-7331.559] (-7329.362) (-7328.226) -- 0:20:50
      149000 -- (-7332.668) (-7322.754) [-7328.229] (-7323.398) * (-7339.281) (-7336.170) [-7318.897] (-7323.428) -- 0:20:50
      149500 -- (-7328.411) (-7327.861) (-7324.376) [-7318.008] * (-7334.701) (-7332.661) [-7314.705] (-7333.400) -- 0:20:51
      150000 -- (-7324.399) [-7316.470] (-7322.896) (-7326.325) * (-7328.912) (-7328.183) [-7319.907] (-7335.272) -- 0:20:52

      Average standard deviation of split frequencies: 0.016513

      150500 -- (-7330.673) (-7322.996) (-7327.248) [-7319.544] * (-7338.083) (-7346.455) [-7321.590] (-7330.266) -- 0:20:47
      151000 -- (-7326.109) (-7331.637) (-7324.963) [-7315.573] * (-7327.839) (-7334.268) (-7326.704) [-7318.923] -- 0:20:48
      151500 -- (-7325.047) (-7321.615) (-7324.989) [-7316.703] * (-7322.556) [-7325.286] (-7331.886) (-7329.438) -- 0:20:48
      152000 -- [-7327.171] (-7327.915) (-7339.411) (-7319.702) * (-7333.670) (-7338.600) [-7327.555] (-7323.494) -- 0:20:49
      152500 -- [-7321.945] (-7337.333) (-7323.478) (-7321.148) * (-7321.432) (-7337.454) (-7326.458) [-7326.788] -- 0:20:44
      153000 -- (-7326.363) (-7330.843) [-7321.323] (-7321.983) * (-7337.566) [-7334.518] (-7331.056) (-7329.442) -- 0:20:45
      153500 -- (-7321.423) (-7326.086) (-7323.338) [-7321.521] * (-7327.972) (-7327.718) [-7325.376] (-7324.156) -- 0:20:46
      154000 -- (-7324.085) (-7330.199) (-7336.223) [-7327.103] * [-7325.301] (-7325.808) (-7331.011) (-7326.763) -- 0:20:47
      154500 -- (-7332.338) [-7317.520] (-7334.857) (-7319.691) * (-7322.612) [-7317.332] (-7332.573) (-7333.049) -- 0:20:42
      155000 -- (-7334.670) (-7328.284) (-7322.746) [-7327.920] * [-7324.293] (-7328.940) (-7338.905) (-7325.430) -- 0:20:42

      Average standard deviation of split frequencies: 0.016452

      155500 -- (-7325.916) (-7328.405) [-7322.568] (-7328.890) * [-7319.713] (-7321.938) (-7338.747) (-7325.479) -- 0:20:43
      156000 -- (-7320.652) (-7324.537) [-7317.463] (-7324.422) * [-7319.780] (-7334.014) (-7330.672) (-7332.341) -- 0:20:38
      156500 -- (-7322.110) (-7322.439) (-7323.206) [-7324.852] * (-7321.938) [-7328.974] (-7334.644) (-7328.417) -- 0:20:39
      157000 -- [-7318.514] (-7325.666) (-7332.542) (-7323.229) * (-7329.999) (-7326.631) [-7322.181] (-7331.579) -- 0:20:40
      157500 -- (-7331.081) (-7326.601) (-7321.357) [-7317.098] * (-7327.154) [-7326.136] (-7339.168) (-7325.132) -- 0:20:41
      158000 -- (-7330.009) [-7323.002] (-7313.972) (-7322.716) * (-7324.733) (-7324.069) (-7328.932) [-7326.679] -- 0:20:36
      158500 -- [-7325.207] (-7320.833) (-7332.355) (-7335.052) * (-7323.377) (-7322.162) (-7329.401) [-7331.017] -- 0:20:37
      159000 -- (-7328.918) [-7318.351] (-7320.632) (-7327.500) * (-7321.034) (-7322.092) (-7332.340) [-7333.842] -- 0:20:37
      159500 -- [-7335.535] (-7317.505) (-7325.679) (-7323.270) * [-7317.597] (-7323.643) (-7327.451) (-7340.664) -- 0:20:38
      160000 -- (-7330.352) [-7311.039] (-7323.675) (-7326.443) * [-7318.272] (-7322.870) (-7329.612) (-7326.093) -- 0:20:33

      Average standard deviation of split frequencies: 0.012877

      160500 -- [-7320.569] (-7330.335) (-7327.500) (-7326.211) * (-7321.317) [-7321.159] (-7329.154) (-7319.734) -- 0:20:34
      161000 -- (-7335.894) [-7330.367] (-7335.666) (-7337.676) * [-7321.049] (-7318.988) (-7324.639) (-7335.471) -- 0:20:35
      161500 -- (-7324.834) (-7318.906) [-7322.850] (-7321.659) * (-7323.330) [-7323.473] (-7323.142) (-7324.679) -- 0:20:35
      162000 -- (-7325.813) [-7320.785] (-7332.702) (-7328.107) * (-7319.739) (-7323.530) [-7317.862] (-7322.498) -- 0:20:31
      162500 -- (-7327.758) [-7317.175] (-7320.592) (-7327.657) * (-7322.405) (-7323.880) (-7324.505) [-7324.022] -- 0:20:31
      163000 -- (-7320.740) (-7325.048) (-7319.579) [-7326.221] * (-7330.800) (-7324.440) (-7328.612) [-7325.386] -- 0:20:32
      163500 -- (-7314.315) (-7328.707) (-7327.453) [-7325.598] * [-7325.839] (-7330.129) (-7328.647) (-7325.854) -- 0:20:27
      164000 -- [-7323.493] (-7330.292) (-7328.248) (-7325.584) * (-7331.030) (-7334.026) (-7326.898) [-7331.683] -- 0:20:28
      164500 -- (-7324.785) (-7326.948) [-7329.750] (-7330.099) * (-7319.922) [-7326.461] (-7327.572) (-7327.978) -- 0:20:29
      165000 -- (-7327.371) (-7319.528) (-7327.240) [-7321.206] * (-7318.899) (-7329.237) (-7334.504) [-7327.171] -- 0:20:29

      Average standard deviation of split frequencies: 0.013095

      165500 -- (-7336.626) [-7323.614] (-7327.698) (-7321.718) * (-7332.371) (-7317.933) (-7329.584) [-7317.743] -- 0:20:25
      166000 -- (-7323.044) (-7329.324) (-7327.344) [-7321.578] * (-7327.841) [-7329.646] (-7328.542) (-7325.740) -- 0:20:25
      166500 -- (-7327.744) (-7329.271) [-7322.191] (-7321.451) * (-7328.026) (-7335.706) (-7330.134) [-7335.061] -- 0:20:26
      167000 -- (-7324.405) [-7328.138] (-7321.083) (-7333.582) * (-7324.629) (-7330.264) [-7324.914] (-7328.010) -- 0:20:27
      167500 -- [-7325.703] (-7315.908) (-7321.048) (-7328.147) * (-7330.533) (-7326.258) (-7340.045) [-7327.096] -- 0:20:22
      168000 -- (-7329.260) (-7322.533) [-7319.518] (-7332.549) * (-7327.422) [-7327.961] (-7336.273) (-7333.542) -- 0:20:23
      168500 -- (-7323.815) (-7322.890) [-7316.499] (-7328.963) * (-7328.989) [-7319.311] (-7330.244) (-7325.104) -- 0:20:23
      169000 -- (-7322.050) (-7332.447) [-7322.001] (-7325.018) * (-7334.346) [-7325.473] (-7327.979) (-7330.002) -- 0:20:24
      169500 -- (-7324.025) [-7328.846] (-7326.145) (-7332.390) * [-7341.383] (-7321.919) (-7325.059) (-7323.310) -- 0:20:20
      170000 -- [-7326.774] (-7335.145) (-7319.625) (-7334.219) * (-7330.012) (-7328.177) [-7322.927] (-7327.238) -- 0:20:20

      Average standard deviation of split frequencies: 0.011662

      170500 -- [-7329.309] (-7329.004) (-7324.399) (-7322.643) * (-7333.931) [-7319.406] (-7326.977) (-7340.764) -- 0:20:21
      171000 -- (-7326.418) (-7338.191) [-7322.007] (-7322.877) * (-7335.713) (-7322.327) [-7332.209] (-7345.521) -- 0:20:16
      171500 -- [-7322.826] (-7331.306) (-7318.001) (-7328.914) * [-7330.650] (-7329.384) (-7338.175) (-7336.414) -- 0:20:17
      172000 -- (-7332.005) (-7336.275) [-7330.176] (-7322.566) * [-7323.887] (-7324.053) (-7317.489) (-7332.518) -- 0:20:17
      172500 -- (-7326.217) (-7332.673) [-7332.826] (-7334.278) * (-7320.153) [-7333.597] (-7317.318) (-7335.665) -- 0:20:18
      173000 -- (-7333.317) (-7325.989) [-7317.974] (-7330.839) * [-7325.761] (-7329.347) (-7315.019) (-7333.199) -- 0:20:14
      173500 -- (-7329.807) [-7344.079] (-7327.303) (-7329.398) * (-7336.381) (-7328.170) [-7322.794] (-7336.651) -- 0:20:14
      174000 -- (-7322.962) (-7330.579) (-7328.197) [-7312.524] * (-7337.746) [-7331.253] (-7328.152) (-7328.976) -- 0:20:15
      174500 -- (-7317.946) (-7343.997) (-7333.359) [-7321.247] * (-7326.820) (-7327.865) [-7331.080] (-7325.353) -- 0:20:15
      175000 -- (-7323.076) (-7328.718) [-7330.609] (-7325.436) * [-7330.915] (-7325.260) (-7335.462) (-7336.367) -- 0:20:11

      Average standard deviation of split frequencies: 0.009970

      175500 -- [-7320.352] (-7320.852) (-7344.761) (-7331.154) * (-7326.222) (-7323.650) (-7333.447) [-7335.250] -- 0:20:12
      176000 -- (-7334.532) [-7330.417] (-7335.616) (-7324.169) * [-7329.639] (-7331.074) (-7325.516) (-7326.204) -- 0:20:12
      176500 -- [-7326.206] (-7328.438) (-7328.864) (-7324.904) * (-7320.799) [-7320.552] (-7332.068) (-7330.762) -- 0:20:13
      177000 -- [-7323.414] (-7326.740) (-7334.257) (-7324.254) * (-7325.410) [-7315.963] (-7344.430) (-7330.211) -- 0:20:08
      177500 -- (-7322.684) (-7335.189) [-7330.149] (-7324.863) * (-7327.774) (-7323.801) (-7339.595) [-7315.344] -- 0:20:09
      178000 -- (-7320.464) [-7333.059] (-7341.204) (-7321.936) * [-7322.589] (-7338.339) (-7329.306) (-7325.691) -- 0:20:09
      178500 -- (-7324.912) (-7329.455) [-7325.878] (-7330.679) * (-7326.372) [-7331.080] (-7336.173) (-7317.139) -- 0:20:10
      179000 -- (-7319.412) (-7325.515) (-7332.889) [-7321.575] * (-7323.184) (-7324.062) (-7339.663) [-7329.946] -- 0:20:06
      179500 -- (-7324.043) (-7326.502) [-7323.640] (-7319.617) * (-7323.221) (-7325.849) [-7331.894] (-7335.316) -- 0:20:06
      180000 -- (-7324.585) [-7322.557] (-7331.793) (-7317.374) * [-7330.004] (-7331.633) (-7326.865) (-7327.487) -- 0:20:07

      Average standard deviation of split frequencies: 0.009132

      180500 -- (-7335.978) (-7330.700) (-7333.340) [-7326.373] * [-7322.802] (-7320.477) (-7328.126) (-7318.765) -- 0:20:03
      181000 -- (-7332.585) (-7341.920) (-7325.703) [-7319.046] * (-7325.635) (-7327.915) (-7326.291) [-7326.503] -- 0:20:03
      181500 -- (-7330.028) (-7329.273) [-7329.844] (-7323.553) * (-7324.648) [-7327.225] (-7328.019) (-7320.138) -- 0:20:04
      182000 -- (-7332.123) [-7333.938] (-7326.021) (-7331.406) * (-7333.540) [-7326.990] (-7324.129) (-7319.649) -- 0:20:04
      182500 -- (-7327.285) (-7331.874) [-7319.594] (-7333.098) * (-7336.491) (-7325.659) (-7323.685) [-7317.593] -- 0:20:00
      183000 -- (-7346.150) (-7332.675) [-7318.036] (-7323.679) * (-7328.795) [-7317.702] (-7324.791) (-7324.355) -- 0:20:00
      183500 -- [-7322.957] (-7337.084) (-7331.161) (-7317.408) * [-7331.107] (-7329.070) (-7326.920) (-7319.625) -- 0:20:01
      184000 -- (-7316.842) (-7328.029) (-7332.652) [-7323.546] * (-7321.423) (-7321.399) (-7325.635) [-7318.662] -- 0:20:01
      184500 -- (-7329.635) (-7320.782) (-7341.726) [-7336.157] * (-7329.783) (-7329.584) (-7332.408) [-7322.107] -- 0:19:57
      185000 -- (-7340.418) (-7327.738) [-7320.939] (-7324.771) * [-7328.966] (-7326.902) (-7329.818) (-7321.214) -- 0:19:58

      Average standard deviation of split frequencies: 0.010138

      185500 -- (-7329.388) (-7330.852) [-7315.971] (-7323.924) * (-7330.112) (-7319.995) [-7322.816] (-7328.962) -- 0:19:58
      186000 -- (-7335.185) (-7333.195) [-7316.926] (-7316.341) * (-7325.654) (-7329.065) (-7328.147) [-7322.902] -- 0:19:54
      186500 -- (-7324.021) (-7328.548) (-7327.421) [-7326.621] * (-7325.728) (-7336.653) (-7327.052) [-7317.202] -- 0:19:55
      187000 -- (-7338.440) (-7341.757) [-7324.810] (-7320.327) * (-7328.544) (-7327.334) (-7323.789) [-7332.150] -- 0:19:55
      187500 -- (-7335.868) (-7328.884) [-7324.162] (-7324.637) * [-7322.701] (-7325.888) (-7325.996) (-7324.687) -- 0:19:56
      188000 -- (-7334.994) (-7319.205) [-7321.273] (-7318.002) * [-7317.126] (-7340.822) (-7319.331) (-7328.230) -- 0:19:52
      188500 -- (-7331.201) (-7321.206) [-7317.850] (-7342.402) * [-7313.857] (-7331.572) (-7322.380) (-7322.205) -- 0:19:52
      189000 -- (-7338.456) [-7319.818] (-7329.979) (-7331.679) * [-7324.415] (-7327.745) (-7328.672) (-7315.707) -- 0:19:52
      189500 -- (-7336.252) (-7336.844) (-7330.772) [-7319.931] * (-7329.654) (-7327.703) (-7324.662) [-7316.580] -- 0:19:53
      190000 -- (-7331.267) (-7328.158) [-7323.956] (-7328.153) * (-7332.256) (-7334.757) (-7325.837) [-7322.478] -- 0:19:49

      Average standard deviation of split frequencies: 0.008726

      190500 -- (-7331.686) (-7326.954) [-7313.805] (-7321.836) * (-7333.494) (-7328.279) (-7322.505) [-7317.461] -- 0:19:49
      191000 -- (-7327.546) (-7343.787) [-7324.470] (-7336.614) * (-7324.664) (-7333.460) [-7327.843] (-7319.424) -- 0:19:50
      191500 -- (-7325.449) (-7334.457) [-7323.206] (-7330.326) * (-7327.864) (-7321.995) [-7320.338] (-7317.765) -- 0:19:50
      192000 -- [-7323.278] (-7339.100) (-7320.528) (-7338.875) * (-7333.595) (-7327.987) (-7314.318) [-7326.979] -- 0:19:46
      192500 -- [-7320.335] (-7334.730) (-7337.946) (-7322.462) * (-7317.337) (-7331.071) (-7327.008) [-7326.438] -- 0:19:47
      193000 -- (-7329.583) [-7327.073] (-7321.448) (-7320.754) * [-7318.577] (-7319.820) (-7330.128) (-7323.659) -- 0:19:47
      193500 -- [-7327.812] (-7328.600) (-7323.459) (-7313.630) * (-7317.772) [-7320.229] (-7332.494) (-7329.527) -- 0:19:47
      194000 -- [-7321.643] (-7334.606) (-7329.953) (-7327.525) * (-7330.327) [-7321.193] (-7339.993) (-7328.126) -- 0:19:44
      194500 -- (-7331.311) (-7325.814) [-7318.373] (-7334.004) * (-7321.959) (-7320.296) (-7324.653) [-7326.972] -- 0:19:44
      195000 -- [-7322.381] (-7334.581) (-7321.646) (-7328.072) * (-7329.650) [-7319.579] (-7331.168) (-7318.456) -- 0:19:44

      Average standard deviation of split frequencies: 0.007498

      195500 -- (-7328.985) (-7333.840) (-7324.777) [-7314.532] * (-7326.993) (-7329.707) [-7320.940] (-7327.180) -- 0:19:41
      196000 -- (-7324.169) [-7314.247] (-7326.721) (-7319.324) * [-7317.211] (-7328.804) (-7323.105) (-7326.110) -- 0:19:41
      196500 -- (-7328.559) (-7321.892) [-7320.524] (-7323.409) * (-7320.452) (-7322.447) [-7330.862] (-7335.820) -- 0:19:41
      197000 -- [-7324.672] (-7337.575) (-7320.871) (-7329.841) * (-7330.294) [-7322.632] (-7328.477) (-7330.433) -- 0:19:42
      197500 -- (-7338.118) (-7325.268) [-7322.576] (-7327.431) * [-7320.093] (-7325.202) (-7323.584) (-7331.222) -- 0:19:38
      198000 -- (-7340.168) (-7322.328) [-7326.544] (-7321.804) * (-7321.711) (-7327.479) [-7320.312] (-7324.067) -- 0:19:38
      198500 -- (-7332.405) (-7319.752) (-7318.044) [-7318.448] * (-7326.245) [-7317.290] (-7329.287) (-7325.063) -- 0:19:39
      199000 -- (-7323.301) (-7320.218) (-7335.205) [-7317.393] * (-7323.391) [-7322.958] (-7320.279) (-7340.787) -- 0:19:39
      199500 -- [-7321.810] (-7327.825) (-7327.667) (-7326.834) * (-7325.842) [-7318.013] (-7329.284) (-7329.334) -- 0:19:35
      200000 -- (-7327.641) (-7325.815) (-7330.720) [-7324.946] * [-7326.718] (-7324.547) (-7331.598) (-7331.749) -- 0:19:36

      Average standard deviation of split frequencies: 0.009535

      200500 -- (-7329.638) [-7332.983] (-7331.229) (-7329.277) * (-7328.908) [-7326.459] (-7333.225) (-7342.344) -- 0:19:36
      201000 -- (-7329.402) [-7330.238] (-7325.604) (-7335.015) * (-7327.545) [-7323.184] (-7333.534) (-7339.532) -- 0:19:36
      201500 -- (-7327.269) (-7329.066) [-7341.377] (-7325.822) * [-7328.240] (-7329.343) (-7326.432) (-7326.326) -- 0:19:32
      202000 -- (-7324.830) (-7333.672) (-7328.607) [-7325.447] * (-7333.882) (-7323.082) (-7325.436) [-7334.456] -- 0:19:33
      202500 -- (-7331.301) (-7319.539) (-7333.904) [-7325.042] * [-7319.667] (-7322.231) (-7329.292) (-7331.188) -- 0:19:33
      203000 -- (-7323.536) [-7322.290] (-7331.081) (-7325.102) * (-7326.831) (-7319.817) [-7327.873] (-7330.688) -- 0:19:29
      203500 -- [-7327.263] (-7326.674) (-7321.444) (-7337.712) * (-7322.814) (-7318.620) [-7317.718] (-7330.651) -- 0:19:30
      204000 -- (-7317.905) [-7322.845] (-7331.512) (-7330.197) * (-7334.617) (-7328.000) [-7322.799] (-7325.556) -- 0:19:30
      204500 -- (-7326.965) [-7322.113] (-7326.109) (-7323.839) * (-7335.281) (-7335.389) (-7324.423) [-7327.051] -- 0:19:30
      205000 -- [-7326.905] (-7323.746) (-7332.316) (-7324.671) * (-7330.007) [-7320.086] (-7339.514) (-7330.349) -- 0:19:27

      Average standard deviation of split frequencies: 0.009557

      205500 -- (-7320.061) (-7320.416) (-7329.338) [-7321.575] * (-7330.316) [-7333.855] (-7331.811) (-7326.189) -- 0:19:27
      206000 -- (-7327.677) (-7327.421) (-7328.205) [-7311.781] * (-7327.846) [-7322.930] (-7329.499) (-7330.790) -- 0:19:27
      206500 -- (-7320.415) [-7322.443] (-7331.307) (-7317.723) * (-7335.872) [-7332.256] (-7322.790) (-7336.970) -- 0:19:28
      207000 -- [-7320.882] (-7319.287) (-7328.257) (-7325.803) * (-7343.147) (-7326.047) (-7320.165) [-7329.336] -- 0:19:24
      207500 -- (-7326.500) [-7323.712] (-7330.144) (-7324.848) * (-7326.316) (-7327.988) [-7331.464] (-7329.448) -- 0:19:24
      208000 -- (-7330.432) (-7324.202) (-7323.979) [-7322.308] * (-7328.380) (-7325.702) (-7327.807) [-7319.062] -- 0:19:25
      208500 -- [-7324.465] (-7330.463) (-7318.866) (-7338.895) * (-7336.389) (-7324.387) (-7328.159) [-7326.826] -- 0:19:25
      209000 -- (-7323.991) (-7327.109) [-7323.738] (-7326.036) * (-7324.379) (-7325.980) (-7320.907) [-7324.619] -- 0:19:21
      209500 -- (-7327.576) (-7327.813) [-7328.979] (-7323.778) * (-7324.606) (-7329.549) (-7324.583) [-7332.909] -- 0:19:22
      210000 -- [-7325.524] (-7329.970) (-7324.986) (-7344.459) * (-7327.123) (-7339.455) [-7322.282] (-7335.354) -- 0:19:22

      Average standard deviation of split frequencies: 0.010135

      210500 -- (-7329.030) (-7332.237) (-7338.546) [-7326.821] * [-7319.073] (-7328.097) (-7333.942) (-7328.185) -- 0:19:22
      211000 -- (-7327.396) [-7317.458] (-7331.780) (-7329.761) * (-7324.051) (-7328.810) [-7336.576] (-7330.624) -- 0:19:19
      211500 -- (-7327.544) [-7321.726] (-7335.002) (-7326.659) * [-7323.202] (-7323.053) (-7326.565) (-7340.271) -- 0:19:19
      212000 -- (-7326.503) (-7332.707) [-7330.782] (-7323.940) * (-7327.369) (-7325.957) [-7324.884] (-7339.639) -- 0:19:19
      212500 -- (-7324.492) (-7324.105) (-7336.718) [-7313.738] * (-7328.688) [-7327.598] (-7328.364) (-7336.181) -- 0:19:16
      213000 -- (-7329.418) (-7337.784) (-7335.037) [-7316.627] * (-7323.250) (-7323.061) (-7327.238) [-7325.361] -- 0:19:16
      213500 -- (-7336.243) (-7334.877) [-7318.549] (-7312.879) * (-7338.911) (-7321.782) (-7328.777) [-7318.714] -- 0:19:16
      214000 -- [-7324.222] (-7338.894) (-7324.999) (-7317.427) * (-7336.376) (-7326.670) [-7320.671] (-7326.650) -- 0:19:16
      214500 -- (-7325.419) (-7350.509) (-7329.981) [-7322.378] * (-7340.140) [-7328.832] (-7321.451) (-7324.958) -- 0:19:13
      215000 -- [-7320.974] (-7331.425) (-7329.448) (-7322.726) * (-7333.326) (-7327.281) [-7326.238] (-7339.184) -- 0:19:13

      Average standard deviation of split frequencies: 0.008730

      215500 -- (-7324.307) (-7328.669) [-7321.170] (-7318.825) * [-7323.656] (-7328.405) (-7324.378) (-7333.010) -- 0:19:13
      216000 -- (-7325.904) (-7329.997) (-7317.929) [-7313.071] * [-7322.540] (-7324.234) (-7326.664) (-7322.445) -- 0:19:14
      216500 -- (-7327.557) (-7325.419) (-7324.093) [-7325.430] * (-7329.034) [-7326.784] (-7327.452) (-7332.678) -- 0:19:10
      217000 -- (-7328.048) (-7325.557) (-7319.528) [-7328.332] * [-7315.113] (-7332.677) (-7329.935) (-7325.999) -- 0:19:11
      217500 -- (-7322.412) [-7330.695] (-7321.740) (-7328.847) * (-7330.133) [-7322.461] (-7326.065) (-7319.441) -- 0:19:11
      218000 -- [-7324.347] (-7332.082) (-7328.547) (-7317.424) * [-7320.847] (-7327.489) (-7329.902) (-7314.941) -- 0:19:11
      218500 -- (-7331.157) (-7322.740) (-7318.754) [-7321.798] * (-7324.228) (-7330.999) (-7324.884) [-7319.537] -- 0:19:08
      219000 -- (-7322.870) [-7319.222] (-7316.263) (-7324.465) * (-7324.945) (-7330.262) (-7320.560) [-7319.434] -- 0:19:08
      219500 -- (-7331.210) (-7331.314) [-7317.783] (-7313.931) * (-7327.059) (-7321.770) [-7322.336] (-7330.247) -- 0:19:08
      220000 -- [-7321.079] (-7323.945) (-7318.872) (-7329.344) * (-7327.892) [-7319.244] (-7323.782) (-7326.153) -- 0:19:05

      Average standard deviation of split frequencies: 0.009425

      220500 -- [-7321.902] (-7321.699) (-7319.736) (-7335.267) * (-7325.395) (-7335.669) (-7319.496) [-7320.915] -- 0:19:05
      221000 -- [-7315.254] (-7329.454) (-7323.597) (-7332.056) * (-7326.884) (-7319.026) [-7316.785] (-7336.702) -- 0:19:05
      221500 -- [-7320.569] (-7335.459) (-7326.454) (-7325.412) * [-7330.618] (-7333.334) (-7325.136) (-7329.253) -- 0:19:05
      222000 -- (-7324.484) (-7337.679) (-7318.253) [-7323.741] * (-7325.126) (-7325.830) [-7328.677] (-7329.050) -- 0:19:02
      222500 -- [-7323.112] (-7330.621) (-7322.677) (-7323.765) * [-7322.227] (-7321.737) (-7328.303) (-7326.850) -- 0:19:02
      223000 -- (-7326.069) (-7327.215) [-7328.620] (-7333.784) * (-7329.140) [-7316.244] (-7324.571) (-7329.144) -- 0:19:02
      223500 -- [-7320.729] (-7329.109) (-7318.849) (-7323.029) * (-7328.133) [-7318.196] (-7315.833) (-7329.874) -- 0:19:03
      224000 -- [-7329.080] (-7327.685) (-7332.410) (-7337.665) * (-7330.922) (-7326.502) [-7318.193] (-7335.161) -- 0:18:59
      224500 -- [-7324.343] (-7321.860) (-7329.604) (-7330.833) * (-7322.587) (-7322.052) [-7324.809] (-7329.360) -- 0:18:59
      225000 -- (-7320.986) [-7326.179] (-7341.715) (-7323.338) * (-7330.249) [-7327.091] (-7328.040) (-7327.571) -- 0:19:00

      Average standard deviation of split frequencies: 0.008343

      225500 -- (-7322.554) (-7320.695) [-7320.147] (-7340.584) * (-7324.728) (-7331.039) (-7332.836) [-7327.724] -- 0:19:00
      226000 -- (-7325.833) (-7322.765) [-7326.973] (-7328.093) * [-7317.103] (-7334.134) (-7338.843) (-7331.086) -- 0:18:57
      226500 -- [-7327.653] (-7330.139) (-7327.432) (-7321.963) * (-7321.506) [-7331.755] (-7339.750) (-7325.393) -- 0:18:57
      227000 -- (-7334.588) (-7330.532) (-7325.965) [-7322.515] * (-7320.370) [-7324.601] (-7338.714) (-7329.041) -- 0:18:57
      227500 -- (-7325.942) (-7330.229) (-7326.207) [-7322.586] * (-7317.132) [-7322.015] (-7328.097) (-7324.622) -- 0:18:54
      228000 -- (-7325.990) (-7329.048) (-7318.443) [-7322.491] * [-7322.090] (-7329.009) (-7336.782) (-7323.018) -- 0:18:54
      228500 -- (-7334.388) (-7331.036) [-7322.006] (-7320.568) * (-7330.358) [-7322.414] (-7318.453) (-7324.164) -- 0:18:54
      229000 -- (-7339.452) [-7329.638] (-7322.954) (-7338.193) * (-7328.412) (-7322.641) [-7327.258] (-7339.550) -- 0:18:54
      229500 -- (-7333.964) (-7337.814) (-7327.300) [-7320.318] * (-7320.978) (-7326.491) [-7316.890] (-7339.735) -- 0:18:51
      230000 -- (-7330.503) [-7329.557] (-7327.733) (-7316.963) * (-7335.524) (-7329.222) [-7320.401] (-7342.323) -- 0:18:51

      Average standard deviation of split frequencies: 0.011060

      230500 -- (-7331.192) (-7326.049) (-7321.562) [-7323.698] * (-7324.622) (-7328.166) (-7323.593) [-7332.322] -- 0:18:51
      231000 -- (-7334.529) (-7322.889) (-7330.112) [-7322.246] * (-7334.701) [-7329.056] (-7324.533) (-7329.814) -- 0:18:51
      231500 -- (-7325.662) (-7324.481) (-7327.670) [-7321.221] * (-7334.160) [-7323.962] (-7321.547) (-7323.166) -- 0:18:48
      232000 -- [-7330.896] (-7331.357) (-7321.547) (-7324.167) * (-7321.733) [-7326.236] (-7332.166) (-7319.612) -- 0:18:48
      232500 -- (-7332.098) (-7329.722) (-7323.135) [-7332.084] * (-7322.092) (-7321.587) (-7337.467) [-7322.210] -- 0:18:48
      233000 -- (-7322.884) (-7329.415) [-7329.486] (-7329.040) * [-7321.660] (-7327.984) (-7334.435) (-7323.432) -- 0:18:49
      233500 -- (-7323.216) [-7328.637] (-7328.762) (-7334.338) * (-7321.031) (-7330.784) (-7327.208) [-7318.111] -- 0:18:45
      234000 -- (-7323.962) (-7322.575) (-7325.255) [-7322.259] * (-7318.353) (-7326.118) [-7328.635] (-7327.614) -- 0:18:46
      234500 -- [-7318.608] (-7325.132) (-7329.100) (-7322.932) * (-7319.661) (-7327.450) [-7319.915] (-7349.312) -- 0:18:46
      235000 -- (-7321.607) (-7331.705) [-7330.146] (-7330.915) * (-7323.432) (-7322.262) [-7317.745] (-7338.889) -- 0:18:43

      Average standard deviation of split frequencies: 0.011045

      235500 -- (-7324.308) (-7326.785) (-7330.722) [-7313.135] * (-7325.224) (-7329.138) [-7320.900] (-7342.641) -- 0:18:43
      236000 -- (-7330.521) (-7317.336) (-7333.473) [-7323.014] * (-7323.515) (-7340.193) [-7318.161] (-7330.080) -- 0:18:43
      236500 -- (-7331.732) [-7322.953] (-7339.519) (-7325.648) * [-7324.381] (-7329.086) (-7334.655) (-7327.961) -- 0:18:43
      237000 -- (-7329.130) (-7335.721) [-7322.387] (-7331.709) * (-7325.058) [-7325.898] (-7328.624) (-7328.549) -- 0:18:40
      237500 -- [-7329.057] (-7327.239) (-7325.406) (-7331.214) * (-7323.726) (-7326.314) [-7332.618] (-7327.164) -- 0:18:40
      238000 -- (-7313.288) (-7326.422) [-7323.004] (-7331.457) * (-7322.352) [-7319.190] (-7330.844) (-7334.354) -- 0:18:40
      238500 -- (-7326.005) (-7332.485) (-7333.616) [-7328.118] * [-7318.156] (-7330.228) (-7333.189) (-7328.961) -- 0:18:40
      239000 -- [-7324.080] (-7325.889) (-7326.620) (-7323.381) * [-7319.171] (-7328.820) (-7327.463) (-7324.797) -- 0:18:37
      239500 -- (-7332.625) (-7325.826) [-7317.998] (-7328.195) * (-7336.312) (-7330.211) [-7334.408] (-7325.338) -- 0:18:37
      240000 -- (-7324.516) [-7324.806] (-7329.359) (-7330.496) * (-7326.691) (-7327.816) [-7324.182] (-7315.031) -- 0:18:37

      Average standard deviation of split frequencies: 0.010600

      240500 -- [-7324.807] (-7326.551) (-7327.577) (-7334.357) * [-7335.946] (-7336.612) (-7328.568) (-7335.998) -- 0:18:37
      241000 -- (-7325.454) (-7316.537) [-7325.854] (-7318.391) * (-7329.791) (-7326.640) (-7325.967) [-7319.233] -- 0:18:34
      241500 -- (-7317.616) [-7317.553] (-7317.591) (-7321.406) * (-7323.416) (-7327.611) (-7320.144) [-7318.971] -- 0:18:34
      242000 -- (-7324.360) [-7325.093] (-7330.405) (-7329.813) * (-7326.001) (-7330.846) [-7332.327] (-7320.804) -- 0:18:35
      242500 -- [-7326.050] (-7320.428) (-7327.826) (-7332.775) * (-7327.522) (-7332.125) (-7327.255) [-7329.285] -- 0:18:32
      243000 -- (-7332.680) (-7320.542) [-7313.599] (-7326.424) * (-7331.132) (-7338.369) (-7320.444) [-7317.573] -- 0:18:32
      243500 -- (-7337.659) (-7324.087) (-7330.764) [-7322.531] * (-7332.250) (-7326.069) [-7321.465] (-7338.415) -- 0:18:32
      244000 -- (-7328.328) (-7319.755) [-7322.197] (-7329.236) * (-7322.956) [-7329.862] (-7325.583) (-7319.564) -- 0:18:32
      244500 -- (-7330.808) [-7318.655] (-7323.997) (-7329.597) * [-7324.051] (-7320.681) (-7329.469) (-7323.729) -- 0:18:29
      245000 -- (-7322.064) [-7319.873] (-7322.228) (-7326.220) * (-7326.150) [-7324.050] (-7322.446) (-7316.288) -- 0:18:29

      Average standard deviation of split frequencies: 0.010596

      245500 -- (-7327.802) (-7322.639) (-7323.183) [-7321.408] * (-7329.978) (-7325.973) [-7326.236] (-7319.126) -- 0:18:29
      246000 -- [-7324.705] (-7329.389) (-7327.389) (-7323.472) * [-7324.292] (-7328.848) (-7327.246) (-7320.031) -- 0:18:29
      246500 -- (-7328.411) [-7315.540] (-7323.728) (-7333.466) * (-7331.062) (-7320.693) (-7349.544) [-7325.323] -- 0:18:26
      247000 -- (-7327.013) (-7324.205) (-7326.519) [-7323.384] * [-7313.906] (-7314.558) (-7331.275) (-7334.820) -- 0:18:26
      247500 -- (-7335.473) [-7323.283] (-7327.231) (-7330.546) * [-7330.688] (-7315.631) (-7335.802) (-7329.132) -- 0:18:26
      248000 -- (-7327.221) [-7321.294] (-7327.027) (-7317.888) * [-7322.393] (-7321.596) (-7326.602) (-7314.775) -- 0:18:26
      248500 -- (-7330.558) (-7329.825) [-7329.309] (-7315.027) * (-7334.582) [-7316.912] (-7323.516) (-7315.932) -- 0:18:23
      249000 -- (-7333.965) (-7324.965) (-7326.943) [-7325.976] * (-7331.930) [-7325.842] (-7330.233) (-7323.686) -- 0:18:23
      249500 -- (-7331.610) (-7323.671) (-7319.907) [-7321.917] * (-7327.123) (-7327.624) [-7322.053] (-7324.451) -- 0:18:23
      250000 -- (-7328.525) (-7326.642) (-7324.717) [-7323.369] * (-7320.349) [-7329.670] (-7322.210) (-7317.113) -- 0:18:24

      Average standard deviation of split frequencies: 0.010288

      250500 -- (-7331.029) (-7334.517) [-7321.465] (-7331.343) * (-7325.663) [-7324.385] (-7335.292) (-7322.505) -- 0:18:21
      251000 -- (-7332.909) [-7319.848] (-7323.960) (-7330.105) * (-7321.559) (-7330.461) (-7336.944) [-7328.851] -- 0:18:21
      251500 -- (-7327.418) (-7317.868) [-7325.360] (-7327.961) * [-7320.976] (-7325.280) (-7329.752) (-7329.538) -- 0:18:21
      252000 -- [-7325.539] (-7326.558) (-7324.961) (-7327.667) * (-7328.376) (-7330.253) (-7324.599) [-7317.540] -- 0:18:18
      252500 -- (-7340.949) [-7323.777] (-7322.966) (-7323.854) * [-7329.771] (-7321.819) (-7325.836) (-7332.570) -- 0:18:18
      253000 -- (-7329.951) [-7322.831] (-7320.380) (-7322.080) * (-7338.925) (-7327.152) [-7331.503] (-7323.014) -- 0:18:18
      253500 -- (-7322.450) [-7318.278] (-7324.150) (-7330.040) * (-7324.035) [-7319.585] (-7322.488) (-7326.596) -- 0:18:18
      254000 -- (-7330.588) (-7320.728) [-7321.620] (-7329.980) * (-7329.548) (-7329.507) [-7326.563] (-7319.710) -- 0:18:15
      254500 -- (-7321.501) (-7331.181) [-7326.485] (-7324.359) * (-7329.498) (-7335.107) [-7327.805] (-7321.932) -- 0:18:15
      255000 -- [-7315.700] (-7327.320) (-7323.881) (-7323.832) * (-7331.764) (-7330.368) (-7328.988) [-7325.035] -- 0:18:15

      Average standard deviation of split frequencies: 0.009749

      255500 -- [-7322.616] (-7320.387) (-7336.883) (-7328.193) * (-7327.334) (-7328.725) (-7321.022) [-7324.359] -- 0:18:15
      256000 -- (-7321.246) [-7324.059] (-7332.903) (-7319.923) * [-7328.081] (-7328.779) (-7317.528) (-7323.816) -- 0:18:12
      256500 -- (-7322.850) (-7333.446) [-7320.917] (-7327.983) * (-7322.871) (-7328.790) [-7319.916] (-7325.258) -- 0:18:12
      257000 -- (-7319.803) [-7319.644] (-7329.258) (-7331.202) * [-7320.545] (-7325.228) (-7316.415) (-7318.339) -- 0:18:12
      257500 -- (-7322.410) (-7322.629) (-7334.094) [-7322.713] * [-7320.694] (-7331.716) (-7325.954) (-7329.937) -- 0:18:12
      258000 -- (-7325.796) (-7327.541) [-7330.782] (-7328.137) * (-7337.765) (-7325.311) [-7324.776] (-7322.829) -- 0:18:09
      258500 -- (-7333.326) (-7329.008) [-7318.738] (-7331.253) * (-7329.414) (-7326.475) [-7324.337] (-7327.501) -- 0:18:10
      259000 -- (-7332.651) (-7319.741) [-7316.376] (-7329.237) * (-7325.726) (-7335.480) [-7329.227] (-7325.464) -- 0:18:10
      259500 -- [-7327.921] (-7328.259) (-7325.895) (-7321.770) * (-7323.568) (-7325.597) [-7326.053] (-7320.897) -- 0:18:10
      260000 -- (-7335.656) [-7337.269] (-7351.232) (-7329.256) * (-7328.738) (-7329.308) (-7332.183) [-7327.607] -- 0:18:07

      Average standard deviation of split frequencies: 0.009468

      260500 -- [-7326.403] (-7340.301) (-7337.616) (-7322.814) * [-7321.228] (-7319.749) (-7331.454) (-7321.298) -- 0:18:07
      261000 -- (-7320.594) [-7324.159] (-7329.195) (-7319.820) * (-7330.548) [-7319.693] (-7330.476) (-7333.714) -- 0:18:07
      261500 -- [-7331.977] (-7320.033) (-7320.609) (-7323.388) * [-7316.758] (-7321.101) (-7324.557) (-7329.296) -- 0:18:04
      262000 -- (-7329.612) [-7317.536] (-7332.233) (-7320.847) * (-7321.027) (-7322.423) (-7325.605) [-7323.716] -- 0:18:04
      262500 -- (-7327.204) (-7325.385) (-7331.176) [-7329.242] * (-7327.086) (-7326.316) [-7329.330] (-7321.541) -- 0:18:04
      263000 -- (-7338.195) (-7327.533) [-7321.514] (-7332.693) * [-7329.676] (-7338.140) (-7325.168) (-7325.541) -- 0:18:04
      263500 -- (-7336.397) (-7333.230) (-7324.141) [-7327.311] * (-7329.150) (-7326.993) (-7333.000) [-7332.971] -- 0:18:01
      264000 -- [-7321.168] (-7324.963) (-7329.397) (-7330.172) * (-7325.532) (-7331.909) (-7350.978) [-7331.144] -- 0:18:01
      264500 -- [-7322.734] (-7326.011) (-7323.719) (-7337.314) * (-7336.686) (-7326.916) (-7329.113) [-7323.096] -- 0:18:01
      265000 -- [-7323.171] (-7322.755) (-7321.274) (-7331.804) * [-7326.129] (-7320.947) (-7319.745) (-7331.412) -- 0:18:01

      Average standard deviation of split frequencies: 0.009799

      265500 -- (-7332.982) [-7323.428] (-7328.968) (-7325.538) * [-7327.826] (-7332.189) (-7329.086) (-7327.797) -- 0:17:58
      266000 -- (-7329.560) [-7321.530] (-7318.182) (-7333.100) * (-7328.964) (-7334.183) [-7318.059] (-7331.451) -- 0:17:58
      266500 -- [-7325.042] (-7321.501) (-7323.953) (-7336.394) * (-7326.515) (-7323.843) [-7326.873] (-7330.141) -- 0:17:58
      267000 -- (-7328.895) (-7337.395) [-7324.487] (-7326.891) * (-7325.779) (-7320.583) [-7323.730] (-7318.411) -- 0:17:58
      267500 -- (-7322.739) (-7336.720) [-7334.073] (-7323.931) * (-7326.167) [-7320.577] (-7334.374) (-7323.733) -- 0:17:56
      268000 -- (-7329.776) (-7328.997) (-7331.831) [-7317.769] * [-7318.617] (-7329.990) (-7336.319) (-7323.962) -- 0:17:56
      268500 -- (-7331.798) (-7328.271) (-7336.609) [-7327.464] * (-7320.266) [-7318.209] (-7328.699) (-7328.856) -- 0:17:56
      269000 -- (-7324.585) (-7335.947) [-7329.024] (-7337.882) * (-7331.070) (-7330.893) (-7332.339) [-7329.743] -- 0:17:56
      269500 -- (-7335.903) (-7322.449) (-7329.500) [-7320.390] * (-7329.428) [-7328.228] (-7335.761) (-7326.428) -- 0:17:53
      270000 -- [-7327.852] (-7327.245) (-7328.043) (-7333.119) * (-7331.295) (-7321.419) (-7335.092) [-7318.955] -- 0:17:53

      Average standard deviation of split frequencies: 0.010143

      270500 -- (-7327.888) (-7334.200) (-7327.738) [-7319.375] * (-7335.758) [-7322.863] (-7328.516) (-7325.958) -- 0:17:53
      271000 -- (-7327.332) (-7338.134) (-7322.308) [-7320.995] * [-7314.646] (-7326.560) (-7339.000) (-7321.941) -- 0:17:50
      271500 -- (-7325.125) (-7326.385) (-7321.544) [-7330.646] * [-7319.683] (-7324.028) (-7327.187) (-7323.216) -- 0:17:50
      272000 -- (-7324.270) [-7318.097] (-7326.160) (-7329.769) * (-7321.845) [-7331.409] (-7321.835) (-7314.735) -- 0:17:50
      272500 -- [-7325.739] (-7321.304) (-7326.899) (-7334.028) * (-7323.285) (-7337.889) (-7325.565) [-7317.470] -- 0:17:50
      273000 -- (-7333.558) (-7330.280) [-7324.897] (-7322.530) * (-7319.847) (-7333.902) [-7317.211] (-7323.510) -- 0:17:47
      273500 -- [-7323.126] (-7331.640) (-7350.684) (-7331.145) * (-7331.682) (-7328.071) [-7321.027] (-7329.921) -- 0:17:47
      274000 -- (-7321.375) (-7329.868) (-7328.015) [-7328.365] * (-7321.999) (-7327.791) [-7319.542] (-7324.251) -- 0:17:47
      274500 -- (-7328.742) (-7329.477) (-7332.107) [-7314.614] * (-7329.854) (-7319.457) [-7322.947] (-7322.864) -- 0:17:47
      275000 -- (-7322.813) (-7324.359) (-7340.174) [-7321.184] * (-7327.086) (-7331.263) [-7323.188] (-7334.643) -- 0:17:45

      Average standard deviation of split frequencies: 0.010851

      275500 -- [-7323.825] (-7321.115) (-7328.042) (-7326.717) * (-7332.045) [-7324.365] (-7330.583) (-7328.925) -- 0:17:45
      276000 -- (-7331.583) [-7318.575] (-7327.233) (-7328.215) * (-7331.428) [-7327.517] (-7327.017) (-7336.651) -- 0:17:45
      276500 -- [-7326.812] (-7327.776) (-7325.406) (-7337.737) * [-7325.198] (-7335.856) (-7328.607) (-7330.362) -- 0:17:44
      277000 -- (-7327.591) (-7329.293) [-7324.979] (-7345.433) * (-7339.258) (-7334.235) (-7324.357) [-7316.871] -- 0:17:42
      277500 -- (-7324.197) [-7326.211] (-7329.227) (-7330.398) * (-7329.534) [-7324.641] (-7324.780) (-7332.143) -- 0:17:42
      278000 -- (-7330.328) [-7323.188] (-7325.000) (-7325.588) * [-7335.139] (-7328.234) (-7325.958) (-7324.254) -- 0:17:42
      278500 -- [-7323.448] (-7337.621) (-7317.956) (-7320.269) * [-7323.679] (-7336.973) (-7336.238) (-7315.861) -- 0:17:39
      279000 -- (-7320.939) (-7328.976) [-7320.105] (-7327.930) * (-7326.325) (-7333.775) (-7329.694) [-7328.057] -- 0:17:39
      279500 -- (-7321.534) (-7327.427) (-7329.665) [-7328.954] * (-7325.160) (-7319.096) [-7318.625] (-7327.109) -- 0:17:39
      280000 -- (-7328.932) (-7316.937) (-7326.626) [-7319.426] * (-7338.662) (-7327.577) (-7320.634) [-7328.562] -- 0:17:39

      Average standard deviation of split frequencies: 0.009287

      280500 -- (-7327.591) [-7330.802] (-7328.450) (-7325.875) * (-7342.858) (-7324.301) [-7334.446] (-7332.978) -- 0:17:36
      281000 -- (-7320.094) (-7318.467) (-7325.997) [-7321.893] * (-7328.081) (-7321.595) (-7326.125) [-7326.951] -- 0:17:36
      281500 -- [-7318.924] (-7326.105) (-7327.028) (-7340.099) * (-7334.217) [-7325.355] (-7330.729) (-7322.385) -- 0:17:36
      282000 -- [-7327.364] (-7330.386) (-7329.908) (-7327.150) * (-7333.736) [-7323.333] (-7333.098) (-7329.708) -- 0:17:36
      282500 -- (-7339.819) [-7329.853] (-7328.095) (-7323.875) * [-7329.221] (-7327.765) (-7335.421) (-7336.515) -- 0:17:34
      283000 -- (-7328.805) (-7329.858) [-7329.941] (-7315.837) * [-7319.407] (-7325.141) (-7332.491) (-7329.783) -- 0:17:33
      283500 -- [-7328.822] (-7323.435) (-7328.716) (-7329.641) * [-7330.536] (-7329.212) (-7337.346) (-7331.913) -- 0:17:33
      284000 -- (-7330.975) [-7326.462] (-7328.189) (-7320.004) * (-7324.082) (-7324.151) (-7335.957) [-7317.971] -- 0:17:33
      284500 -- [-7322.786] (-7322.116) (-7328.062) (-7327.376) * [-7325.146] (-7324.860) (-7331.046) (-7327.229) -- 0:17:31
      285000 -- (-7322.044) [-7318.511] (-7320.424) (-7343.672) * (-7322.318) (-7331.752) (-7333.545) [-7325.353] -- 0:17:31

      Average standard deviation of split frequencies: 0.010374

      285500 -- (-7318.366) [-7325.763] (-7332.732) (-7338.047) * (-7325.157) (-7330.287) [-7323.663] (-7321.461) -- 0:17:31
      286000 -- (-7324.833) [-7326.369] (-7339.406) (-7328.489) * [-7323.635] (-7341.656) (-7316.221) (-7315.191) -- 0:17:31
      286500 -- (-7329.764) (-7325.733) (-7332.000) [-7335.681] * (-7328.579) (-7334.237) (-7325.578) [-7323.724] -- 0:17:28
      287000 -- (-7329.127) (-7314.498) [-7336.155] (-7339.058) * (-7333.251) (-7328.539) (-7326.738) [-7324.956] -- 0:17:28
      287500 -- [-7329.115] (-7320.622) (-7321.624) (-7323.717) * (-7333.730) [-7321.639] (-7331.262) (-7328.302) -- 0:17:28
      288000 -- (-7322.789) [-7319.178] (-7315.951) (-7324.486) * (-7329.615) [-7318.895] (-7348.947) (-7326.186) -- 0:17:28
      288500 -- [-7324.968] (-7329.332) (-7329.936) (-7316.349) * (-7329.901) (-7322.315) (-7339.293) [-7328.749] -- 0:17:25
      289000 -- (-7321.465) (-7320.382) (-7331.740) [-7321.659] * [-7319.311] (-7318.432) (-7327.761) (-7321.416) -- 0:17:25
      289500 -- (-7330.785) (-7325.146) [-7338.130] (-7319.931) * [-7325.997] (-7321.705) (-7325.602) (-7317.864) -- 0:17:25
      290000 -- [-7324.610] (-7333.758) (-7326.691) (-7323.990) * (-7326.653) (-7327.911) (-7324.633) [-7320.161] -- 0:17:25

      Average standard deviation of split frequencies: 0.010494

      290500 -- (-7327.773) (-7319.866) (-7327.521) [-7324.792] * [-7334.649] (-7323.389) (-7332.640) (-7322.031) -- 0:17:22
      291000 -- (-7325.780) [-7333.167] (-7327.775) (-7316.326) * (-7320.477) [-7325.462] (-7334.703) (-7319.283) -- 0:17:22
      291500 -- (-7320.264) (-7326.330) (-7326.948) [-7312.497] * [-7330.297] (-7327.616) (-7319.495) (-7328.786) -- 0:17:22
      292000 -- (-7327.307) (-7331.359) (-7335.726) [-7314.439] * [-7326.933] (-7332.059) (-7325.238) (-7322.679) -- 0:17:20
      292500 -- [-7323.334] (-7326.258) (-7332.098) (-7321.779) * (-7323.683) (-7334.520) [-7324.270] (-7326.777) -- 0:17:20
      293000 -- (-7326.838) (-7330.680) (-7337.842) [-7328.198] * (-7330.640) (-7323.691) [-7324.261] (-7330.781) -- 0:17:19
      293500 -- (-7330.640) (-7326.730) (-7332.846) [-7326.933] * (-7326.556) (-7324.006) [-7324.156] (-7326.057) -- 0:17:19
      294000 -- (-7324.252) [-7325.798] (-7334.760) (-7325.524) * (-7330.555) (-7323.232) (-7318.396) [-7335.189] -- 0:17:17
      294500 -- (-7326.228) [-7317.900] (-7331.381) (-7318.802) * (-7322.636) (-7322.340) (-7324.689) [-7323.760] -- 0:17:17
      295000 -- (-7328.699) (-7322.396) (-7334.776) [-7324.697] * (-7331.984) (-7325.235) (-7319.641) [-7323.581] -- 0:17:17

      Average standard deviation of split frequencies: 0.010211

      295500 -- (-7327.462) (-7327.977) (-7328.027) [-7322.892] * (-7330.513) [-7324.109] (-7321.212) (-7325.520) -- 0:17:17
      296000 -- (-7330.189) [-7322.644] (-7321.234) (-7321.715) * [-7325.051] (-7327.808) (-7322.102) (-7330.012) -- 0:17:14
      296500 -- (-7325.833) [-7333.998] (-7333.381) (-7317.676) * (-7349.222) (-7327.796) (-7328.264) [-7319.699] -- 0:17:14
      297000 -- (-7320.741) (-7330.606) [-7334.294] (-7324.030) * (-7331.875) (-7316.412) [-7329.452] (-7329.681) -- 0:17:14
      297500 -- [-7327.055] (-7319.457) (-7320.663) (-7327.113) * (-7343.413) [-7319.470] (-7325.454) (-7329.858) -- 0:17:14
      298000 -- (-7332.180) [-7319.238] (-7322.107) (-7329.114) * (-7333.460) (-7325.335) [-7319.559] (-7325.789) -- 0:17:11
      298500 -- [-7323.238] (-7325.400) (-7325.916) (-7340.348) * (-7323.126) (-7339.097) [-7330.954] (-7324.292) -- 0:17:11
      299000 -- (-7349.802) (-7324.647) (-7327.828) [-7325.948] * [-7312.801] (-7334.461) (-7324.500) (-7330.191) -- 0:17:11
      299500 -- (-7338.305) (-7321.601) [-7326.221] (-7330.105) * (-7315.466) [-7317.733] (-7331.485) (-7334.439) -- 0:17:11
      300000 -- (-7325.549) [-7316.648] (-7333.804) (-7330.370) * (-7335.171) [-7320.873] (-7327.992) (-7321.838) -- 0:17:09

      Average standard deviation of split frequencies: 0.009038

      300500 -- (-7314.855) (-7323.885) (-7330.537) [-7329.472] * (-7328.470) [-7324.551] (-7327.120) (-7327.741) -- 0:17:08
      301000 -- (-7326.603) [-7321.230] (-7324.903) (-7324.222) * [-7325.366] (-7323.728) (-7335.396) (-7323.391) -- 0:17:08
      301500 -- (-7324.106) (-7332.099) (-7319.193) [-7322.701] * (-7332.302) (-7317.357) (-7332.157) [-7328.174] -- 0:17:08
      302000 -- [-7324.495] (-7335.936) (-7323.101) (-7329.677) * [-7327.562] (-7325.034) (-7333.076) (-7323.107) -- 0:17:06
      302500 -- [-7326.921] (-7330.549) (-7333.283) (-7322.688) * (-7322.732) [-7329.859] (-7337.055) (-7318.487) -- 0:17:06
      303000 -- [-7324.374] (-7324.323) (-7327.540) (-7330.606) * [-7322.267] (-7340.397) (-7324.741) (-7335.803) -- 0:17:05
      303500 -- (-7336.963) (-7315.600) (-7330.073) [-7317.133] * (-7332.050) (-7328.327) [-7329.594] (-7319.999) -- 0:17:03
      304000 -- (-7325.278) (-7318.482) (-7320.496) [-7334.459] * (-7330.345) (-7335.334) [-7329.218] (-7319.855) -- 0:17:03
      304500 -- (-7328.430) (-7314.370) [-7330.379] (-7324.446) * [-7333.759] (-7341.948) (-7327.498) (-7331.168) -- 0:17:03
      305000 -- (-7328.409) (-7323.921) [-7329.845] (-7325.015) * (-7316.580) (-7330.960) [-7317.933] (-7334.562) -- 0:17:03

      Average standard deviation of split frequencies: 0.008971

      305500 -- (-7329.009) (-7330.772) (-7324.268) [-7323.958] * (-7324.065) (-7330.767) [-7326.544] (-7318.234) -- 0:17:00
      306000 -- (-7333.680) (-7327.462) [-7330.474] (-7315.553) * (-7321.596) (-7329.447) (-7321.828) [-7320.402] -- 0:17:00
      306500 -- [-7320.944] (-7324.832) (-7322.836) (-7326.268) * (-7325.651) (-7331.627) [-7327.001] (-7326.565) -- 0:17:00
      307000 -- (-7322.481) (-7330.658) (-7322.189) [-7325.200] * [-7324.391] (-7329.746) (-7324.149) (-7323.969) -- 0:17:00
      307500 -- (-7326.107) [-7322.142] (-7328.403) (-7331.771) * (-7317.837) (-7325.510) (-7323.077) [-7319.847] -- 0:16:57
      308000 -- [-7322.238] (-7326.425) (-7321.927) (-7326.701) * (-7336.247) [-7326.501] (-7332.044) (-7331.328) -- 0:16:57
      308500 -- (-7321.028) [-7329.725] (-7324.435) (-7333.817) * [-7328.265] (-7329.924) (-7328.351) (-7330.886) -- 0:16:57
      309000 -- (-7336.480) [-7318.084] (-7323.044) (-7328.605) * (-7325.775) [-7325.134] (-7334.389) (-7324.645) -- 0:16:55
      309500 -- (-7327.775) (-7322.929) (-7326.155) [-7313.897] * (-7331.589) (-7322.805) [-7326.929] (-7334.010) -- 0:16:55
      310000 -- [-7322.999] (-7323.344) (-7336.605) (-7321.582) * (-7325.094) [-7324.324] (-7327.046) (-7318.733) -- 0:16:54

      Average standard deviation of split frequencies: 0.008480

      310500 -- (-7322.849) (-7328.948) [-7329.353] (-7318.044) * (-7328.373) (-7317.757) (-7331.676) [-7327.587] -- 0:16:54
      311000 -- [-7314.543] (-7322.574) (-7328.316) (-7323.406) * (-7345.736) (-7324.560) (-7326.333) [-7320.701] -- 0:16:52
      311500 -- [-7319.733] (-7329.580) (-7317.132) (-7322.619) * (-7328.209) (-7323.277) [-7320.502] (-7324.737) -- 0:16:52
      312000 -- (-7328.964) (-7334.156) (-7322.727) [-7320.522] * (-7319.124) [-7327.606] (-7325.696) (-7322.990) -- 0:16:52
      312500 -- (-7335.451) (-7331.384) (-7318.551) [-7322.924] * (-7319.311) (-7323.325) (-7328.226) [-7324.013] -- 0:16:52
      313000 -- (-7326.367) [-7323.536] (-7320.024) (-7331.935) * [-7328.421] (-7333.399) (-7331.336) (-7332.991) -- 0:16:49
      313500 -- (-7323.048) [-7321.558] (-7322.821) (-7334.366) * (-7328.250) (-7337.795) [-7324.469] (-7328.693) -- 0:16:49
      314000 -- (-7323.263) [-7317.462] (-7330.370) (-7325.666) * (-7324.755) (-7329.814) [-7325.926] (-7327.813) -- 0:16:49
      314500 -- (-7329.725) [-7320.907] (-7328.705) (-7330.912) * (-7323.841) (-7332.607) (-7340.937) [-7326.728] -- 0:16:46
      315000 -- (-7327.301) [-7330.020] (-7329.838) (-7324.578) * (-7325.343) (-7321.186) [-7319.730] (-7332.700) -- 0:16:46

      Average standard deviation of split frequencies: 0.008424

      315500 -- [-7325.614] (-7326.363) (-7327.220) (-7326.125) * [-7329.074] (-7330.466) (-7338.931) (-7330.675) -- 0:16:46
      316000 -- (-7339.052) [-7333.386] (-7328.669) (-7321.463) * (-7325.914) (-7329.404) (-7334.182) [-7329.714] -- 0:16:46
      316500 -- [-7325.545] (-7333.324) (-7333.629) (-7327.152) * (-7327.081) (-7320.330) (-7329.562) [-7322.710] -- 0:16:44
      317000 -- (-7336.554) (-7329.171) [-7320.863] (-7326.833) * [-7324.257] (-7324.458) (-7325.965) (-7318.716) -- 0:16:44
      317500 -- (-7330.677) [-7323.311] (-7330.988) (-7325.815) * (-7327.447) (-7337.578) [-7320.903] (-7325.481) -- 0:16:43
      318000 -- (-7336.410) (-7335.131) [-7326.695] (-7329.687) * (-7328.685) (-7334.066) [-7322.987] (-7327.623) -- 0:16:43
      318500 -- (-7323.323) (-7332.305) [-7324.380] (-7318.032) * [-7323.845] (-7341.974) (-7320.867) (-7323.161) -- 0:16:41
      319000 -- (-7325.384) (-7335.096) (-7331.118) [-7320.851] * (-7317.347) (-7327.424) (-7326.605) [-7320.869] -- 0:16:41
      319500 -- (-7326.488) [-7313.728] (-7324.583) (-7319.292) * [-7319.893] (-7329.073) (-7333.629) (-7321.532) -- 0:16:41
      320000 -- (-7325.659) [-7331.567] (-7320.393) (-7335.434) * [-7322.598] (-7334.991) (-7345.413) (-7332.279) -- 0:16:38

      Average standard deviation of split frequencies: 0.008388

      320500 -- (-7324.041) (-7320.345) (-7323.037) [-7322.230] * (-7319.305) (-7332.051) [-7325.209] (-7324.215) -- 0:16:38
      321000 -- (-7328.732) (-7324.165) [-7317.430] (-7315.924) * (-7320.673) (-7330.986) [-7318.526] (-7318.521) -- 0:16:38
      321500 -- (-7321.625) (-7326.305) [-7327.377] (-7321.589) * (-7319.883) (-7329.613) [-7326.784] (-7324.194) -- 0:16:38
      322000 -- [-7325.777] (-7338.295) (-7327.846) (-7328.108) * (-7335.851) (-7326.655) (-7319.992) [-7321.971] -- 0:16:35
      322500 -- [-7324.063] (-7327.615) (-7319.933) (-7325.854) * (-7338.964) [-7317.349] (-7321.535) (-7323.699) -- 0:16:35
      323000 -- [-7322.390] (-7325.624) (-7321.257) (-7317.777) * (-7331.056) (-7323.835) (-7321.679) [-7324.562] -- 0:16:35
      323500 -- [-7325.967] (-7321.738) (-7329.140) (-7314.918) * (-7325.329) [-7316.118] (-7338.369) (-7322.770) -- 0:16:35
      324000 -- (-7323.726) (-7316.910) (-7335.914) [-7329.822] * (-7332.225) (-7324.082) (-7336.180) [-7323.422] -- 0:16:33
      324500 -- (-7329.393) (-7318.596) (-7335.762) [-7316.527] * [-7315.522] (-7329.704) (-7327.391) (-7320.758) -- 0:16:32
      325000 -- (-7322.367) (-7324.797) (-7327.241) [-7316.730] * [-7323.506] (-7328.650) (-7328.444) (-7330.648) -- 0:16:32

      Average standard deviation of split frequencies: 0.008591

      325500 -- (-7319.924) (-7332.335) (-7333.692) [-7327.640] * [-7328.209] (-7332.168) (-7335.567) (-7327.562) -- 0:16:30
      326000 -- [-7315.912] (-7327.873) (-7342.865) (-7328.927) * (-7322.287) (-7335.056) (-7326.850) [-7321.528] -- 0:16:30
      326500 -- (-7327.366) (-7330.467) (-7341.889) [-7320.912] * (-7326.433) (-7333.473) (-7325.753) [-7329.076] -- 0:16:30
      327000 -- [-7324.369] (-7320.362) (-7342.105) (-7334.373) * (-7323.334) [-7324.827] (-7318.150) (-7334.554) -- 0:16:29
      327500 -- (-7319.555) (-7328.224) (-7334.470) [-7327.265] * (-7322.991) [-7328.006] (-7324.462) (-7321.556) -- 0:16:27
      328000 -- (-7330.666) [-7323.556] (-7329.186) (-7322.511) * [-7323.878] (-7320.655) (-7327.631) (-7327.046) -- 0:16:27
      328500 -- (-7333.435) (-7324.483) (-7325.591) [-7322.501] * (-7323.515) [-7328.167] (-7330.185) (-7330.893) -- 0:16:27
      329000 -- (-7323.814) (-7326.952) (-7331.983) [-7321.822] * (-7328.258) [-7324.621] (-7325.304) (-7331.891) -- 0:16:27
      329500 -- (-7322.977) (-7329.036) (-7336.076) [-7318.226] * (-7332.546) [-7322.399] (-7325.182) (-7318.125) -- 0:16:24
      330000 -- [-7328.649] (-7333.282) (-7328.382) (-7327.672) * (-7332.722) (-7330.031) (-7327.546) [-7316.936] -- 0:16:24

      Average standard deviation of split frequencies: 0.009057

      330500 -- (-7325.136) (-7320.734) (-7324.713) [-7330.577] * (-7323.708) (-7339.408) [-7337.839] (-7324.019) -- 0:16:24
      331000 -- [-7319.803] (-7334.047) (-7322.069) (-7328.284) * (-7330.567) [-7335.955] (-7338.507) (-7321.620) -- 0:16:22
      331500 -- (-7324.226) (-7321.445) (-7325.713) [-7320.960] * (-7324.643) (-7328.754) (-7329.242) [-7329.807] -- 0:16:22
      332000 -- (-7334.927) (-7330.372) [-7322.992] (-7325.007) * (-7320.353) (-7333.088) (-7337.929) [-7327.316] -- 0:16:21
      332500 -- (-7332.423) (-7325.605) (-7322.304) [-7317.211] * [-7320.376] (-7337.845) (-7321.488) (-7315.986) -- 0:16:21
      333000 -- (-7324.540) (-7320.968) (-7324.250) [-7323.450] * (-7327.895) (-7324.240) (-7323.137) [-7328.877] -- 0:16:19
      333500 -- (-7323.329) [-7327.783] (-7331.603) (-7327.295) * (-7322.212) (-7337.810) (-7324.380) [-7320.749] -- 0:16:19
      334000 -- (-7324.089) (-7326.205) (-7330.292) [-7330.444] * [-7316.574] (-7322.237) (-7322.722) (-7334.964) -- 0:16:19
      334500 -- (-7325.523) (-7335.377) (-7319.066) [-7320.566] * (-7320.881) (-7326.700) (-7336.888) [-7323.835] -- 0:16:16
      335000 -- [-7330.540] (-7325.288) (-7326.072) (-7329.850) * (-7326.041) (-7323.029) (-7345.078) [-7321.169] -- 0:16:16

      Average standard deviation of split frequencies: 0.009986

      335500 -- (-7335.054) [-7327.444] (-7329.931) (-7323.713) * (-7326.015) [-7321.442] (-7330.658) (-7323.280) -- 0:16:16
      336000 -- (-7327.290) (-7338.846) (-7318.642) [-7319.812] * (-7325.648) [-7317.263] (-7328.074) (-7320.677) -- 0:16:16
      336500 -- (-7326.072) (-7329.567) [-7321.452] (-7321.457) * (-7336.575) [-7326.933] (-7321.778) (-7336.940) -- 0:16:14
      337000 -- (-7332.057) (-7330.407) [-7320.100] (-7325.509) * (-7326.551) (-7322.553) (-7329.475) [-7324.560] -- 0:16:13
      337500 -- (-7326.741) [-7316.988] (-7315.742) (-7332.484) * (-7327.594) (-7335.465) (-7329.233) [-7334.518] -- 0:16:13
      338000 -- (-7327.801) (-7328.944) (-7329.087) [-7324.374] * (-7331.335) (-7328.572) [-7321.302] (-7324.647) -- 0:16:13
      338500 -- (-7328.531) (-7325.025) (-7327.425) [-7319.977] * (-7325.463) [-7334.557] (-7318.882) (-7323.402) -- 0:16:11
      339000 -- [-7321.601] (-7315.343) (-7325.536) (-7323.462) * [-7327.579] (-7328.860) (-7318.471) (-7326.141) -- 0:16:11
      339500 -- [-7313.599] (-7325.538) (-7316.463) (-7337.168) * (-7319.217) [-7334.463] (-7328.446) (-7328.151) -- 0:16:10
      340000 -- (-7328.592) [-7322.607] (-7318.277) (-7329.200) * [-7319.873] (-7334.545) (-7327.420) (-7320.237) -- 0:16:08

      Average standard deviation of split frequencies: 0.010093

      340500 -- [-7323.187] (-7325.211) (-7335.916) (-7321.791) * (-7324.001) [-7321.870] (-7333.438) (-7330.386) -- 0:16:08
      341000 -- (-7330.409) (-7327.693) [-7322.098] (-7324.707) * (-7322.546) (-7323.163) (-7331.275) [-7334.464] -- 0:16:08
      341500 -- [-7319.866] (-7334.187) (-7326.025) (-7323.447) * [-7327.980] (-7323.277) (-7340.431) (-7325.814) -- 0:16:07
      342000 -- (-7327.443) [-7321.934] (-7322.850) (-7329.510) * (-7330.163) [-7324.578] (-7332.524) (-7315.111) -- 0:16:05
      342500 -- [-7322.696] (-7331.851) (-7325.611) (-7323.171) * (-7325.291) (-7325.734) (-7317.487) [-7320.903] -- 0:16:05
      343000 -- [-7319.888] (-7318.077) (-7326.187) (-7329.245) * (-7336.410) (-7328.023) (-7333.986) [-7320.438] -- 0:16:05
      343500 -- (-7322.620) (-7337.405) [-7332.397] (-7326.011) * (-7335.558) [-7323.794] (-7322.727) (-7319.960) -- 0:16:05
      344000 -- [-7328.799] (-7332.729) (-7327.887) (-7330.814) * (-7322.217) (-7327.738) [-7327.543] (-7318.530) -- 0:16:03
      344500 -- (-7320.058) (-7317.115) [-7322.973] (-7327.200) * [-7323.824] (-7332.741) (-7327.820) (-7318.874) -- 0:16:02
      345000 -- (-7325.268) [-7319.451] (-7327.554) (-7320.048) * (-7319.403) [-7328.079] (-7338.123) (-7326.734) -- 0:16:02

      Average standard deviation of split frequencies: 0.009297

      345500 -- [-7328.174] (-7321.063) (-7329.281) (-7319.242) * [-7317.463] (-7328.090) (-7332.682) (-7324.294) -- 0:16:02
      346000 -- [-7321.967] (-7331.816) (-7333.941) (-7321.651) * (-7326.429) [-7322.594] (-7328.355) (-7329.201) -- 0:16:00
      346500 -- (-7331.056) [-7323.376] (-7322.395) (-7329.376) * (-7330.462) (-7333.997) [-7326.736] (-7328.672) -- 0:15:59
      347000 -- (-7328.788) (-7329.528) [-7325.732] (-7333.333) * (-7330.255) (-7330.658) (-7327.144) [-7319.317] -- 0:15:59
      347500 -- [-7327.065] (-7333.594) (-7336.125) (-7330.831) * (-7326.611) (-7331.976) [-7325.111] (-7322.930) -- 0:15:59
      348000 -- (-7333.219) (-7325.599) [-7332.008] (-7324.500) * [-7316.019] (-7322.240) (-7324.501) (-7328.191) -- 0:15:57
      348500 -- (-7327.741) [-7322.577] (-7326.880) (-7318.773) * (-7319.610) [-7328.582] (-7325.297) (-7336.191) -- 0:15:57
      349000 -- (-7327.553) (-7324.080) (-7331.486) [-7318.026] * (-7314.593) (-7327.489) [-7319.373] (-7325.299) -- 0:15:56
      349500 -- (-7321.989) [-7319.171] (-7326.997) (-7322.428) * (-7320.594) [-7323.234] (-7326.639) (-7322.863) -- 0:15:56
      350000 -- (-7321.401) (-7320.956) [-7325.497] (-7328.918) * (-7324.672) [-7320.938] (-7327.397) (-7332.186) -- 0:15:54

      Average standard deviation of split frequencies: 0.009489

      350500 -- [-7322.477] (-7323.434) (-7324.699) (-7327.493) * (-7320.601) [-7330.692] (-7330.967) (-7331.844) -- 0:15:54
      351000 -- (-7325.420) (-7324.402) (-7329.422) [-7321.678] * (-7317.229) (-7326.248) [-7327.811] (-7321.281) -- 0:15:54
      351500 -- (-7326.452) [-7315.326] (-7334.679) (-7322.221) * (-7320.641) (-7335.241) [-7324.045] (-7330.689) -- 0:15:53
      352000 -- (-7331.038) (-7328.397) (-7325.978) [-7321.756] * (-7311.987) (-7329.298) [-7316.659] (-7327.611) -- 0:15:51
      352500 -- [-7329.951] (-7339.271) (-7327.239) (-7334.477) * (-7332.636) (-7331.735) [-7323.000] (-7323.970) -- 0:15:51
      353000 -- [-7318.719] (-7327.305) (-7328.347) (-7324.793) * (-7327.008) [-7324.793] (-7314.067) (-7324.914) -- 0:15:51
      353500 -- (-7322.612) [-7321.697] (-7326.178) (-7333.556) * (-7325.463) (-7322.721) (-7324.008) [-7328.020] -- 0:15:51
      354000 -- (-7317.946) (-7327.630) [-7323.201] (-7336.547) * [-7322.666] (-7331.607) (-7333.635) (-7323.464) -- 0:15:48
      354500 -- (-7324.297) (-7333.557) (-7329.012) [-7329.836] * [-7324.695] (-7321.501) (-7324.039) (-7330.115) -- 0:15:48
      355000 -- (-7323.011) [-7317.621] (-7333.508) (-7326.528) * (-7325.887) [-7320.596] (-7334.507) (-7340.482) -- 0:15:48

      Average standard deviation of split frequencies: 0.008958

      355500 -- (-7325.180) [-7331.237] (-7333.907) (-7316.489) * [-7317.509] (-7334.290) (-7343.872) (-7346.349) -- 0:15:48
      356000 -- (-7329.520) (-7329.317) (-7346.558) [-7316.265] * (-7333.350) [-7318.981] (-7322.252) (-7343.477) -- 0:15:46
      356500 -- (-7321.081) (-7329.470) (-7331.903) [-7316.998] * (-7327.137) (-7328.471) [-7319.486] (-7342.501) -- 0:15:45
      357000 -- [-7325.645] (-7323.919) (-7337.713) (-7321.911) * (-7326.684) (-7328.566) (-7327.674) [-7328.679] -- 0:15:45
      357500 -- [-7323.157] (-7326.109) (-7324.144) (-7328.932) * [-7328.023] (-7325.667) (-7330.946) (-7322.168) -- 0:15:45
      358000 -- [-7327.660] (-7331.050) (-7323.837) (-7331.176) * (-7319.188) (-7326.727) (-7326.272) [-7325.743] -- 0:15:43
      358500 -- [-7322.030] (-7332.003) (-7324.175) (-7327.852) * (-7339.188) [-7330.465] (-7331.103) (-7326.487) -- 0:15:43
      359000 -- (-7321.107) (-7327.477) [-7320.547] (-7320.213) * (-7332.939) (-7336.633) [-7327.196] (-7324.269) -- 0:15:42
      359500 -- [-7320.795] (-7323.302) (-7323.065) (-7316.356) * [-7328.852] (-7331.921) (-7338.596) (-7326.493) -- 0:15:42
      360000 -- (-7323.312) (-7329.767) (-7324.421) [-7323.230] * [-7324.292] (-7338.435) (-7326.165) (-7323.701) -- 0:15:40

      Average standard deviation of split frequencies: 0.008688

      360500 -- (-7331.591) [-7332.417] (-7320.618) (-7326.252) * (-7332.049) (-7352.395) (-7321.467) [-7324.698] -- 0:15:40
      361000 -- (-7319.630) (-7328.299) [-7326.404] (-7326.338) * (-7326.240) [-7329.829] (-7318.697) (-7330.987) -- 0:15:39
      361500 -- (-7317.805) [-7325.485] (-7325.936) (-7327.699) * (-7323.269) (-7332.687) (-7322.426) [-7325.234] -- 0:15:39
      362000 -- (-7335.250) (-7323.727) [-7327.429] (-7336.844) * (-7324.355) [-7330.246] (-7324.788) (-7322.098) -- 0:15:39
      362500 -- (-7319.552) [-7318.412] (-7320.086) (-7327.441) * [-7318.228] (-7327.196) (-7328.395) (-7312.739) -- 0:15:37
      363000 -- (-7324.750) [-7320.970] (-7326.076) (-7322.741) * (-7324.438) [-7325.321] (-7327.144) (-7326.793) -- 0:15:37
      363500 -- [-7319.201] (-7325.438) (-7321.714) (-7322.411) * [-7318.025] (-7329.498) (-7321.141) (-7325.140) -- 0:15:36
      364000 -- (-7326.638) [-7323.615] (-7326.903) (-7321.297) * (-7323.794) [-7330.559] (-7327.762) (-7323.282) -- 0:15:36
      364500 -- (-7326.860) (-7319.001) (-7332.705) [-7316.623] * (-7325.845) (-7324.827) [-7322.500] (-7332.216) -- 0:15:34
      365000 -- (-7335.942) (-7327.530) [-7326.631] (-7324.620) * [-7322.057] (-7337.680) (-7323.462) (-7318.070) -- 0:15:34

      Average standard deviation of split frequencies: 0.008789

      365500 -- (-7325.557) (-7317.512) [-7331.914] (-7317.021) * (-7327.421) (-7329.070) (-7321.835) [-7326.388] -- 0:15:33
      366000 -- (-7328.051) [-7324.454] (-7332.238) (-7328.534) * (-7325.792) (-7327.966) (-7329.425) [-7319.040] -- 0:15:33
      366500 -- (-7326.597) [-7318.034] (-7317.968) (-7330.482) * [-7327.548] (-7331.504) (-7320.100) (-7320.425) -- 0:15:31
      367000 -- [-7324.132] (-7322.111) (-7325.027) (-7333.901) * [-7325.362] (-7323.324) (-7327.575) (-7321.495) -- 0:15:31
      367500 -- [-7315.576] (-7317.096) (-7335.481) (-7321.581) * [-7324.060] (-7331.158) (-7319.286) (-7321.633) -- 0:15:31
      368000 -- (-7316.866) (-7326.779) (-7319.386) [-7317.370] * (-7321.738) (-7329.886) [-7319.469] (-7321.017) -- 0:15:30
      368500 -- (-7326.738) (-7331.280) (-7333.810) [-7317.795] * (-7328.473) (-7326.914) (-7322.639) [-7325.021] -- 0:15:28
      369000 -- (-7329.230) (-7323.422) [-7330.385] (-7315.926) * [-7323.075] (-7336.446) (-7335.335) (-7334.558) -- 0:15:28
      369500 -- (-7329.200) (-7324.707) (-7322.048) [-7322.711] * (-7323.185) (-7326.581) [-7322.883] (-7329.672) -- 0:15:28
      370000 -- (-7333.258) (-7323.233) [-7325.614] (-7318.322) * [-7318.111] (-7318.340) (-7322.827) (-7328.426) -- 0:15:27

      Average standard deviation of split frequencies: 0.007631

      370500 -- [-7318.118] (-7327.775) (-7332.731) (-7324.581) * (-7326.071) [-7322.792] (-7332.337) (-7329.572) -- 0:15:25
      371000 -- (-7327.410) [-7325.110] (-7322.444) (-7320.788) * (-7328.391) (-7330.358) [-7328.242] (-7329.553) -- 0:15:25
      371500 -- (-7319.684) (-7331.363) (-7333.312) [-7324.649] * [-7322.906] (-7334.707) (-7322.891) (-7336.410) -- 0:15:25
      372000 -- (-7325.320) [-7323.748] (-7334.923) (-7324.201) * (-7331.416) (-7330.552) [-7321.007] (-7328.491) -- 0:15:25
      372500 -- (-7330.745) [-7321.985] (-7332.285) (-7333.169) * (-7328.686) (-7335.598) [-7318.068] (-7322.455) -- 0:15:23
      373000 -- (-7326.381) (-7336.350) (-7321.954) [-7323.381] * [-7318.622] (-7333.677) (-7322.859) (-7324.750) -- 0:15:22
      373500 -- (-7332.603) (-7324.401) [-7332.768] (-7333.255) * (-7336.200) (-7325.062) [-7318.658] (-7331.869) -- 0:15:22
      374000 -- (-7328.614) [-7328.962] (-7329.962) (-7328.555) * (-7327.833) (-7336.000) (-7330.043) [-7320.657] -- 0:15:22
      374500 -- (-7330.244) (-7324.595) [-7317.732] (-7324.253) * (-7325.240) (-7338.832) (-7327.830) [-7324.213] -- 0:15:20
      375000 -- [-7328.300] (-7325.793) (-7318.450) (-7328.813) * (-7331.655) (-7329.843) [-7322.049] (-7330.880) -- 0:15:20

      Average standard deviation of split frequencies: 0.007522

      375500 -- [-7326.195] (-7329.807) (-7320.909) (-7333.435) * [-7323.850] (-7330.488) (-7338.579) (-7329.293) -- 0:15:19
      376000 -- [-7329.725] (-7324.274) (-7328.366) (-7326.827) * (-7324.788) (-7333.068) (-7322.410) [-7326.611] -- 0:15:19
      376500 -- (-7324.594) [-7321.132] (-7328.729) (-7338.434) * [-7327.543] (-7317.856) (-7324.310) (-7324.244) -- 0:15:17
      377000 -- (-7321.031) (-7326.592) [-7328.439] (-7328.708) * (-7326.251) [-7325.553] (-7311.792) (-7322.372) -- 0:15:17
      377500 -- (-7323.704) [-7317.003] (-7331.989) (-7335.030) * (-7331.435) (-7324.103) (-7325.761) [-7325.523] -- 0:15:16
      378000 -- (-7330.825) [-7320.238] (-7324.853) (-7330.257) * [-7326.191] (-7332.924) (-7320.112) (-7327.036) -- 0:15:16
      378500 -- (-7329.621) [-7320.386] (-7337.125) (-7324.507) * [-7327.174] (-7332.989) (-7315.386) (-7330.823) -- 0:15:14
      379000 -- (-7318.977) (-7324.890) (-7327.294) [-7324.206] * (-7329.143) (-7328.626) [-7322.792] (-7338.808) -- 0:15:14
      379500 -- (-7330.532) [-7330.959] (-7328.095) (-7323.531) * (-7331.751) [-7328.896] (-7327.782) (-7322.691) -- 0:15:13
      380000 -- [-7319.048] (-7330.614) (-7330.912) (-7330.508) * [-7324.534] (-7337.351) (-7333.806) (-7317.163) -- 0:15:13

      Average standard deviation of split frequencies: 0.008814

      380500 -- [-7327.995] (-7323.050) (-7325.299) (-7339.362) * (-7327.756) (-7324.116) [-7328.531] (-7318.825) -- 0:15:13
      381000 -- (-7324.279) (-7318.921) [-7328.561] (-7326.404) * [-7330.458] (-7331.557) (-7321.199) (-7320.821) -- 0:15:11
      381500 -- (-7319.108) [-7325.848] (-7325.854) (-7324.783) * (-7332.542) (-7330.704) [-7324.881] (-7331.915) -- 0:15:11
      382000 -- (-7331.208) [-7327.177] (-7332.698) (-7323.300) * (-7318.601) (-7337.358) [-7323.410] (-7328.193) -- 0:15:10
      382500 -- (-7325.873) (-7329.223) (-7331.682) [-7318.398] * [-7320.049] (-7338.471) (-7331.240) (-7339.333) -- 0:15:10
      383000 -- (-7322.159) [-7327.832] (-7337.574) (-7324.024) * (-7323.630) (-7331.377) [-7331.295] (-7328.571) -- 0:15:08
      383500 -- (-7314.841) [-7328.720] (-7335.033) (-7321.084) * (-7330.108) [-7326.446] (-7319.615) (-7324.782) -- 0:15:08
      384000 -- [-7319.722] (-7331.072) (-7318.942) (-7331.988) * (-7323.068) [-7315.719] (-7321.194) (-7322.869) -- 0:15:07
      384500 -- [-7321.823] (-7328.513) (-7329.366) (-7323.412) * (-7328.095) [-7325.580] (-7328.981) (-7321.385) -- 0:15:07
      385000 -- (-7331.745) [-7322.770] (-7316.045) (-7320.508) * (-7335.277) (-7333.246) [-7321.935] (-7317.218) -- 0:15:05

      Average standard deviation of split frequencies: 0.008477

      385500 -- [-7322.406] (-7333.700) (-7324.843) (-7330.030) * (-7336.768) (-7325.150) (-7323.666) [-7324.328] -- 0:15:05
      386000 -- (-7327.853) (-7326.743) [-7329.768] (-7339.362) * (-7330.983) [-7325.597] (-7327.320) (-7320.152) -- 0:15:05
      386500 -- (-7324.641) [-7323.090] (-7318.893) (-7325.869) * (-7333.992) (-7327.055) [-7322.812] (-7337.154) -- 0:15:04
      387000 -- [-7327.212] (-7330.880) (-7319.915) (-7345.073) * (-7335.116) [-7324.616] (-7326.381) (-7328.352) -- 0:15:02
      387500 -- (-7329.276) [-7321.947] (-7325.184) (-7328.309) * (-7322.037) [-7324.548] (-7331.163) (-7331.782) -- 0:15:02
      388000 -- (-7326.911) (-7322.012) (-7320.497) [-7326.416] * (-7326.631) (-7327.383) [-7331.968] (-7323.247) -- 0:15:02
      388500 -- (-7324.783) [-7319.656] (-7325.324) (-7340.167) * [-7323.136] (-7330.022) (-7323.734) (-7327.719) -- 0:15:01
      389000 -- (-7329.289) (-7314.410) (-7322.260) [-7323.369] * [-7320.761] (-7336.592) (-7336.387) (-7328.750) -- 0:15:00
      389500 -- (-7323.710) (-7321.405) (-7326.764) [-7321.645] * (-7324.088) (-7326.260) [-7323.849] (-7337.034) -- 0:14:59
      390000 -- (-7334.447) [-7323.684] (-7323.142) (-7334.054) * [-7323.729] (-7326.623) (-7328.627) (-7324.930) -- 0:14:59

      Average standard deviation of split frequencies: 0.008944

      390500 -- [-7319.895] (-7338.197) (-7339.475) (-7336.805) * (-7321.754) [-7321.918] (-7327.354) (-7327.240) -- 0:14:59
      391000 -- (-7320.772) [-7329.100] (-7331.604) (-7324.906) * (-7327.544) [-7328.647] (-7333.066) (-7332.801) -- 0:14:57
      391500 -- (-7327.339) [-7321.255] (-7335.417) (-7333.697) * (-7329.400) (-7331.074) (-7330.177) [-7325.296] -- 0:14:56
      392000 -- (-7331.884) (-7321.339) (-7324.528) [-7330.678] * [-7335.595] (-7327.251) (-7327.394) (-7329.112) -- 0:14:56
      392500 -- (-7325.991) [-7320.431] (-7330.332) (-7323.118) * [-7321.931] (-7330.327) (-7335.213) (-7324.309) -- 0:14:56
      393000 -- (-7325.313) [-7323.657] (-7322.051) (-7321.481) * (-7323.433) (-7332.412) (-7340.635) [-7315.772] -- 0:14:54
      393500 -- [-7330.759] (-7321.103) (-7322.937) (-7345.883) * [-7320.162] (-7320.591) (-7320.627) (-7330.859) -- 0:14:53
      394000 -- [-7325.449] (-7326.690) (-7323.359) (-7336.333) * [-7316.696] (-7327.608) (-7328.163) (-7332.097) -- 0:14:53
      394500 -- (-7322.981) [-7332.198] (-7328.721) (-7327.542) * (-7328.578) (-7331.247) [-7326.482] (-7323.328) -- 0:14:53
      395000 -- [-7317.215] (-7336.126) (-7332.574) (-7327.984) * [-7323.195] (-7325.333) (-7321.426) (-7331.544) -- 0:14:51

      Average standard deviation of split frequencies: 0.008403

      395500 -- (-7331.247) (-7322.213) (-7319.046) [-7330.342] * (-7329.590) (-7329.121) (-7318.322) [-7326.900] -- 0:14:51
      396000 -- (-7317.015) (-7319.308) (-7328.238) [-7322.969] * (-7325.244) [-7322.161] (-7324.498) (-7342.096) -- 0:14:50
      396500 -- (-7325.535) (-7324.740) [-7319.850] (-7334.444) * (-7328.494) (-7321.363) (-7329.068) [-7322.839] -- 0:14:50
      397000 -- [-7320.099] (-7324.922) (-7322.426) (-7339.271) * (-7338.688) [-7318.372] (-7334.220) (-7323.319) -- 0:14:48
      397500 -- (-7324.313) [-7320.857] (-7323.907) (-7340.459) * (-7328.477) [-7320.950] (-7329.458) (-7324.871) -- 0:14:48
      398000 -- (-7336.500) (-7330.485) [-7327.269] (-7332.949) * (-7330.283) (-7332.966) [-7325.153] (-7318.306) -- 0:14:47
      398500 -- [-7334.632] (-7328.895) (-7322.493) (-7331.789) * (-7324.410) (-7327.526) (-7327.440) [-7314.684] -- 0:14:47
      399000 -- (-7320.806) [-7326.511] (-7329.522) (-7334.158) * (-7334.657) (-7329.663) [-7325.052] (-7326.002) -- 0:14:45
      399500 -- (-7327.114) (-7338.354) (-7322.800) [-7324.969] * (-7328.961) (-7324.608) (-7333.003) [-7319.538] -- 0:14:45
      400000 -- (-7325.026) (-7326.878) [-7322.912] (-7334.245) * (-7335.301) [-7325.010] (-7328.193) (-7324.517) -- 0:14:45

      Average standard deviation of split frequencies: 0.008790

      400500 -- (-7321.961) [-7327.085] (-7327.276) (-7326.167) * (-7326.820) (-7336.425) [-7327.559] (-7326.123) -- 0:14:44
      401000 -- (-7342.453) [-7322.528] (-7323.505) (-7321.175) * (-7328.885) (-7326.077) (-7333.205) [-7325.877] -- 0:14:42
      401500 -- (-7339.541) [-7319.693] (-7325.571) (-7327.381) * [-7322.069] (-7321.798) (-7324.454) (-7323.905) -- 0:14:42
      402000 -- (-7333.994) (-7323.662) (-7339.686) [-7324.817] * (-7322.057) (-7327.855) (-7318.815) [-7322.615] -- 0:14:42
      402500 -- (-7331.709) (-7329.218) [-7323.296] (-7321.896) * (-7331.922) (-7352.181) (-7322.637) [-7319.371] -- 0:14:41
      403000 -- (-7329.611) (-7326.705) [-7315.774] (-7327.279) * (-7333.407) (-7324.545) [-7319.232] (-7321.106) -- 0:14:39
      403500 -- [-7317.025] (-7323.919) (-7319.778) (-7333.967) * (-7326.531) (-7328.265) (-7323.763) [-7325.660] -- 0:14:39
      404000 -- (-7324.648) [-7332.827] (-7339.376) (-7332.199) * [-7327.119] (-7326.084) (-7327.823) (-7327.129) -- 0:14:39
      404500 -- (-7326.356) [-7329.545] (-7338.143) (-7335.082) * (-7333.249) [-7321.904] (-7328.108) (-7322.229) -- 0:14:38
      405000 -- (-7331.823) (-7323.845) (-7329.220) [-7320.094] * [-7323.790] (-7331.363) (-7326.215) (-7324.471) -- 0:14:37

      Average standard deviation of split frequencies: 0.008879

      405500 -- (-7323.345) (-7321.462) (-7339.558) [-7319.449] * [-7320.837] (-7329.399) (-7328.721) (-7328.768) -- 0:14:36
      406000 -- [-7332.090] (-7324.929) (-7344.811) (-7323.478) * (-7338.971) (-7333.065) (-7319.251) [-7328.813] -- 0:14:36
      406500 -- (-7339.958) [-7322.943] (-7344.767) (-7327.235) * (-7342.785) [-7327.363] (-7324.114) (-7329.671) -- 0:14:36
      407000 -- [-7326.709] (-7326.746) (-7331.481) (-7318.900) * (-7322.411) [-7327.638] (-7334.881) (-7325.985) -- 0:14:34
      407500 -- [-7316.754] (-7326.333) (-7325.803) (-7317.966) * (-7323.052) (-7334.412) [-7327.940] (-7340.089) -- 0:14:33
      408000 -- (-7327.666) (-7329.450) (-7322.834) [-7319.422] * [-7317.540] (-7328.692) (-7318.247) (-7327.147) -- 0:14:33
      408500 -- (-7325.753) (-7322.025) (-7322.830) [-7320.323] * (-7324.009) (-7323.742) [-7319.658] (-7331.206) -- 0:14:33
      409000 -- (-7319.053) [-7321.851] (-7322.867) (-7323.661) * (-7336.029) (-7326.366) [-7317.791] (-7330.128) -- 0:14:31
      409500 -- (-7319.517) [-7321.372] (-7332.749) (-7327.317) * [-7332.169] (-7347.366) (-7317.923) (-7333.013) -- 0:14:30
      410000 -- [-7319.411] (-7331.406) (-7332.216) (-7316.190) * (-7331.218) [-7320.354] (-7319.837) (-7331.840) -- 0:14:30

      Average standard deviation of split frequencies: 0.008508

      410500 -- [-7323.931] (-7335.036) (-7321.227) (-7326.587) * (-7329.199) (-7319.254) [-7323.318] (-7326.514) -- 0:14:30
      411000 -- (-7332.473) (-7334.185) [-7317.606] (-7335.128) * [-7325.754] (-7325.322) (-7325.837) (-7327.009) -- 0:14:29
      411500 -- (-7324.677) (-7330.153) [-7320.028] (-7331.000) * (-7323.086) (-7333.476) (-7338.027) [-7321.122] -- 0:14:28
      412000 -- (-7323.963) [-7322.322] (-7328.240) (-7330.535) * (-7331.636) (-7328.089) (-7337.971) [-7320.243] -- 0:14:27
      412500 -- (-7322.159) [-7321.477] (-7331.553) (-7339.498) * (-7329.730) [-7321.811] (-7331.272) (-7321.545) -- 0:14:27
      413000 -- (-7322.863) (-7329.211) [-7327.813] (-7337.550) * [-7330.735] (-7326.379) (-7335.368) (-7329.360) -- 0:14:26
      413500 -- (-7338.006) (-7324.853) [-7322.039] (-7336.560) * (-7326.277) [-7331.561] (-7335.735) (-7327.413) -- 0:14:25
      414000 -- (-7339.275) [-7330.651] (-7335.320) (-7334.744) * (-7321.545) (-7321.745) (-7326.523) [-7323.890] -- 0:14:24
      414500 -- (-7332.162) (-7331.352) [-7328.878] (-7334.467) * [-7317.745] (-7324.750) (-7327.966) (-7332.134) -- 0:14:24
      415000 -- (-7331.337) [-7328.895] (-7332.435) (-7326.554) * (-7318.292) (-7326.761) (-7318.197) [-7324.277] -- 0:14:24

      Average standard deviation of split frequencies: 0.009065

      415500 -- (-7327.495) (-7321.015) (-7331.108) [-7330.324] * (-7321.801) (-7323.893) (-7319.653) [-7326.078] -- 0:14:22
      416000 -- (-7333.694) [-7318.907] (-7329.340) (-7331.440) * (-7327.847) [-7325.539] (-7324.849) (-7329.536) -- 0:14:21
      416500 -- (-7318.883) (-7325.719) (-7325.506) [-7328.363] * (-7329.291) (-7331.228) (-7327.487) [-7321.904] -- 0:14:21
      417000 -- (-7331.842) (-7326.246) [-7323.213] (-7328.825) * [-7327.143] (-7327.089) (-7330.721) (-7322.634) -- 0:14:21
      417500 -- (-7324.434) [-7321.948] (-7328.943) (-7323.973) * (-7319.219) [-7324.581] (-7325.338) (-7323.699) -- 0:14:19
      418000 -- [-7326.239] (-7329.320) (-7332.222) (-7326.958) * [-7329.466] (-7331.990) (-7334.193) (-7329.313) -- 0:14:19
      418500 -- [-7325.160] (-7320.656) (-7330.164) (-7330.807) * (-7330.213) [-7321.838] (-7326.896) (-7331.997) -- 0:14:18
      419000 -- [-7325.873] (-7321.096) (-7323.508) (-7328.295) * (-7329.272) (-7340.325) [-7322.649] (-7327.013) -- 0:14:18
      419500 -- (-7317.311) (-7322.387) (-7329.673) [-7308.994] * [-7324.766] (-7348.984) (-7327.190) (-7328.853) -- 0:14:16
      420000 -- (-7320.930) (-7323.462) (-7325.923) [-7320.878] * [-7321.593] (-7329.500) (-7327.809) (-7334.216) -- 0:14:16

      Average standard deviation of split frequencies: 0.009097

      420500 -- (-7319.153) (-7325.762) [-7318.171] (-7323.960) * (-7332.430) (-7333.563) (-7329.992) [-7328.002] -- 0:14:15
      421000 -- (-7334.809) (-7325.192) (-7322.411) [-7326.283] * (-7338.287) (-7331.278) (-7330.960) [-7326.235] -- 0:14:15
      421500 -- (-7326.131) (-7329.729) (-7333.673) [-7327.643] * [-7321.491] (-7327.800) (-7323.808) (-7337.329) -- 0:14:13
      422000 -- (-7322.537) (-7319.646) [-7321.005] (-7329.306) * [-7322.504] (-7331.056) (-7321.961) (-7326.720) -- 0:14:13
      422500 -- [-7324.277] (-7327.938) (-7323.475) (-7323.007) * (-7327.711) (-7325.395) [-7334.335] (-7330.230) -- 0:14:12
      423000 -- (-7319.773) (-7323.573) [-7339.810] (-7329.196) * (-7325.731) (-7335.373) [-7319.757] (-7335.997) -- 0:14:12
      423500 -- [-7320.250] (-7324.908) (-7325.470) (-7337.037) * (-7327.733) [-7330.114] (-7330.840) (-7317.184) -- 0:14:10
      424000 -- (-7330.057) (-7320.792) [-7323.656] (-7323.023) * (-7327.568) (-7323.731) [-7320.900] (-7315.964) -- 0:14:10
      424500 -- (-7325.451) [-7324.887] (-7322.889) (-7332.580) * [-7320.480] (-7324.902) (-7331.324) (-7318.707) -- 0:14:10
      425000 -- (-7319.378) (-7326.414) [-7323.827] (-7321.135) * [-7322.143] (-7322.878) (-7339.937) (-7328.445) -- 0:14:09

      Average standard deviation of split frequencies: 0.009178

      425500 -- (-7324.128) [-7323.368] (-7320.858) (-7328.608) * [-7320.845] (-7335.596) (-7335.304) (-7323.301) -- 0:14:07
      426000 -- [-7318.825] (-7322.149) (-7329.485) (-7319.000) * (-7330.129) [-7321.637] (-7332.854) (-7321.494) -- 0:14:07
      426500 -- (-7311.924) (-7335.798) (-7327.742) [-7324.915] * (-7331.400) (-7321.218) [-7320.280] (-7328.535) -- 0:14:07
      427000 -- (-7318.849) [-7324.354] (-7335.661) (-7328.125) * (-7331.656) (-7322.933) [-7318.261] (-7327.809) -- 0:14:06
      427500 -- (-7328.549) (-7324.141) [-7322.853] (-7343.051) * (-7334.581) [-7317.203] (-7322.662) (-7323.924) -- 0:14:05
      428000 -- (-7325.660) (-7330.413) [-7323.882] (-7325.700) * (-7319.950) [-7315.246] (-7333.177) (-7331.797) -- 0:14:04
      428500 -- (-7323.462) (-7330.675) [-7326.277] (-7327.854) * [-7319.335] (-7337.473) (-7336.748) (-7325.114) -- 0:14:04
      429000 -- (-7328.629) (-7325.762) [-7319.001] (-7333.457) * (-7323.031) [-7326.450] (-7325.283) (-7326.062) -- 0:14:03
      429500 -- (-7329.361) [-7322.509] (-7322.296) (-7322.786) * [-7322.592] (-7327.013) (-7316.323) (-7326.140) -- 0:14:02
      430000 -- [-7325.216] (-7318.682) (-7330.005) (-7333.811) * [-7321.300] (-7323.793) (-7319.761) (-7333.747) -- 0:14:01

      Average standard deviation of split frequencies: 0.009336

      430500 -- (-7329.581) [-7327.529] (-7320.182) (-7331.727) * (-7329.663) (-7318.697) (-7322.606) [-7327.830] -- 0:14:01
      431000 -- (-7334.944) (-7315.993) (-7327.313) [-7329.574] * [-7317.738] (-7328.634) (-7326.553) (-7329.526) -- 0:14:00
      431500 -- (-7332.404) (-7331.770) [-7331.689] (-7326.891) * (-7328.454) (-7328.941) [-7317.376] (-7323.132) -- 0:14:00
      432000 -- (-7319.221) (-7324.860) [-7319.167] (-7317.339) * (-7319.423) (-7324.974) (-7322.535) [-7320.836] -- 0:13:58
      432500 -- (-7331.293) [-7325.944] (-7320.405) (-7326.719) * [-7320.869] (-7324.871) (-7328.540) (-7335.273) -- 0:13:58
      433000 -- [-7322.050] (-7329.632) (-7328.047) (-7324.677) * (-7331.314) (-7328.752) [-7322.595] (-7332.198) -- 0:13:58
      433500 -- [-7322.405] (-7338.902) (-7323.512) (-7332.691) * (-7328.665) (-7325.291) (-7316.483) [-7320.036] -- 0:13:57
      434000 -- (-7330.816) [-7326.295] (-7327.334) (-7326.707) * (-7324.428) (-7325.355) (-7326.767) [-7316.180] -- 0:13:55
      434500 -- (-7325.450) [-7330.351] (-7321.503) (-7322.651) * (-7333.206) [-7321.966] (-7320.797) (-7323.842) -- 0:13:55
      435000 -- (-7331.901) (-7337.481) [-7311.564] (-7327.401) * [-7333.540] (-7329.530) (-7323.257) (-7316.359) -- 0:13:55

      Average standard deviation of split frequencies: 0.010367

      435500 -- (-7329.674) [-7326.134] (-7333.726) (-7328.225) * (-7327.199) (-7327.160) [-7317.863] (-7316.141) -- 0:13:54
      436000 -- (-7326.436) [-7325.144] (-7323.635) (-7318.954) * (-7319.660) (-7347.556) [-7315.861] (-7326.020) -- 0:13:53
      436500 -- (-7335.387) [-7320.892] (-7322.222) (-7328.721) * (-7330.308) (-7332.990) [-7327.103] (-7335.787) -- 0:13:52
      437000 -- (-7333.393) (-7320.073) (-7323.220) [-7326.122] * (-7326.847) (-7313.643) (-7327.346) [-7325.335] -- 0:13:52
      437500 -- (-7325.160) (-7325.883) [-7322.597] (-7326.358) * (-7324.971) [-7311.643] (-7328.046) (-7329.995) -- 0:13:51
      438000 -- (-7334.719) (-7331.336) (-7327.395) [-7321.122] * [-7322.258] (-7325.741) (-7329.842) (-7326.205) -- 0:13:50
      438500 -- [-7326.772] (-7321.205) (-7327.635) (-7315.604) * (-7320.074) (-7332.410) [-7322.814] (-7318.476) -- 0:13:49
      439000 -- (-7326.814) (-7330.840) (-7329.599) [-7324.074] * [-7319.209] (-7329.408) (-7322.067) (-7321.396) -- 0:13:49
      439500 -- (-7335.286) [-7324.304] (-7326.436) (-7327.490) * (-7334.674) (-7338.100) [-7325.208] (-7325.727) -- 0:13:48
      440000 -- (-7329.346) (-7323.654) [-7337.303] (-7324.994) * (-7333.883) [-7322.433] (-7329.466) (-7326.102) -- 0:13:47

      Average standard deviation of split frequencies: 0.009502

      440500 -- [-7328.810] (-7329.597) (-7334.048) (-7324.458) * (-7335.543) (-7342.635) [-7321.310] (-7327.467) -- 0:13:46
      441000 -- [-7326.768] (-7320.589) (-7340.903) (-7323.158) * (-7321.376) (-7335.213) [-7323.203] (-7329.118) -- 0:13:46
      441500 -- [-7326.277] (-7333.625) (-7328.125) (-7325.860) * (-7334.963) (-7327.409) [-7334.832] (-7328.245) -- 0:13:46
      442000 -- (-7318.170) (-7331.614) (-7330.396) [-7318.543] * [-7338.979] (-7337.347) (-7321.812) (-7326.340) -- 0:13:44
      442500 -- [-7323.551] (-7329.692) (-7321.685) (-7327.718) * (-7328.739) (-7339.070) [-7323.946] (-7332.094) -- 0:13:43
      443000 -- [-7322.010] (-7325.589) (-7322.003) (-7322.123) * [-7327.627] (-7350.018) (-7324.826) (-7319.301) -- 0:13:43
      443500 -- (-7329.148) [-7320.334] (-7332.820) (-7333.639) * (-7341.078) [-7332.833] (-7328.955) (-7327.895) -- 0:13:43
      444000 -- [-7325.534] (-7322.394) (-7326.057) (-7331.626) * (-7330.487) [-7324.583] (-7320.277) (-7332.848) -- 0:13:41
      444500 -- (-7333.368) (-7329.488) (-7339.470) [-7318.683] * (-7324.951) (-7330.286) [-7322.800] (-7336.309) -- 0:13:41
      445000 -- (-7323.351) (-7319.775) [-7319.689] (-7334.808) * [-7321.868] (-7328.322) (-7325.618) (-7330.357) -- 0:13:40

      Average standard deviation of split frequencies: 0.009388

      445500 -- (-7324.879) (-7320.882) [-7317.560] (-7323.854) * (-7329.145) [-7332.065] (-7321.302) (-7325.370) -- 0:13:40
      446000 -- (-7323.523) (-7319.197) (-7329.385) [-7323.443] * [-7324.812] (-7324.972) (-7326.828) (-7325.009) -- 0:13:38
      446500 -- (-7320.997) (-7332.186) (-7330.797) [-7320.382] * (-7332.074) (-7323.157) (-7336.866) [-7320.816] -- 0:13:38
      447000 -- (-7328.776) (-7327.334) (-7330.385) [-7325.551] * (-7329.760) (-7336.292) (-7324.064) [-7324.050] -- 0:13:37
      447500 -- (-7335.343) [-7322.274] (-7334.846) (-7321.866) * (-7332.460) (-7325.381) [-7331.779] (-7323.029) -- 0:13:37
      448000 -- (-7321.331) (-7321.588) (-7339.339) [-7323.804] * (-7331.168) [-7319.699] (-7338.437) (-7318.875) -- 0:13:35
      448500 -- [-7315.925] (-7323.221) (-7340.335) (-7332.700) * (-7333.290) (-7325.481) [-7321.952] (-7327.322) -- 0:13:35
      449000 -- (-7328.206) [-7319.748] (-7333.728) (-7328.099) * [-7332.460] (-7321.130) (-7326.316) (-7329.854) -- 0:13:34
      449500 -- [-7324.465] (-7331.871) (-7326.079) (-7330.825) * (-7332.231) (-7330.530) [-7322.823] (-7335.593) -- 0:13:34
      450000 -- [-7317.125] (-7331.950) (-7332.466) (-7323.903) * (-7330.881) [-7317.370] (-7322.170) (-7330.955) -- 0:13:32

      Average standard deviation of split frequencies: 0.009722

      450500 -- (-7318.948) (-7321.742) [-7326.146] (-7328.947) * [-7329.974] (-7329.961) (-7336.442) (-7333.024) -- 0:13:32
      451000 -- (-7317.100) (-7328.632) (-7325.243) [-7331.358] * (-7328.926) (-7328.355) (-7327.809) [-7318.971] -- 0:13:31
      451500 -- (-7320.374) [-7325.903] (-7321.828) (-7333.674) * (-7330.264) (-7319.078) (-7331.325) [-7324.479] -- 0:13:31
      452000 -- (-7322.994) (-7325.735) [-7325.219] (-7342.579) * (-7331.788) [-7323.343] (-7326.743) (-7331.569) -- 0:13:29
      452500 -- (-7325.743) (-7329.324) [-7326.701] (-7330.577) * (-7328.872) (-7316.634) [-7323.839] (-7326.238) -- 0:13:29
      453000 -- [-7323.877] (-7337.053) (-7324.057) (-7331.928) * (-7330.459) [-7313.114] (-7325.883) (-7332.361) -- 0:13:29
      453500 -- [-7319.904] (-7324.196) (-7321.662) (-7329.998) * (-7326.419) [-7323.279] (-7325.998) (-7332.533) -- 0:13:28
      454000 -- (-7326.984) (-7324.154) [-7326.592] (-7326.513) * [-7330.904] (-7332.461) (-7334.918) (-7328.359) -- 0:13:26
      454500 -- (-7322.306) (-7318.831) [-7332.926] (-7329.437) * [-7334.066] (-7322.320) (-7332.479) (-7328.577) -- 0:13:26
      455000 -- (-7322.653) (-7329.573) [-7326.548] (-7324.633) * (-7327.594) [-7323.458] (-7325.330) (-7327.401) -- 0:13:26

      Average standard deviation of split frequencies: 0.010216

      455500 -- (-7323.721) (-7328.959) (-7324.374) [-7326.383] * [-7329.575] (-7328.922) (-7335.439) (-7324.651) -- 0:13:25
      456000 -- [-7334.616] (-7336.275) (-7331.718) (-7323.946) * (-7332.397) [-7324.286] (-7332.906) (-7323.998) -- 0:13:24
      456500 -- (-7328.180) [-7323.023] (-7324.372) (-7328.881) * (-7328.052) (-7321.877) [-7332.362] (-7322.478) -- 0:13:23
      457000 -- [-7325.373] (-7322.449) (-7327.097) (-7322.851) * (-7325.835) [-7323.828] (-7326.367) (-7325.310) -- 0:13:23
      457500 -- [-7330.354] (-7337.263) (-7320.275) (-7327.012) * (-7328.915) [-7327.372] (-7327.973) (-7327.793) -- 0:13:22
      458000 -- (-7333.136) (-7331.210) [-7322.157] (-7328.240) * (-7326.252) (-7330.839) (-7323.478) [-7330.123] -- 0:13:21
      458500 -- [-7325.652] (-7322.853) (-7335.687) (-7338.781) * (-7338.285) (-7321.874) (-7324.230) [-7322.777] -- 0:13:20
      459000 -- [-7317.372] (-7328.425) (-7329.550) (-7336.403) * [-7327.310] (-7325.590) (-7325.713) (-7324.837) -- 0:13:20
      459500 -- (-7325.856) (-7324.704) (-7335.330) [-7327.536] * [-7323.832] (-7321.139) (-7324.525) (-7322.945) -- 0:13:19
      460000 -- (-7314.733) (-7318.311) (-7333.746) [-7322.583] * (-7319.726) (-7331.174) (-7333.009) [-7324.488] -- 0:13:18

      Average standard deviation of split frequencies: 0.010053

      460500 -- [-7319.706] (-7327.219) (-7339.033) (-7325.717) * (-7324.513) (-7324.258) [-7317.746] (-7328.384) -- 0:13:17
      461000 -- (-7332.146) [-7318.887] (-7338.372) (-7323.893) * (-7327.908) [-7326.046] (-7326.625) (-7334.213) -- 0:13:17
      461500 -- [-7320.236] (-7329.769) (-7337.973) (-7321.424) * (-7330.511) (-7330.958) (-7334.284) [-7323.825] -- 0:13:16
      462000 -- [-7321.853] (-7334.023) (-7324.027) (-7333.057) * (-7321.156) (-7328.711) (-7318.284) [-7323.313] -- 0:13:15
      462500 -- (-7323.500) (-7345.791) [-7332.442] (-7320.374) * (-7334.791) (-7336.416) (-7329.550) [-7325.564] -- 0:13:14
      463000 -- (-7322.872) (-7327.557) [-7316.630] (-7332.636) * [-7325.997] (-7325.703) (-7320.938) (-7322.846) -- 0:13:14
      463500 -- (-7323.805) (-7333.343) (-7325.184) [-7329.833] * (-7321.838) (-7323.062) [-7322.523] (-7325.846) -- 0:13:14
      464000 -- (-7323.206) (-7338.849) [-7339.595] (-7322.598) * (-7328.472) (-7322.581) [-7324.036] (-7325.226) -- 0:13:13
      464500 -- [-7322.857] (-7331.611) (-7327.947) (-7312.337) * (-7326.378) (-7333.576) [-7326.872] (-7333.604) -- 0:13:12
      465000 -- [-7319.741] (-7332.142) (-7331.303) (-7317.906) * (-7328.445) (-7335.270) [-7320.836] (-7324.940) -- 0:13:11

      Average standard deviation of split frequencies: 0.010056

      465500 -- (-7324.969) (-7320.947) (-7338.082) [-7316.482] * (-7339.110) (-7324.711) [-7328.247] (-7329.265) -- 0:13:11
      466000 -- [-7327.830] (-7330.224) (-7328.646) (-7318.650) * (-7326.390) (-7324.274) (-7325.080) [-7323.206] -- 0:13:09
      466500 -- [-7332.929] (-7330.303) (-7326.706) (-7330.349) * (-7332.076) (-7327.160) (-7326.256) [-7322.996] -- 0:13:09
      467000 -- (-7327.697) (-7332.655) (-7339.886) [-7320.454] * [-7328.180] (-7326.320) (-7322.885) (-7326.931) -- 0:13:08
      467500 -- (-7336.315) (-7335.718) (-7338.746) [-7318.343] * [-7318.406] (-7317.867) (-7328.624) (-7325.042) -- 0:13:08
      468000 -- (-7320.457) (-7323.574) (-7338.571) [-7320.413] * (-7327.464) (-7324.925) [-7325.336] (-7325.097) -- 0:13:06
      468500 -- (-7319.725) (-7317.302) (-7323.910) [-7323.884] * (-7325.326) (-7324.799) [-7322.477] (-7325.225) -- 0:13:06
      469000 -- (-7319.886) (-7324.631) (-7335.457) [-7325.256] * [-7325.385] (-7326.190) (-7313.708) (-7341.775) -- 0:13:05
      469500 -- (-7325.830) (-7325.850) (-7325.897) [-7319.662] * [-7321.059] (-7332.582) (-7329.344) (-7335.589) -- 0:13:05
      470000 -- [-7325.525] (-7325.465) (-7334.093) (-7330.362) * (-7319.841) (-7324.921) (-7329.399) [-7322.050] -- 0:13:04

      Average standard deviation of split frequencies: 0.010664

      470500 -- (-7324.788) (-7323.282) [-7323.873] (-7319.780) * (-7319.698) (-7320.382) (-7328.254) [-7331.171] -- 0:13:03
      471000 -- (-7329.175) (-7321.599) (-7322.306) [-7322.708] * [-7318.408] (-7315.929) (-7329.880) (-7331.232) -- 0:13:02
      471500 -- (-7321.578) [-7326.497] (-7316.951) (-7325.481) * [-7321.292] (-7326.029) (-7335.875) (-7323.152) -- 0:13:02
      472000 -- (-7329.357) (-7329.828) (-7333.452) [-7317.973] * (-7333.126) [-7327.759] (-7331.606) (-7319.296) -- 0:13:00
      472500 -- (-7325.533) [-7322.611] (-7331.696) (-7321.964) * (-7323.850) (-7336.902) (-7341.351) [-7327.468] -- 0:13:00
      473000 -- (-7325.559) (-7322.672) [-7323.582] (-7333.234) * (-7327.457) (-7323.452) [-7328.662] (-7325.034) -- 0:12:59
      473500 -- (-7328.495) (-7327.968) [-7321.205] (-7345.228) * (-7326.296) (-7334.510) [-7320.323] (-7326.254) -- 0:12:59
      474000 -- [-7318.442] (-7332.745) (-7333.146) (-7316.296) * [-7329.052] (-7336.311) (-7325.913) (-7325.798) -- 0:12:59
      474500 -- (-7322.114) (-7330.509) [-7327.471] (-7334.718) * (-7328.300) (-7322.497) [-7336.075] (-7321.531) -- 0:12:57
      475000 -- (-7323.196) (-7333.731) [-7321.705] (-7341.250) * [-7333.785] (-7320.495) (-7323.084) (-7334.215) -- 0:12:57

      Average standard deviation of split frequencies: 0.010136

      475500 -- (-7318.290) (-7327.645) [-7320.443] (-7334.040) * (-7329.915) (-7331.910) (-7328.304) [-7325.018] -- 0:12:56
      476000 -- (-7322.301) [-7331.278] (-7322.292) (-7330.215) * (-7327.207) [-7319.242] (-7328.506) (-7322.942) -- 0:12:56
      476500 -- (-7324.286) (-7325.466) [-7319.101] (-7318.324) * (-7328.055) (-7334.478) (-7336.330) [-7325.872] -- 0:12:54
      477000 -- (-7323.901) [-7319.002] (-7328.618) (-7323.874) * (-7327.506) (-7334.058) (-7334.187) [-7321.020] -- 0:12:54
      477500 -- (-7323.963) [-7321.681] (-7323.044) (-7320.318) * (-7328.459) [-7333.883] (-7334.388) (-7322.446) -- 0:12:53
      478000 -- (-7326.831) (-7320.035) (-7336.581) [-7317.114] * (-7316.997) [-7316.849] (-7338.786) (-7329.605) -- 0:12:53
      478500 -- (-7329.631) (-7332.359) [-7324.466] (-7330.316) * [-7321.817] (-7324.154) (-7325.232) (-7322.943) -- 0:12:51
      479000 -- (-7331.696) (-7335.354) (-7320.804) [-7333.629] * [-7329.928] (-7333.700) (-7323.160) (-7326.046) -- 0:12:51
      479500 -- (-7329.330) (-7319.594) [-7322.395] (-7323.171) * (-7329.988) (-7325.955) [-7322.997] (-7323.108) -- 0:12:50
      480000 -- [-7312.643] (-7319.081) (-7338.396) (-7327.134) * (-7325.195) (-7330.364) [-7320.921] (-7322.222) -- 0:12:50

      Average standard deviation of split frequencies: 0.010211

      480500 -- (-7327.623) (-7314.785) [-7333.058] (-7324.587) * (-7332.116) (-7331.036) [-7316.396] (-7326.752) -- 0:12:48
      481000 -- [-7320.124] (-7323.557) (-7335.136) (-7329.386) * (-7328.688) (-7329.190) [-7313.626] (-7326.328) -- 0:12:48
      481500 -- [-7322.123] (-7321.489) (-7343.409) (-7328.762) * (-7333.700) (-7327.700) [-7321.347] (-7328.159) -- 0:12:47
      482000 -- (-7327.238) (-7333.302) (-7327.813) [-7326.168] * (-7336.394) [-7325.514] (-7314.657) (-7321.208) -- 0:12:47
      482500 -- (-7328.567) (-7334.279) (-7327.903) [-7322.217] * (-7317.542) (-7328.231) (-7327.145) [-7319.953] -- 0:12:45
      483000 -- (-7330.416) (-7334.740) (-7326.031) [-7323.880] * (-7327.333) (-7334.499) [-7317.723] (-7319.408) -- 0:12:45
      483500 -- [-7322.219] (-7321.564) (-7339.566) (-7327.922) * (-7319.010) [-7332.475] (-7320.881) (-7332.516) -- 0:12:44
      484000 -- (-7318.777) (-7322.318) (-7331.054) [-7322.316] * (-7319.264) (-7323.896) [-7315.040] (-7325.645) -- 0:12:44
      484500 -- (-7329.230) (-7326.691) (-7340.668) [-7324.564] * [-7324.045] (-7327.215) (-7327.218) (-7319.246) -- 0:12:42
      485000 -- (-7329.392) (-7329.460) (-7329.209) [-7326.045] * [-7314.621] (-7320.889) (-7322.560) (-7324.021) -- 0:12:42

      Average standard deviation of split frequencies: 0.010384

      485500 -- (-7340.023) [-7327.971] (-7325.268) (-7316.986) * (-7327.175) [-7331.304] (-7330.609) (-7321.618) -- 0:12:41
      486000 -- (-7329.903) [-7319.994] (-7329.657) (-7319.882) * (-7323.675) [-7326.407] (-7329.229) (-7314.356) -- 0:12:41
      486500 -- (-7332.771) (-7323.213) (-7318.767) [-7316.886] * (-7326.536) [-7321.208] (-7333.911) (-7320.546) -- 0:12:39
      487000 -- (-7339.701) (-7320.905) (-7329.735) [-7327.466] * (-7333.496) [-7328.255] (-7330.121) (-7324.521) -- 0:12:39
      487500 -- (-7330.027) (-7326.612) [-7331.528] (-7323.890) * (-7318.907) (-7323.962) [-7325.101] (-7345.799) -- 0:12:39
      488000 -- (-7334.344) [-7316.196] (-7327.686) (-7323.476) * (-7329.801) (-7325.897) [-7324.355] (-7337.765) -- 0:12:38
      488500 -- (-7336.569) [-7321.306] (-7332.858) (-7320.984) * (-7330.143) [-7327.255] (-7318.080) (-7325.949) -- 0:12:37
      489000 -- (-7328.254) [-7325.965] (-7331.259) (-7324.383) * [-7324.931] (-7326.283) (-7316.379) (-7318.575) -- 0:12:36
      489500 -- (-7330.172) [-7330.825] (-7331.723) (-7323.748) * (-7330.436) (-7322.131) [-7323.004] (-7323.725) -- 0:12:36
      490000 -- (-7337.775) (-7339.805) (-7332.152) [-7322.406] * (-7327.484) [-7319.207] (-7327.196) (-7320.314) -- 0:12:35

      Average standard deviation of split frequencies: 0.010286

      490500 -- (-7336.997) (-7329.558) (-7324.208) [-7321.208] * (-7323.138) (-7324.851) [-7325.171] (-7327.751) -- 0:12:34
      491000 -- [-7327.095] (-7333.538) (-7335.101) (-7319.072) * (-7328.165) (-7331.645) [-7314.259] (-7330.235) -- 0:12:33
      491500 -- [-7324.522] (-7328.674) (-7336.155) (-7326.708) * [-7317.803] (-7337.449) (-7316.070) (-7333.395) -- 0:12:33
      492000 -- [-7329.632] (-7326.992) (-7336.279) (-7321.782) * (-7322.010) [-7328.861] (-7323.484) (-7327.267) -- 0:12:32
      492500 -- (-7329.362) (-7332.938) (-7336.527) [-7326.032] * [-7320.684] (-7334.163) (-7324.690) (-7323.836) -- 0:12:31
      493000 -- (-7334.909) (-7335.894) (-7333.577) [-7335.057] * (-7334.232) (-7336.796) [-7321.096] (-7317.184) -- 0:12:30
      493500 -- [-7323.697] (-7324.941) (-7337.702) (-7323.226) * (-7322.039) (-7328.307) (-7321.810) [-7324.962] -- 0:12:30
      494000 -- [-7317.769] (-7328.372) (-7338.422) (-7329.396) * (-7321.338) (-7321.903) [-7319.023] (-7320.990) -- 0:12:29
      494500 -- (-7325.562) (-7321.636) [-7319.479] (-7322.586) * [-7323.998] (-7320.228) (-7327.108) (-7332.622) -- 0:12:28
      495000 -- [-7328.450] (-7335.758) (-7327.563) (-7328.486) * (-7332.855) [-7321.520] (-7325.232) (-7323.016) -- 0:12:27

      Average standard deviation of split frequencies: 0.010566

      495500 -- (-7324.645) [-7319.068] (-7328.317) (-7330.513) * (-7324.056) [-7320.079] (-7322.314) (-7329.752) -- 0:12:27
      496000 -- (-7333.250) (-7329.566) (-7321.689) [-7315.573] * (-7336.232) (-7325.494) (-7332.954) [-7325.939] -- 0:12:26
      496500 -- (-7340.726) (-7326.519) (-7332.132) [-7326.396] * (-7330.874) [-7319.786] (-7323.962) (-7326.565) -- 0:12:25
      497000 -- (-7330.354) (-7326.345) (-7321.721) [-7322.759] * (-7333.138) (-7325.858) [-7331.713] (-7327.341) -- 0:12:24
      497500 -- (-7325.485) (-7328.528) [-7330.611] (-7329.623) * (-7330.366) (-7314.339) (-7332.480) [-7317.431] -- 0:12:24
      498000 -- [-7330.471] (-7335.100) (-7324.765) (-7325.187) * (-7323.748) [-7318.641] (-7324.642) (-7321.297) -- 0:12:23
      498500 -- (-7325.145) (-7328.845) (-7324.358) [-7316.747] * (-7316.963) [-7326.123] (-7327.939) (-7317.810) -- 0:12:22
      499000 -- (-7331.642) (-7334.103) (-7330.197) [-7320.691] * (-7335.597) [-7315.704] (-7323.921) (-7322.625) -- 0:12:21
      499500 -- (-7332.886) (-7326.997) (-7330.499) [-7323.713] * (-7333.064) [-7320.448] (-7325.467) (-7320.888) -- 0:12:21
      500000 -- (-7338.304) (-7331.215) (-7323.082) [-7318.647] * (-7340.491) (-7329.945) [-7326.805] (-7317.232) -- 0:12:21

      Average standard deviation of split frequencies: 0.010412

      500500 -- (-7333.345) (-7324.601) (-7330.136) [-7317.008] * (-7342.637) (-7320.165) (-7319.987) [-7334.177] -- 0:12:19
      501000 -- (-7322.105) [-7329.335] (-7328.106) (-7325.337) * [-7321.489] (-7326.401) (-7339.375) (-7324.844) -- 0:12:19
      501500 -- (-7330.877) [-7335.722] (-7338.001) (-7328.978) * (-7327.249) (-7325.420) (-7323.604) [-7327.382] -- 0:12:18
      502000 -- (-7320.810) (-7329.411) [-7328.234] (-7330.579) * [-7329.426] (-7324.131) (-7316.851) (-7325.066) -- 0:12:18
      502500 -- (-7328.758) [-7322.458] (-7325.802) (-7320.796) * (-7320.234) (-7332.756) [-7317.245] (-7329.167) -- 0:12:16
      503000 -- (-7321.388) (-7320.161) (-7331.349) [-7322.281] * [-7313.514] (-7321.076) (-7319.466) (-7326.144) -- 0:12:16
      503500 -- (-7332.051) (-7321.909) [-7321.613] (-7333.529) * [-7315.095] (-7321.659) (-7317.394) (-7327.434) -- 0:12:15
      504000 -- (-7326.376) [-7319.773] (-7322.674) (-7344.620) * (-7322.931) (-7324.096) [-7323.713] (-7329.115) -- 0:12:15
      504500 -- [-7324.351] (-7325.766) (-7324.383) (-7334.764) * [-7334.239] (-7325.691) (-7325.770) (-7328.452) -- 0:12:13
      505000 -- (-7323.892) (-7322.440) [-7328.553] (-7335.645) * [-7319.035] (-7330.342) (-7327.831) (-7325.925) -- 0:12:13

      Average standard deviation of split frequencies: 0.010577

      505500 -- (-7317.359) (-7328.139) (-7322.889) [-7325.794] * [-7320.018] (-7331.009) (-7325.899) (-7328.719) -- 0:12:12
      506000 -- (-7327.501) (-7327.312) (-7332.739) [-7321.058] * [-7316.805] (-7329.748) (-7332.383) (-7336.782) -- 0:12:12
      506500 -- (-7332.590) [-7319.020] (-7325.007) (-7323.227) * (-7323.161) (-7333.645) [-7323.903] (-7326.197) -- 0:12:11
      507000 -- [-7334.739] (-7325.958) (-7321.841) (-7329.677) * (-7330.835) (-7338.649) [-7332.603] (-7319.859) -- 0:12:10
      507500 -- (-7333.252) (-7324.266) [-7322.855] (-7318.717) * [-7315.630] (-7330.017) (-7321.360) (-7326.836) -- 0:12:09
      508000 -- (-7320.414) [-7315.815] (-7317.969) (-7325.196) * (-7323.895) (-7320.513) [-7327.153] (-7328.382) -- 0:12:09
      508500 -- (-7330.955) (-7328.507) (-7318.432) [-7324.632] * [-7328.652] (-7321.373) (-7324.688) (-7326.120) -- 0:12:08
      509000 -- [-7318.920] (-7334.655) (-7324.433) (-7323.389) * (-7318.773) (-7320.484) [-7320.440] (-7327.936) -- 0:12:07
      509500 -- (-7325.857) (-7326.427) (-7340.244) [-7325.928] * (-7322.688) [-7322.305] (-7327.178) (-7324.142) -- 0:12:06
      510000 -- (-7319.005) (-7314.795) (-7332.669) [-7322.143] * [-7318.954] (-7326.088) (-7331.814) (-7322.718) -- 0:12:06

      Average standard deviation of split frequencies: 0.010371

      510500 -- (-7326.400) [-7327.405] (-7330.125) (-7328.505) * [-7328.978] (-7321.605) (-7317.733) (-7321.107) -- 0:12:05
      511000 -- [-7314.866] (-7327.862) (-7324.300) (-7325.812) * (-7332.823) (-7336.478) (-7320.331) [-7326.131] -- 0:12:04
      511500 -- [-7320.724] (-7343.251) (-7328.051) (-7337.264) * [-7325.941] (-7336.838) (-7337.694) (-7323.669) -- 0:12:03
      512000 -- (-7327.354) [-7321.475] (-7324.054) (-7347.370) * (-7327.046) (-7324.685) [-7321.741] (-7331.340) -- 0:12:03
      512500 -- [-7320.221] (-7320.677) (-7340.201) (-7327.880) * (-7330.014) (-7332.481) (-7331.815) [-7329.510] -- 0:12:02
      513000 -- (-7330.051) (-7332.897) (-7348.844) [-7329.679] * [-7322.626] (-7323.355) (-7321.277) (-7337.997) -- 0:12:01
      513500 -- (-7327.931) [-7330.866] (-7331.239) (-7323.600) * [-7325.521] (-7335.233) (-7324.861) (-7329.168) -- 0:12:00
      514000 -- (-7329.777) [-7321.811] (-7324.226) (-7319.822) * (-7320.137) (-7339.332) [-7323.823] (-7333.343) -- 0:12:00
      514500 -- [-7327.865] (-7322.219) (-7326.195) (-7323.694) * (-7332.490) [-7329.024] (-7327.114) (-7344.191) -- 0:11:59
      515000 -- [-7328.518] (-7332.743) (-7329.571) (-7322.582) * [-7317.926] (-7327.441) (-7327.003) (-7334.214) -- 0:11:58

      Average standard deviation of split frequencies: 0.009942

      515500 -- (-7326.627) [-7327.635] (-7331.579) (-7323.108) * (-7322.684) (-7333.170) (-7322.974) [-7325.229] -- 0:11:58
      516000 -- [-7326.135] (-7327.553) (-7327.575) (-7328.503) * (-7330.082) [-7328.317] (-7321.286) (-7323.604) -- 0:11:57
      516500 -- (-7320.117) [-7322.156] (-7331.844) (-7325.267) * (-7329.615) [-7329.484] (-7331.774) (-7330.913) -- 0:11:57
      517000 -- (-7319.795) [-7318.091] (-7333.976) (-7332.159) * (-7322.195) (-7324.199) (-7328.205) [-7321.420] -- 0:11:55
      517500 -- (-7330.847) (-7330.647) [-7333.229] (-7329.234) * (-7337.888) (-7328.117) (-7329.075) [-7326.374] -- 0:11:55
      518000 -- [-7332.097] (-7335.294) (-7328.050) (-7333.078) * (-7336.220) (-7326.192) (-7330.095) [-7327.460] -- 0:11:54
      518500 -- [-7323.892] (-7324.256) (-7326.989) (-7345.429) * (-7321.381) (-7323.918) (-7331.147) [-7333.326] -- 0:11:54
      519000 -- (-7320.785) [-7325.121] (-7328.471) (-7332.219) * (-7322.018) [-7325.192] (-7320.981) (-7321.630) -- 0:11:52
      519500 -- (-7319.684) [-7320.038] (-7331.761) (-7318.378) * (-7325.996) (-7330.067) (-7337.381) [-7319.774] -- 0:11:52
      520000 -- (-7327.156) [-7326.330] (-7326.609) (-7337.072) * [-7324.052] (-7329.871) (-7334.394) (-7324.405) -- 0:11:51

      Average standard deviation of split frequencies: 0.010971

      520500 -- (-7333.682) (-7331.913) [-7322.769] (-7324.883) * (-7331.437) [-7328.241] (-7333.189) (-7317.551) -- 0:11:51
      521000 -- (-7332.302) (-7324.045) [-7319.787] (-7321.670) * (-7326.062) (-7325.731) (-7322.228) [-7316.494] -- 0:11:49
      521500 -- (-7321.394) (-7326.777) (-7318.580) [-7317.169] * (-7333.174) [-7320.568] (-7320.748) (-7314.663) -- 0:11:49
      522000 -- (-7334.104) (-7319.204) (-7324.667) [-7315.490] * (-7328.874) (-7333.654) (-7322.894) [-7321.152] -- 0:11:48
      522500 -- (-7334.619) (-7327.399) (-7318.337) [-7324.166] * (-7329.224) (-7331.291) (-7319.982) [-7320.037] -- 0:11:48
      523000 -- (-7330.842) (-7327.953) (-7323.854) [-7324.632] * (-7329.908) (-7333.737) (-7328.497) [-7320.874] -- 0:11:46
      523500 -- (-7333.688) (-7323.239) (-7326.690) [-7320.069] * (-7322.749) (-7334.224) (-7338.716) [-7326.207] -- 0:11:46
      524000 -- (-7332.253) (-7325.658) (-7327.611) [-7322.956] * (-7328.419) [-7335.130] (-7322.398) (-7329.711) -- 0:11:45
      524500 -- [-7326.343] (-7341.935) (-7324.242) (-7316.885) * (-7329.917) (-7326.995) [-7322.766] (-7327.083) -- 0:11:45
      525000 -- (-7328.588) (-7334.092) (-7337.793) [-7323.792] * (-7329.137) (-7315.549) (-7324.951) [-7322.417] -- 0:11:43

      Average standard deviation of split frequencies: 0.010122

      525500 -- [-7322.306] (-7335.897) (-7333.097) (-7317.232) * [-7334.208] (-7322.358) (-7335.604) (-7318.912) -- 0:11:43
      526000 -- (-7326.344) (-7333.641) (-7322.320) [-7325.833] * (-7333.465) (-7328.348) [-7326.516] (-7322.535) -- 0:11:42
      526500 -- (-7326.377) (-7327.613) [-7314.714] (-7323.290) * (-7325.316) (-7331.908) [-7321.101] (-7333.436) -- 0:11:42
      527000 -- (-7330.617) [-7325.049] (-7330.855) (-7322.437) * (-7318.677) [-7317.566] (-7339.308) (-7324.940) -- 0:11:40
      527500 -- [-7338.687] (-7329.726) (-7322.148) (-7334.408) * (-7322.367) (-7324.919) [-7328.155] (-7326.621) -- 0:11:40
      528000 -- (-7323.256) (-7324.333) (-7324.424) [-7325.345] * (-7325.693) [-7327.295] (-7327.295) (-7326.493) -- 0:11:39
      528500 -- [-7323.434] (-7326.012) (-7321.950) (-7330.067) * (-7341.894) (-7326.619) [-7325.126] (-7326.132) -- 0:11:39
      529000 -- (-7328.312) (-7322.958) [-7320.870] (-7324.166) * (-7333.370) (-7324.993) (-7333.828) [-7325.667] -- 0:11:38
      529500 -- (-7328.363) [-7328.902] (-7326.623) (-7322.271) * (-7320.502) (-7319.882) (-7322.846) [-7326.296] -- 0:11:37
      530000 -- (-7322.247) [-7323.149] (-7325.981) (-7326.454) * [-7322.293] (-7325.791) (-7321.619) (-7328.120) -- 0:11:37

      Average standard deviation of split frequencies: 0.010294

      530500 -- (-7327.036) (-7326.863) [-7322.766] (-7327.152) * [-7317.049] (-7329.097) (-7346.495) (-7334.177) -- 0:11:36
      531000 -- (-7325.175) [-7322.563] (-7320.532) (-7328.247) * [-7315.798] (-7329.830) (-7341.105) (-7337.169) -- 0:11:35
      531500 -- [-7317.675] (-7326.009) (-7321.245) (-7323.872) * [-7322.124] (-7336.719) (-7320.256) (-7323.058) -- 0:11:34
      532000 -- (-7327.705) (-7330.925) [-7325.685] (-7323.944) * (-7330.839) (-7321.745) [-7320.277] (-7337.975) -- 0:11:34
      532500 -- (-7328.013) (-7332.418) [-7335.787] (-7326.425) * [-7319.491] (-7332.430) (-7325.165) (-7336.515) -- 0:11:33
      533000 -- (-7326.828) [-7318.632] (-7334.219) (-7335.898) * (-7320.037) [-7332.054] (-7341.701) (-7326.542) -- 0:11:32
      533500 -- (-7320.141) [-7325.344] (-7330.452) (-7326.550) * (-7322.497) (-7332.297) (-7320.175) [-7329.902] -- 0:11:31
      534000 -- (-7324.040) (-7335.323) [-7328.594] (-7331.177) * (-7321.950) [-7319.318] (-7328.413) (-7330.682) -- 0:11:31
      534500 -- (-7331.057) [-7325.533] (-7332.781) (-7324.965) * (-7322.207) (-7333.545) [-7321.401] (-7323.472) -- 0:11:30
      535000 -- [-7327.076] (-7327.890) (-7324.667) (-7331.009) * (-7321.112) (-7319.252) (-7320.478) [-7324.465] -- 0:11:29

      Average standard deviation of split frequencies: 0.010140

      535500 -- (-7326.791) [-7325.915] (-7342.919) (-7325.280) * (-7321.554) (-7327.599) [-7321.653] (-7322.789) -- 0:11:28
      536000 -- [-7328.163] (-7327.503) (-7329.085) (-7329.179) * [-7318.279] (-7340.512) (-7323.210) (-7324.614) -- 0:11:28
      536500 -- [-7323.708] (-7328.695) (-7322.040) (-7331.238) * (-7330.217) (-7333.453) [-7321.376] (-7333.637) -- 0:11:27
      537000 -- (-7349.166) [-7319.991] (-7322.116) (-7323.023) * (-7325.608) [-7326.107] (-7330.112) (-7329.850) -- 0:11:26
      537500 -- (-7336.836) (-7331.490) [-7318.487] (-7326.376) * [-7324.251] (-7330.459) (-7332.049) (-7314.279) -- 0:11:25
      538000 -- (-7331.081) (-7335.256) (-7324.506) [-7322.057] * (-7322.638) [-7318.234] (-7330.452) (-7332.472) -- 0:11:25
      538500 -- (-7329.005) (-7330.504) [-7320.804] (-7326.054) * (-7316.043) (-7328.956) [-7328.281] (-7331.749) -- 0:11:24
      539000 -- [-7325.889] (-7328.365) (-7320.199) (-7333.357) * (-7327.545) (-7335.803) (-7321.949) [-7326.710] -- 0:11:23
      539500 -- [-7319.522] (-7327.689) (-7324.791) (-7321.795) * (-7336.259) (-7331.004) (-7332.396) [-7324.567] -- 0:11:22
      540000 -- [-7320.375] (-7329.018) (-7316.134) (-7324.637) * (-7329.427) (-7328.886) (-7326.738) [-7326.359] -- 0:11:22

      Average standard deviation of split frequencies: 0.010001

      540500 -- [-7325.206] (-7324.833) (-7328.427) (-7335.837) * (-7327.086) (-7315.576) [-7322.118] (-7329.524) -- 0:11:21
      541000 -- [-7325.615] (-7322.279) (-7316.587) (-7327.687) * [-7318.171] (-7327.286) (-7322.279) (-7324.346) -- 0:11:20
      541500 -- (-7339.457) (-7323.508) [-7326.342] (-7328.879) * [-7324.371] (-7333.422) (-7334.726) (-7331.130) -- 0:11:19
      542000 -- (-7330.160) (-7319.197) (-7326.168) [-7330.132] * [-7322.924] (-7334.604) (-7324.542) (-7319.910) -- 0:11:19
      542500 -- (-7330.089) (-7330.408) (-7326.876) [-7322.167] * [-7323.086] (-7327.274) (-7321.713) (-7321.193) -- 0:11:18
      543000 -- (-7329.476) (-7327.534) (-7337.450) [-7332.909] * [-7320.630] (-7334.766) (-7319.340) (-7320.197) -- 0:11:18
      543500 -- [-7331.426] (-7325.361) (-7331.327) (-7322.493) * [-7318.657] (-7329.333) (-7325.623) (-7326.365) -- 0:11:16
      544000 -- (-7326.686) [-7329.609] (-7327.264) (-7331.644) * [-7314.222] (-7331.801) (-7325.782) (-7317.311) -- 0:11:16
      544500 -- (-7328.670) [-7330.322] (-7332.184) (-7350.609) * (-7328.460) [-7331.118] (-7326.777) (-7329.506) -- 0:11:15
      545000 -- (-7332.242) (-7320.886) [-7314.510] (-7328.091) * [-7331.806] (-7323.742) (-7323.133) (-7332.336) -- 0:11:15

      Average standard deviation of split frequencies: 0.010005

      545500 -- (-7334.003) (-7323.892) (-7312.268) [-7333.190] * (-7324.432) (-7334.340) [-7317.927] (-7330.123) -- 0:11:14
      546000 -- (-7331.899) (-7324.938) [-7324.980] (-7324.326) * (-7325.233) (-7340.599) (-7316.725) [-7324.150] -- 0:11:13
      546500 -- (-7324.123) (-7328.585) [-7329.937] (-7325.964) * [-7322.417] (-7332.461) (-7329.977) (-7331.706) -- 0:11:12
      547000 -- (-7334.106) (-7331.106) [-7319.849] (-7326.994) * (-7327.473) (-7324.988) (-7343.780) [-7332.826] -- 0:11:12
      547500 -- [-7332.673] (-7335.969) (-7334.736) (-7321.820) * (-7323.246) [-7320.952] (-7334.018) (-7320.963) -- 0:11:11
      548000 -- (-7329.176) [-7319.489] (-7329.243) (-7323.150) * (-7326.029) [-7329.556] (-7329.376) (-7319.265) -- 0:11:10
      548500 -- (-7321.421) (-7322.601) (-7337.879) [-7318.320] * (-7339.793) (-7346.475) (-7326.707) [-7324.555] -- 0:11:10
      549000 -- (-7324.119) [-7314.492] (-7330.009) (-7322.469) * (-7339.306) (-7337.648) [-7326.988] (-7321.473) -- 0:11:09
      549500 -- (-7335.619) [-7330.613] (-7331.285) (-7325.726) * (-7328.900) [-7325.975] (-7342.597) (-7320.969) -- 0:11:08
      550000 -- (-7324.226) (-7325.430) [-7322.035] (-7326.686) * (-7325.539) (-7332.340) (-7340.108) [-7324.010] -- 0:11:07

      Average standard deviation of split frequencies: 0.009668

      550500 -- (-7327.621) (-7320.346) (-7335.376) [-7322.919] * (-7327.691) [-7330.208] (-7327.704) (-7334.960) -- 0:11:07
      551000 -- [-7319.924] (-7330.035) (-7325.190) (-7329.859) * (-7327.560) (-7320.155) [-7324.273] (-7328.158) -- 0:11:06
      551500 -- [-7319.843] (-7332.052) (-7324.412) (-7324.099) * (-7327.346) [-7329.864] (-7328.531) (-7324.397) -- 0:11:05
      552000 -- (-7333.670) (-7324.019) (-7334.242) [-7330.781] * [-7322.040] (-7323.624) (-7332.537) (-7327.514) -- 0:11:04
      552500 -- [-7321.868] (-7324.809) (-7338.498) (-7320.702) * (-7323.450) [-7319.794] (-7332.751) (-7328.288) -- 0:11:04
      553000 -- (-7321.115) (-7335.029) [-7326.059] (-7325.183) * (-7318.071) [-7320.650] (-7343.137) (-7337.240) -- 0:11:03
      553500 -- (-7326.130) (-7324.271) (-7331.959) [-7328.899] * [-7329.734] (-7326.808) (-7335.891) (-7340.798) -- 0:11:02
      554000 -- (-7340.914) (-7333.834) (-7332.266) [-7320.683] * [-7331.464] (-7332.625) (-7335.141) (-7330.438) -- 0:11:01
      554500 -- [-7328.933] (-7334.862) (-7323.108) (-7330.643) * [-7321.988] (-7322.058) (-7334.843) (-7325.754) -- 0:11:01
      555000 -- (-7337.090) [-7322.678] (-7325.963) (-7327.069) * (-7336.443) (-7330.178) (-7329.563) [-7322.353] -- 0:11:00

      Average standard deviation of split frequencies: 0.009875

      555500 -- (-7324.619) [-7330.978] (-7336.909) (-7333.899) * (-7323.376) (-7326.564) (-7333.893) [-7317.543] -- 0:10:59
      556000 -- (-7342.981) (-7338.701) (-7320.004) [-7333.768] * (-7324.218) (-7331.051) (-7328.374) [-7321.480] -- 0:10:58
      556500 -- (-7328.780) (-7324.680) (-7324.035) [-7325.382] * (-7321.832) (-7330.390) (-7329.767) [-7334.585] -- 0:10:58
      557000 -- [-7319.372] (-7323.312) (-7327.219) (-7328.351) * [-7327.836] (-7319.309) (-7324.273) (-7328.356) -- 0:10:57
      557500 -- (-7317.758) (-7327.853) [-7328.290] (-7326.817) * (-7320.336) [-7316.854] (-7324.525) (-7334.454) -- 0:10:56
      558000 -- (-7321.897) (-7337.920) [-7320.047] (-7333.681) * (-7325.407) (-7325.654) [-7326.799] (-7321.896) -- 0:10:55
      558500 -- (-7320.255) (-7334.503) (-7336.493) [-7321.983] * [-7316.003] (-7334.280) (-7334.168) (-7323.239) -- 0:10:55
      559000 -- [-7324.136] (-7317.723) (-7326.650) (-7334.320) * (-7323.772) (-7327.589) (-7324.425) [-7327.223] -- 0:10:54
      559500 -- (-7317.015) [-7323.134] (-7325.190) (-7326.834) * (-7327.940) [-7320.786] (-7323.256) (-7325.591) -- 0:10:53
      560000 -- (-7330.552) (-7323.528) [-7321.050] (-7326.977) * [-7327.942] (-7324.315) (-7322.221) (-7321.490) -- 0:10:52

      Average standard deviation of split frequencies: 0.009595

      560500 -- [-7323.850] (-7319.604) (-7321.464) (-7319.303) * [-7336.697] (-7332.738) (-7324.026) (-7331.399) -- 0:10:52
      561000 -- (-7321.216) (-7322.942) (-7325.686) [-7320.720] * (-7330.182) (-7321.885) [-7322.958] (-7323.371) -- 0:10:51
      561500 -- [-7326.093] (-7322.636) (-7327.244) (-7330.172) * (-7332.897) [-7319.855] (-7322.313) (-7341.269) -- 0:10:50
      562000 -- (-7325.240) [-7322.745] (-7324.444) (-7326.594) * [-7325.822] (-7332.492) (-7324.683) (-7324.312) -- 0:10:49
      562500 -- [-7327.035] (-7325.427) (-7336.025) (-7329.283) * (-7327.684) [-7319.867] (-7325.003) (-7325.231) -- 0:10:49
      563000 -- (-7325.881) (-7319.593) [-7318.782] (-7323.407) * (-7335.963) (-7337.162) (-7329.429) [-7327.983] -- 0:10:48
      563500 -- (-7329.519) (-7318.276) [-7324.977] (-7336.203) * [-7321.366] (-7328.340) (-7319.515) (-7324.271) -- 0:10:47
      564000 -- (-7332.414) [-7325.715] (-7325.556) (-7331.002) * (-7319.874) [-7322.848] (-7322.997) (-7322.354) -- 0:10:47
      564500 -- (-7333.624) (-7336.276) [-7318.953] (-7330.560) * [-7328.956] (-7335.571) (-7336.297) (-7314.137) -- 0:10:46
      565000 -- (-7322.242) [-7326.810] (-7327.150) (-7319.181) * (-7329.599) (-7336.847) (-7326.529) [-7320.675] -- 0:10:45

      Average standard deviation of split frequencies: 0.009749

      565500 -- (-7328.375) [-7330.402] (-7320.872) (-7323.136) * (-7331.316) (-7340.475) [-7325.610] (-7325.321) -- 0:10:44
      566000 -- (-7326.208) (-7329.584) [-7320.708] (-7326.859) * (-7324.263) [-7322.542] (-7322.656) (-7322.889) -- 0:10:44
      566500 -- (-7325.532) [-7331.581] (-7320.985) (-7328.697) * [-7325.417] (-7338.547) (-7327.950) (-7317.911) -- 0:10:43
      567000 -- (-7327.436) (-7323.031) (-7318.346) [-7319.394] * [-7327.936] (-7326.967) (-7335.594) (-7331.321) -- 0:10:43
      567500 -- (-7322.453) [-7321.969] (-7327.259) (-7333.878) * (-7332.651) (-7329.129) (-7341.089) [-7319.898] -- 0:10:41
      568000 -- (-7333.005) (-7326.686) [-7324.206] (-7334.529) * (-7318.642) (-7320.259) (-7342.318) [-7327.011] -- 0:10:41
      568500 -- (-7330.215) (-7322.856) [-7319.549] (-7334.234) * (-7325.916) (-7315.593) (-7329.938) [-7320.725] -- 0:10:40
      569000 -- (-7332.371) (-7328.814) (-7322.108) [-7339.241] * [-7329.689] (-7325.777) (-7342.136) (-7329.939) -- 0:10:40
      569500 -- (-7327.137) [-7318.972] (-7327.917) (-7323.721) * [-7327.700] (-7335.330) (-7327.828) (-7334.763) -- 0:10:38
      570000 -- (-7336.630) (-7323.407) [-7333.965] (-7328.757) * [-7320.919] (-7334.582) (-7334.208) (-7324.346) -- 0:10:38

      Average standard deviation of split frequencies: 0.008698

      570500 -- [-7324.154] (-7323.208) (-7331.944) (-7319.049) * [-7321.540] (-7329.611) (-7320.589) (-7324.830) -- 0:10:37
      571000 -- (-7324.797) (-7326.537) [-7323.814] (-7317.346) * (-7320.480) (-7333.047) (-7345.164) [-7327.238] -- 0:10:37
      571500 -- (-7329.828) (-7323.965) [-7329.181] (-7328.127) * [-7320.797] (-7321.578) (-7333.621) (-7327.257) -- 0:10:35
      572000 -- (-7327.448) (-7317.563) [-7329.863] (-7323.928) * (-7331.107) [-7322.962] (-7337.042) (-7338.168) -- 0:10:35
      572500 -- (-7324.214) [-7323.418] (-7324.501) (-7327.006) * (-7331.926) [-7325.728] (-7324.706) (-7333.325) -- 0:10:34
      573000 -- (-7335.849) [-7324.270] (-7324.314) (-7314.639) * (-7335.341) (-7318.843) [-7323.943] (-7325.371) -- 0:10:34
      573500 -- (-7336.001) (-7323.169) (-7326.908) [-7321.668] * [-7328.275] (-7325.295) (-7326.691) (-7322.380) -- 0:10:32
      574000 -- [-7324.588] (-7327.191) (-7329.255) (-7331.626) * (-7317.476) (-7329.500) (-7318.885) [-7322.549] -- 0:10:32
      574500 -- [-7329.344] (-7326.037) (-7327.709) (-7334.477) * (-7319.163) [-7322.799] (-7321.525) (-7325.392) -- 0:10:31
      575000 -- (-7340.476) [-7324.938] (-7328.281) (-7330.393) * [-7317.830] (-7321.471) (-7326.218) (-7327.558) -- 0:10:31

      Average standard deviation of split frequencies: 0.008184

      575500 -- (-7324.014) [-7317.719] (-7334.036) (-7317.996) * [-7313.246] (-7332.954) (-7332.486) (-7324.840) -- 0:10:29
      576000 -- (-7326.300) [-7317.703] (-7321.244) (-7322.715) * [-7325.585] (-7325.870) (-7330.914) (-7330.786) -- 0:10:29
      576500 -- [-7328.905] (-7332.107) (-7336.944) (-7332.295) * (-7326.735) [-7325.467] (-7333.321) (-7320.272) -- 0:10:28
      577000 -- [-7326.822] (-7319.540) (-7327.644) (-7329.764) * (-7327.322) (-7322.821) [-7316.507] (-7323.293) -- 0:10:28
      577500 -- (-7325.845) [-7320.021] (-7335.337) (-7326.808) * (-7323.613) (-7324.303) [-7320.572] (-7339.228) -- 0:10:26
      578000 -- (-7327.111) [-7320.967] (-7328.555) (-7329.993) * [-7318.455] (-7327.035) (-7322.116) (-7328.246) -- 0:10:26
      578500 -- (-7340.236) (-7323.837) (-7321.938) [-7327.901] * (-7325.835) (-7341.162) (-7326.896) [-7323.252] -- 0:10:25
      579000 -- (-7334.005) (-7324.915) [-7321.032] (-7317.613) * [-7330.533] (-7332.275) (-7340.891) (-7324.652) -- 0:10:25
      579500 -- (-7335.431) [-7322.633] (-7327.418) (-7318.047) * (-7332.582) (-7328.118) (-7335.805) [-7318.312] -- 0:10:24
      580000 -- (-7349.355) (-7322.109) [-7325.505] (-7327.361) * [-7320.571] (-7333.149) (-7328.247) (-7327.782) -- 0:10:23

      Average standard deviation of split frequencies: 0.008500

      580500 -- (-7321.642) (-7325.316) (-7323.395) [-7345.466] * (-7325.332) (-7329.276) (-7328.595) [-7323.535] -- 0:10:22
      581000 -- (-7327.469) (-7326.592) (-7327.784) [-7327.223] * [-7314.655] (-7326.625) (-7329.750) (-7333.920) -- 0:10:22
      581500 -- [-7320.234] (-7331.581) (-7317.367) (-7326.299) * (-7323.380) [-7327.010] (-7323.240) (-7330.648) -- 0:10:21
      582000 -- [-7324.198] (-7324.812) (-7337.995) (-7324.361) * (-7334.741) [-7319.380] (-7321.383) (-7332.963) -- 0:10:20
      582500 -- (-7323.764) [-7329.543] (-7323.095) (-7321.563) * (-7335.238) [-7319.890] (-7328.012) (-7322.861) -- 0:10:19
      583000 -- (-7331.644) (-7332.918) [-7324.754] (-7325.809) * (-7331.907) [-7323.366] (-7334.081) (-7324.777) -- 0:10:19
      583500 -- (-7324.039) (-7330.405) [-7324.195] (-7330.999) * (-7333.067) [-7327.889] (-7328.696) (-7324.835) -- 0:10:18
      584000 -- (-7335.369) (-7344.432) [-7323.002] (-7336.799) * (-7332.234) (-7329.349) (-7317.440) [-7328.609] -- 0:10:17
      584500 -- [-7319.564] (-7336.933) (-7319.138) (-7329.959) * (-7338.657) [-7324.346] (-7334.429) (-7330.207) -- 0:10:17
      585000 -- (-7336.800) (-7330.611) (-7320.051) [-7327.211] * (-7342.492) [-7327.579] (-7338.280) (-7335.015) -- 0:10:16

      Average standard deviation of split frequencies: 0.008234

      585500 -- (-7336.608) (-7327.629) [-7321.590] (-7326.453) * (-7328.464) (-7321.327) (-7320.176) [-7320.601] -- 0:10:15
      586000 -- (-7333.342) (-7330.806) [-7323.765] (-7334.479) * (-7321.598) (-7321.943) [-7327.612] (-7326.721) -- 0:10:14
      586500 -- (-7325.334) [-7336.631] (-7331.582) (-7321.862) * (-7323.012) (-7324.004) [-7324.864] (-7322.385) -- 0:10:14
      587000 -- [-7324.685] (-7331.070) (-7315.860) (-7322.268) * (-7327.326) (-7327.894) (-7323.807) [-7322.371] -- 0:10:13
      587500 -- (-7331.161) [-7331.814] (-7321.625) (-7324.846) * (-7326.320) (-7326.587) [-7323.072] (-7318.213) -- 0:10:12
      588000 -- (-7324.451) (-7342.693) [-7317.753] (-7326.979) * [-7320.673] (-7324.307) (-7329.813) (-7327.160) -- 0:10:11
      588500 -- (-7321.846) (-7326.091) (-7331.953) [-7323.419] * [-7323.000] (-7335.228) (-7333.368) (-7322.234) -- 0:10:11
      589000 -- (-7316.165) [-7329.177] (-7331.478) (-7328.427) * (-7327.138) (-7324.195) (-7329.811) [-7318.174] -- 0:10:10
      589500 -- [-7325.338] (-7334.843) (-7325.750) (-7329.804) * (-7325.870) (-7325.846) [-7320.303] (-7323.160) -- 0:10:10
      590000 -- (-7321.030) (-7322.545) [-7317.783] (-7330.206) * (-7329.536) (-7327.675) [-7323.139] (-7320.661) -- 0:10:08

      Average standard deviation of split frequencies: 0.007699

      590500 -- [-7320.128] (-7324.869) (-7326.246) (-7336.878) * (-7329.414) [-7319.219] (-7323.434) (-7327.681) -- 0:10:08
      591000 -- [-7322.501] (-7324.974) (-7329.779) (-7321.082) * (-7338.073) [-7324.347] (-7332.458) (-7330.282) -- 0:10:07
      591500 -- (-7329.312) [-7325.979] (-7322.531) (-7326.967) * (-7329.127) (-7330.818) (-7330.709) [-7319.298] -- 0:10:07
      592000 -- (-7327.058) [-7330.694] (-7319.990) (-7332.195) * (-7333.975) (-7327.985) (-7326.040) [-7322.725] -- 0:10:05
      592500 -- (-7323.557) (-7328.942) (-7320.417) [-7324.103] * [-7328.756] (-7326.916) (-7328.508) (-7332.406) -- 0:10:05
      593000 -- (-7325.673) (-7324.947) (-7321.248) [-7339.930] * (-7330.070) [-7318.448] (-7324.467) (-7321.645) -- 0:10:04
      593500 -- (-7331.131) [-7321.000] (-7323.029) (-7331.503) * (-7333.216) (-7326.330) [-7329.091] (-7322.123) -- 0:10:04
      594000 -- (-7333.670) [-7324.335] (-7326.709) (-7328.506) * [-7324.906] (-7329.148) (-7331.516) (-7330.095) -- 0:10:02
      594500 -- (-7339.606) (-7322.888) [-7321.934] (-7328.960) * (-7320.483) (-7336.548) (-7323.650) [-7334.400] -- 0:10:02
      595000 -- (-7323.321) (-7325.265) (-7323.249) [-7330.175] * [-7323.736] (-7326.175) (-7321.017) (-7331.049) -- 0:10:01

      Average standard deviation of split frequencies: 0.007723

      595500 -- (-7324.668) (-7328.748) [-7318.033] (-7334.057) * [-7330.349] (-7328.000) (-7320.697) (-7325.999) -- 0:10:01
      596000 -- (-7326.886) [-7333.475] (-7321.527) (-7329.251) * [-7323.654] (-7326.595) (-7340.263) (-7330.652) -- 0:09:59
      596500 -- (-7322.192) (-7338.604) (-7320.984) [-7332.329] * [-7326.334] (-7331.373) (-7323.131) (-7321.865) -- 0:09:59
      597000 -- (-7318.555) [-7335.535] (-7322.479) (-7323.141) * (-7336.504) (-7325.150) (-7322.228) [-7325.047] -- 0:09:58
      597500 -- [-7322.900] (-7326.369) (-7333.525) (-7327.836) * (-7315.023) [-7324.121] (-7330.815) (-7320.226) -- 0:09:58
      598000 -- [-7322.892] (-7329.178) (-7337.132) (-7328.040) * [-7319.098] (-7326.557) (-7321.469) (-7326.699) -- 0:09:56
      598500 -- [-7325.057] (-7334.446) (-7325.889) (-7329.400) * (-7340.328) [-7323.221] (-7337.378) (-7323.419) -- 0:09:56
      599000 -- [-7323.612] (-7334.419) (-7320.811) (-7329.752) * (-7328.346) [-7320.383] (-7329.320) (-7336.759) -- 0:09:55
      599500 -- (-7329.579) [-7320.920] (-7339.710) (-7339.360) * [-7327.520] (-7329.482) (-7326.057) (-7334.736) -- 0:09:55
      600000 -- (-7329.210) (-7324.003) (-7323.439) [-7332.989] * (-7322.113) (-7329.665) [-7319.146] (-7328.778) -- 0:09:54

      Average standard deviation of split frequencies: 0.006832

      600500 -- (-7332.577) (-7325.160) [-7323.191] (-7330.215) * (-7322.099) (-7323.088) (-7318.668) [-7326.894] -- 0:09:53
      601000 -- [-7329.556] (-7328.429) (-7315.564) (-7332.693) * (-7339.714) (-7318.708) (-7321.814) [-7319.711] -- 0:09:52
      601500 -- [-7327.361] (-7321.467) (-7323.713) (-7341.664) * (-7334.704) (-7327.447) (-7323.176) [-7329.547] -- 0:09:52
      602000 -- (-7323.113) (-7318.627) [-7315.544] (-7324.074) * (-7315.348) (-7326.341) (-7316.976) [-7325.527] -- 0:09:51
      602500 -- [-7321.188] (-7322.384) (-7325.617) (-7322.621) * (-7326.283) [-7324.338] (-7319.391) (-7337.987) -- 0:09:50
      603000 -- (-7329.595) (-7318.867) (-7322.847) [-7317.043] * (-7326.510) (-7326.780) [-7316.812] (-7344.172) -- 0:09:49
      603500 -- (-7319.840) (-7324.348) (-7335.499) [-7313.775] * (-7325.094) [-7332.952] (-7320.283) (-7330.531) -- 0:09:49
      604000 -- [-7321.568] (-7327.294) (-7331.693) (-7320.613) * (-7325.848) (-7319.311) (-7337.230) [-7327.233] -- 0:09:48
      604500 -- (-7322.777) (-7325.211) (-7327.233) [-7331.524] * (-7327.160) [-7315.483] (-7332.484) (-7331.725) -- 0:09:47
      605000 -- (-7335.073) [-7316.844] (-7326.765) (-7335.222) * [-7320.194] (-7321.193) (-7326.959) (-7328.206) -- 0:09:46

      Average standard deviation of split frequencies: 0.006910

      605500 -- (-7325.932) (-7330.491) (-7330.663) [-7328.153] * (-7325.384) (-7325.131) [-7317.708] (-7330.467) -- 0:09:46
      606000 -- (-7328.122) (-7326.769) (-7325.276) [-7328.681] * (-7320.482) (-7324.220) (-7324.177) [-7332.031] -- 0:09:45
      606500 -- (-7319.844) [-7329.709] (-7332.701) (-7326.284) * (-7320.688) (-7330.668) [-7317.765] (-7314.873) -- 0:09:44
      607000 -- [-7324.567] (-7333.175) (-7331.312) (-7320.051) * (-7325.856) (-7326.705) (-7321.027) [-7322.171] -- 0:09:43
      607500 -- (-7329.644) (-7330.747) (-7337.370) [-7318.720] * (-7335.326) [-7323.891] (-7325.858) (-7327.127) -- 0:09:43
      608000 -- (-7324.814) [-7324.784] (-7332.855) (-7327.462) * (-7336.770) (-7330.267) [-7320.602] (-7330.510) -- 0:09:42
      608500 -- (-7332.353) (-7332.395) [-7337.742] (-7329.089) * (-7329.312) (-7324.419) (-7323.806) [-7327.499] -- 0:09:41
      609000 -- (-7323.533) [-7326.844] (-7339.359) (-7324.065) * [-7321.856] (-7325.870) (-7327.696) (-7321.133) -- 0:09:41
      609500 -- [-7330.998] (-7340.215) (-7332.524) (-7323.995) * (-7327.168) (-7333.257) [-7327.540] (-7326.007) -- 0:09:40
      610000 -- (-7326.772) (-7338.972) (-7326.905) [-7321.398] * [-7330.486] (-7336.375) (-7329.801) (-7328.312) -- 0:09:39

      Average standard deviation of split frequencies: 0.006630

      610500 -- (-7324.211) (-7326.849) [-7330.645] (-7331.216) * [-7322.575] (-7326.952) (-7339.826) (-7321.709) -- 0:09:38
      611000 -- [-7323.856] (-7332.449) (-7322.832) (-7327.120) * (-7319.811) [-7325.808] (-7336.187) (-7326.180) -- 0:09:38
      611500 -- [-7328.818] (-7327.360) (-7331.821) (-7328.795) * [-7322.324] (-7332.986) (-7318.830) (-7325.827) -- 0:09:37
      612000 -- [-7333.520] (-7318.306) (-7343.110) (-7327.903) * [-7329.926] (-7327.260) (-7328.978) (-7322.066) -- 0:09:36
      612500 -- (-7326.476) [-7321.430] (-7344.011) (-7331.948) * (-7331.196) (-7331.028) [-7329.678] (-7325.940) -- 0:09:35
      613000 -- (-7325.070) [-7319.875] (-7326.372) (-7329.048) * (-7338.046) (-7335.464) [-7324.134] (-7331.659) -- 0:09:35
      613500 -- (-7330.951) [-7317.447] (-7329.227) (-7325.398) * (-7322.223) (-7337.732) (-7325.013) [-7320.444] -- 0:09:34
      614000 -- (-7333.410) [-7325.649] (-7331.077) (-7332.398) * (-7325.682) (-7333.310) [-7321.871] (-7328.208) -- 0:09:33
      614500 -- (-7330.318) (-7331.261) [-7324.925] (-7328.650) * (-7328.589) (-7332.245) (-7322.727) [-7327.595] -- 0:09:32
      615000 -- (-7325.468) (-7316.698) (-7331.142) [-7314.675] * (-7322.926) [-7327.700] (-7328.268) (-7326.992) -- 0:09:32

      Average standard deviation of split frequencies: 0.006392

      615500 -- [-7320.996] (-7312.334) (-7323.734) (-7332.747) * [-7330.330] (-7335.888) (-7321.659) (-7336.488) -- 0:09:31
      616000 -- (-7322.890) [-7323.550] (-7324.495) (-7325.389) * (-7327.133) [-7327.817] (-7328.018) (-7337.192) -- 0:09:30
      616500 -- (-7333.605) [-7319.830] (-7324.302) (-7324.028) * (-7331.456) [-7322.293] (-7329.315) (-7318.596) -- 0:09:29
      617000 -- (-7326.699) (-7318.127) (-7325.515) [-7323.114] * (-7324.564) (-7320.036) (-7333.126) [-7326.392] -- 0:09:29
      617500 -- (-7330.759) (-7328.349) (-7330.961) [-7318.370] * (-7326.821) (-7329.204) (-7334.569) [-7328.089] -- 0:09:28
      618000 -- (-7332.974) (-7328.705) (-7327.710) [-7320.903] * [-7316.732] (-7339.897) (-7334.395) (-7322.286) -- 0:09:27
      618500 -- (-7337.062) (-7327.837) [-7320.724] (-7325.691) * [-7317.614] (-7335.056) (-7333.007) (-7323.857) -- 0:09:26
      619000 -- (-7320.036) [-7324.083] (-7320.944) (-7323.971) * (-7320.475) (-7332.019) (-7323.718) [-7319.571] -- 0:09:26
      619500 -- [-7321.172] (-7338.619) (-7328.623) (-7317.405) * (-7324.818) (-7331.251) [-7325.469] (-7323.800) -- 0:09:25
      620000 -- (-7331.294) [-7330.230] (-7325.825) (-7323.542) * [-7316.947] (-7336.614) (-7326.717) (-7321.317) -- 0:09:25

      Average standard deviation of split frequencies: 0.006389

      620500 -- (-7325.316) (-7333.546) [-7330.989] (-7323.615) * (-7325.245) [-7319.886] (-7327.395) (-7330.788) -- 0:09:23
      621000 -- (-7322.511) (-7329.004) [-7327.032] (-7324.529) * (-7341.823) (-7323.581) (-7332.176) [-7325.604] -- 0:09:23
      621500 -- (-7323.546) [-7319.284] (-7330.408) (-7330.329) * (-7331.882) [-7325.778] (-7331.523) (-7324.189) -- 0:09:22
      622000 -- [-7320.910] (-7337.494) (-7326.292) (-7326.766) * (-7319.440) (-7331.428) [-7327.844] (-7328.505) -- 0:09:22
      622500 -- (-7318.362) (-7321.483) (-7331.102) [-7322.450] * (-7327.858) (-7333.118) (-7336.967) [-7318.697] -- 0:09:20
      623000 -- [-7325.391] (-7318.576) (-7336.864) (-7325.568) * (-7333.178) [-7318.067] (-7328.643) (-7320.160) -- 0:09:20
      623500 -- (-7336.777) [-7322.785] (-7321.502) (-7324.986) * (-7334.819) (-7329.035) (-7323.656) [-7320.372] -- 0:09:19
      624000 -- (-7328.570) [-7327.758] (-7324.005) (-7326.252) * (-7325.781) (-7337.538) (-7322.705) [-7332.320] -- 0:09:19
      624500 -- [-7332.057] (-7330.329) (-7327.206) (-7325.179) * [-7322.342] (-7338.476) (-7325.977) (-7329.351) -- 0:09:17
      625000 -- (-7333.362) (-7323.770) (-7328.268) [-7319.299] * (-7328.326) (-7317.489) (-7320.735) [-7318.504] -- 0:09:17

      Average standard deviation of split frequencies: 0.007043

      625500 -- (-7321.179) (-7325.330) (-7327.068) [-7321.293] * (-7321.267) [-7319.595] (-7327.107) (-7327.936) -- 0:09:16
      626000 -- [-7322.904] (-7326.315) (-7324.361) (-7329.472) * (-7330.982) (-7319.966) [-7324.141] (-7344.077) -- 0:09:16
      626500 -- (-7323.809) (-7328.401) [-7328.876] (-7318.662) * [-7324.509] (-7324.780) (-7329.411) (-7336.993) -- 0:09:15
      627000 -- (-7330.153) (-7331.293) (-7335.358) [-7326.691] * (-7335.492) [-7316.784] (-7330.494) (-7325.671) -- 0:09:14
      627500 -- (-7329.447) [-7319.588] (-7329.804) (-7333.916) * (-7327.070) [-7324.099] (-7336.859) (-7328.612) -- 0:09:13
      628000 -- (-7324.851) [-7328.555] (-7329.313) (-7336.402) * (-7326.323) (-7324.046) (-7334.302) [-7325.718] -- 0:09:13
      628500 -- [-7324.273] (-7321.497) (-7322.841) (-7324.454) * [-7318.090] (-7331.580) (-7339.353) (-7331.524) -- 0:09:12
      629000 -- [-7322.443] (-7327.393) (-7325.286) (-7325.133) * [-7324.598] (-7321.935) (-7335.610) (-7322.389) -- 0:09:11
      629500 -- (-7322.219) (-7330.489) (-7330.727) [-7330.997] * (-7333.818) (-7327.505) (-7323.874) [-7317.135] -- 0:09:10
      630000 -- (-7322.290) (-7328.326) [-7331.107] (-7329.749) * (-7338.615) [-7321.299] (-7329.095) (-7327.540) -- 0:09:10

      Average standard deviation of split frequencies: 0.006507

      630500 -- [-7311.755] (-7323.907) (-7327.553) (-7325.777) * (-7332.650) (-7322.756) (-7318.704) [-7319.631] -- 0:09:09
      631000 -- (-7322.989) (-7347.416) (-7328.084) [-7323.682] * (-7333.977) (-7328.472) [-7317.661] (-7327.649) -- 0:09:08
      631500 -- [-7317.518] (-7329.706) (-7326.495) (-7337.312) * [-7335.094] (-7322.826) (-7326.295) (-7329.755) -- 0:09:07
      632000 -- (-7324.434) (-7328.129) (-7333.470) [-7321.953] * (-7325.859) [-7316.619] (-7332.111) (-7334.946) -- 0:09:07
      632500 -- [-7326.972] (-7336.831) (-7327.256) (-7321.451) * (-7322.585) [-7322.083] (-7334.945) (-7321.603) -- 0:09:06
      633000 -- [-7321.132] (-7321.817) (-7339.939) (-7327.836) * (-7326.710) (-7326.732) (-7321.582) [-7324.351] -- 0:09:05
      633500 -- (-7328.672) (-7329.230) (-7333.946) [-7322.774] * [-7327.620] (-7325.955) (-7325.416) (-7323.726) -- 0:09:04
      634000 -- (-7326.656) [-7316.866] (-7325.727) (-7320.371) * (-7334.988) (-7321.665) (-7322.952) [-7323.714] -- 0:09:04
      634500 -- (-7332.479) (-7330.005) (-7326.862) [-7323.382] * [-7327.747] (-7326.892) (-7327.700) (-7319.841) -- 0:09:03
      635000 -- (-7336.674) (-7335.354) [-7319.173] (-7327.613) * (-7337.211) (-7326.961) (-7333.469) [-7318.440] -- 0:09:02

      Average standard deviation of split frequencies: 0.006714

      635500 -- (-7329.328) (-7328.408) [-7324.002] (-7331.450) * (-7332.398) (-7329.390) [-7324.591] (-7318.452) -- 0:09:02
      636000 -- (-7323.298) (-7338.138) (-7333.913) [-7328.188] * (-7320.539) (-7337.792) (-7331.205) [-7321.691] -- 0:09:01
      636500 -- (-7325.844) (-7332.882) (-7327.512) [-7325.319] * [-7331.469] (-7326.241) (-7327.926) (-7328.410) -- 0:09:00
      637000 -- (-7336.251) (-7335.787) (-7324.687) [-7317.815] * (-7326.209) (-7326.416) (-7325.773) [-7317.025] -- 0:08:59
      637500 -- (-7325.616) [-7323.177] (-7321.756) (-7321.328) * (-7330.315) [-7317.806] (-7328.698) (-7320.168) -- 0:08:59
      638000 -- [-7324.805] (-7326.905) (-7328.103) (-7324.577) * (-7326.537) [-7323.561] (-7325.306) (-7323.682) -- 0:08:58
      638500 -- (-7338.141) [-7328.082] (-7325.621) (-7329.220) * [-7324.057] (-7322.716) (-7320.327) (-7320.337) -- 0:08:57
      639000 -- [-7316.902] (-7328.120) (-7322.178) (-7333.908) * (-7336.125) (-7326.550) (-7330.898) [-7322.277] -- 0:08:56
      639500 -- [-7322.018] (-7326.031) (-7316.339) (-7332.566) * [-7329.682] (-7323.016) (-7337.617) (-7328.471) -- 0:08:56
      640000 -- [-7323.597] (-7325.362) (-7320.666) (-7330.874) * (-7320.195) [-7326.852] (-7329.131) (-7329.591) -- 0:08:55

      Average standard deviation of split frequencies: 0.006492

      640500 -- (-7325.043) (-7321.233) [-7320.789] (-7335.161) * (-7329.559) [-7323.563] (-7329.332) (-7330.633) -- 0:08:54
      641000 -- (-7330.287) (-7315.819) (-7318.117) [-7333.420] * (-7327.826) [-7331.165] (-7326.060) (-7334.658) -- 0:08:53
      641500 -- (-7324.053) (-7322.896) (-7318.877) [-7323.013] * (-7319.896) [-7321.449] (-7324.250) (-7327.393) -- 0:08:53
      642000 -- (-7319.988) (-7320.120) (-7317.672) [-7319.536] * (-7325.314) (-7333.549) (-7337.905) [-7319.937] -- 0:08:52
      642500 -- [-7321.105] (-7318.717) (-7315.938) (-7321.277) * [-7323.523] (-7326.598) (-7317.635) (-7333.041) -- 0:08:51
      643000 -- (-7320.423) (-7327.611) (-7327.176) [-7336.640] * (-7331.802) (-7331.436) (-7313.837) [-7321.869] -- 0:08:50
      643500 -- [-7326.732] (-7325.406) (-7324.306) (-7333.351) * [-7321.647] (-7329.685) (-7318.712) (-7320.752) -- 0:08:50
      644000 -- (-7331.631) (-7328.750) [-7321.849] (-7326.760) * [-7328.046] (-7334.729) (-7326.338) (-7326.560) -- 0:08:49
      644500 -- (-7338.301) (-7324.560) [-7320.427] (-7338.718) * [-7317.252] (-7331.978) (-7321.910) (-7330.659) -- 0:08:48
      645000 -- (-7322.760) (-7333.876) [-7316.041] (-7336.805) * (-7335.361) (-7332.124) (-7334.245) [-7320.324] -- 0:08:47

      Average standard deviation of split frequencies: 0.006739

      645500 -- (-7320.487) (-7323.223) [-7322.149] (-7326.539) * [-7324.045] (-7329.891) (-7323.879) (-7323.218) -- 0:08:47
      646000 -- [-7318.018] (-7321.263) (-7327.769) (-7325.870) * (-7327.966) (-7331.545) [-7319.294] (-7334.811) -- 0:08:46
      646500 -- (-7317.645) (-7331.214) [-7331.618] (-7324.549) * (-7320.622) (-7332.383) [-7327.728] (-7333.734) -- 0:08:45
      647000 -- [-7317.886] (-7330.545) (-7336.036) (-7331.646) * (-7318.515) (-7336.187) [-7323.253] (-7321.117) -- 0:08:44
      647500 -- (-7320.790) (-7333.078) (-7323.414) [-7322.747] * (-7321.641) (-7333.918) (-7319.393) [-7329.550] -- 0:08:44
      648000 -- (-7330.091) (-7329.595) [-7329.890] (-7331.975) * [-7313.861] (-7323.328) (-7324.740) (-7330.225) -- 0:08:43
      648500 -- (-7335.183) (-7325.345) [-7319.741] (-7315.675) * (-7330.717) (-7318.955) [-7329.881] (-7326.494) -- 0:08:42
      649000 -- (-7329.196) (-7322.442) [-7323.815] (-7325.365) * (-7329.206) (-7323.545) [-7321.309] (-7320.553) -- 0:08:41
      649500 -- (-7320.220) (-7319.427) (-7320.815) [-7325.777] * [-7321.679] (-7330.601) (-7324.916) (-7322.652) -- 0:08:41
      650000 -- (-7325.924) (-7323.798) (-7320.343) [-7329.778] * (-7325.308) (-7327.060) (-7325.673) [-7320.762] -- 0:08:40

      Average standard deviation of split frequencies: 0.006734

      650500 -- (-7325.244) (-7332.840) [-7319.020] (-7322.868) * (-7320.743) [-7319.734] (-7336.881) (-7322.019) -- 0:08:39
      651000 -- (-7337.547) [-7322.191] (-7319.672) (-7333.652) * (-7322.149) (-7326.545) [-7330.272] (-7318.008) -- 0:08:38
      651500 -- [-7331.005] (-7324.281) (-7331.534) (-7328.257) * [-7325.881] (-7325.824) (-7330.659) (-7327.616) -- 0:08:38
      652000 -- (-7323.502) (-7336.540) [-7322.022] (-7324.340) * [-7321.639] (-7330.943) (-7325.497) (-7330.473) -- 0:08:37
      652500 -- (-7322.884) (-7327.041) [-7327.385] (-7331.463) * (-7324.865) (-7328.200) [-7321.663] (-7319.187) -- 0:08:36
      653000 -- [-7324.910] (-7329.287) (-7331.526) (-7335.399) * (-7330.007) (-7327.111) (-7324.839) [-7318.781] -- 0:08:35
      653500 -- (-7322.784) (-7328.716) [-7321.180] (-7334.670) * (-7336.519) (-7323.768) (-7322.667) [-7325.388] -- 0:08:35
      654000 -- (-7314.719) (-7325.430) [-7326.298] (-7324.879) * (-7334.185) (-7318.214) [-7318.206] (-7327.384) -- 0:08:34
      654500 -- [-7323.006] (-7325.826) (-7326.582) (-7334.398) * [-7322.704] (-7329.597) (-7318.350) (-7325.377) -- 0:08:33
      655000 -- [-7314.608] (-7323.681) (-7333.847) (-7332.462) * (-7326.771) [-7317.187] (-7312.963) (-7327.782) -- 0:08:33

      Average standard deviation of split frequencies: 0.006975

      655500 -- (-7322.439) [-7319.224] (-7322.697) (-7322.194) * (-7341.189) [-7329.624] (-7320.224) (-7322.546) -- 0:08:32
      656000 -- (-7324.588) (-7320.964) (-7330.757) [-7317.543] * [-7322.316] (-7325.114) (-7325.362) (-7321.825) -- 0:08:31
      656500 -- (-7323.779) (-7337.241) [-7332.953] (-7324.498) * [-7325.288] (-7318.109) (-7325.020) (-7324.104) -- 0:08:30
      657000 -- (-7341.356) [-7328.031] (-7326.435) (-7317.141) * (-7330.594) (-7321.742) [-7318.097] (-7341.508) -- 0:08:30
      657500 -- (-7351.146) (-7325.894) [-7325.816] (-7327.414) * (-7333.000) (-7327.436) [-7316.086] (-7330.125) -- 0:08:29
      658000 -- (-7340.027) (-7330.349) [-7327.817] (-7319.699) * (-7333.146) (-7334.756) [-7322.624] (-7332.142) -- 0:08:28
      658500 -- (-7326.839) [-7322.045] (-7339.366) (-7324.530) * (-7336.501) (-7337.172) (-7324.931) [-7324.507] -- 0:08:27
      659000 -- (-7318.019) (-7322.149) [-7318.468] (-7325.708) * [-7328.529] (-7340.650) (-7323.681) (-7324.392) -- 0:08:27
      659500 -- [-7321.968] (-7332.896) (-7335.091) (-7330.043) * [-7320.455] (-7328.066) (-7335.741) (-7328.200) -- 0:08:26
      660000 -- (-7322.585) (-7321.300) [-7319.839] (-7330.532) * (-7328.329) [-7318.242] (-7328.098) (-7331.626) -- 0:08:25

      Average standard deviation of split frequencies: 0.006800

      660500 -- (-7322.839) [-7323.097] (-7322.137) (-7323.993) * (-7322.988) [-7324.820] (-7327.233) (-7331.540) -- 0:08:24
      661000 -- (-7325.684) (-7334.875) [-7324.493] (-7326.663) * (-7321.486) [-7319.736] (-7320.890) (-7331.063) -- 0:08:24
      661500 -- (-7326.027) (-7324.806) (-7336.238) [-7322.211] * (-7324.542) (-7325.441) [-7319.225] (-7326.061) -- 0:08:23
      662000 -- (-7328.174) [-7315.060] (-7326.696) (-7329.680) * (-7329.999) (-7323.231) [-7313.802] (-7326.664) -- 0:08:22
      662500 -- (-7330.834) (-7320.733) (-7322.367) [-7331.330] * [-7328.140] (-7320.305) (-7324.651) (-7329.962) -- 0:08:22
      663000 -- (-7327.342) [-7326.372] (-7325.922) (-7330.160) * (-7327.098) (-7323.925) [-7330.236] (-7333.409) -- 0:08:21
      663500 -- (-7323.298) (-7332.647) [-7323.625] (-7339.082) * [-7321.813] (-7330.200) (-7324.514) (-7337.000) -- 0:08:20
      664000 -- (-7328.354) (-7328.009) [-7319.521] (-7323.485) * (-7323.457) (-7319.958) (-7324.849) [-7317.940] -- 0:08:19
      664500 -- (-7323.130) (-7328.990) [-7324.039] (-7325.964) * (-7327.324) [-7323.313] (-7336.417) (-7319.979) -- 0:08:19
      665000 -- [-7320.751] (-7321.747) (-7331.642) (-7325.507) * (-7330.056) (-7324.687) [-7338.219] (-7324.244) -- 0:08:18

      Average standard deviation of split frequencies: 0.006745

      665500 -- (-7332.862) [-7322.865] (-7338.150) (-7328.421) * [-7324.247] (-7339.365) (-7333.128) (-7322.612) -- 0:08:17
      666000 -- (-7328.998) (-7327.485) [-7331.062] (-7320.669) * (-7321.209) [-7320.054] (-7341.125) (-7333.126) -- 0:08:16
      666500 -- [-7330.777] (-7332.211) (-7329.988) (-7326.224) * (-7326.537) (-7337.418) (-7338.525) [-7320.617] -- 0:08:16
      667000 -- (-7330.132) (-7330.721) [-7328.559] (-7326.686) * (-7320.989) [-7332.801] (-7322.642) (-7331.342) -- 0:08:15
      667500 -- (-7340.024) [-7331.595] (-7322.364) (-7323.230) * (-7320.106) (-7330.012) [-7330.726] (-7328.143) -- 0:08:14
      668000 -- (-7328.799) [-7328.233] (-7319.155) (-7323.212) * [-7325.190] (-7333.836) (-7344.017) (-7327.033) -- 0:08:14
      668500 -- [-7329.764] (-7321.698) (-7329.806) (-7318.356) * (-7327.508) [-7322.939] (-7328.991) (-7329.062) -- 0:08:13
      669000 -- (-7341.856) [-7321.806] (-7329.857) (-7324.167) * (-7320.555) (-7331.142) (-7331.032) [-7318.789] -- 0:08:12
      669500 -- (-7329.724) [-7319.963] (-7324.891) (-7345.630) * [-7325.839] (-7336.387) (-7333.975) (-7333.051) -- 0:08:11
      670000 -- (-7326.072) (-7334.181) [-7319.221] (-7335.568) * (-7330.858) (-7330.019) [-7317.910] (-7330.890) -- 0:08:11

      Average standard deviation of split frequencies: 0.007029

      670500 -- (-7327.772) (-7328.472) (-7327.711) [-7323.102] * (-7345.900) (-7324.297) [-7329.910] (-7340.274) -- 0:08:10
      671000 -- (-7320.539) (-7331.234) (-7326.858) [-7315.353] * (-7338.254) [-7324.877] (-7321.468) (-7336.112) -- 0:08:09
      671500 -- (-7325.507) (-7329.108) [-7320.239] (-7326.215) * [-7322.846] (-7324.017) (-7321.855) (-7327.443) -- 0:08:08
      672000 -- (-7339.460) (-7333.579) (-7328.943) [-7322.500] * (-7326.736) (-7321.867) (-7326.255) [-7328.593] -- 0:08:08
      672500 -- [-7329.012] (-7323.921) (-7320.107) (-7329.279) * (-7326.658) (-7321.592) [-7325.063] (-7322.781) -- 0:08:07
      673000 -- (-7325.846) [-7331.232] (-7331.232) (-7324.452) * (-7322.683) (-7318.793) (-7318.188) [-7326.009] -- 0:08:06
      673500 -- (-7336.180) (-7328.809) (-7332.770) [-7324.834] * (-7327.797) (-7329.159) (-7320.616) [-7322.590] -- 0:08:05
      674000 -- (-7330.229) (-7327.143) [-7331.535] (-7325.948) * (-7323.274) [-7321.238] (-7323.172) (-7329.509) -- 0:08:05
      674500 -- [-7330.633] (-7331.931) (-7325.639) (-7327.370) * [-7321.955] (-7335.410) (-7318.729) (-7323.757) -- 0:08:04
      675000 -- (-7332.440) (-7322.630) [-7332.966] (-7333.679) * [-7320.906] (-7324.707) (-7334.134) (-7325.742) -- 0:08:03

      Average standard deviation of split frequencies: 0.007261

      675500 -- (-7342.516) (-7321.475) [-7321.672] (-7320.322) * (-7322.867) [-7323.573] (-7322.829) (-7324.222) -- 0:08:02
      676000 -- (-7334.972) (-7321.457) (-7340.134) [-7321.189] * [-7318.723] (-7334.909) (-7325.947) (-7334.193) -- 0:08:02
      676500 -- [-7332.772] (-7328.584) (-7330.918) (-7329.109) * (-7335.318) [-7334.073] (-7330.758) (-7324.848) -- 0:08:01
      677000 -- (-7319.566) [-7324.592] (-7329.659) (-7329.834) * (-7330.904) (-7317.531) (-7337.294) [-7316.822] -- 0:08:00
      677500 -- (-7327.085) (-7327.165) [-7319.118] (-7326.962) * (-7328.063) [-7324.073] (-7334.577) (-7314.949) -- 0:07:59
      678000 -- (-7329.265) (-7325.621) [-7324.908] (-7318.330) * [-7319.031] (-7323.778) (-7329.064) (-7318.216) -- 0:07:59
      678500 -- (-7329.050) [-7319.163] (-7327.084) (-7323.374) * (-7324.641) (-7325.251) [-7319.852] (-7324.233) -- 0:07:58
      679000 -- (-7330.676) [-7325.663] (-7317.561) (-7323.080) * (-7328.905) [-7317.671] (-7333.907) (-7322.275) -- 0:07:57
      679500 -- (-7332.513) [-7315.157] (-7321.723) (-7322.331) * [-7321.064] (-7320.849) (-7324.177) (-7331.735) -- 0:07:56
      680000 -- (-7333.266) (-7331.388) [-7318.596] (-7330.514) * [-7321.565] (-7322.815) (-7321.851) (-7322.939) -- 0:07:56

      Average standard deviation of split frequencies: 0.007496

      680500 -- [-7326.880] (-7342.628) (-7327.984) (-7324.693) * [-7324.694] (-7334.277) (-7322.599) (-7328.277) -- 0:07:55
      681000 -- (-7316.637) (-7318.104) [-7319.643] (-7339.373) * (-7325.153) (-7329.522) (-7333.971) [-7322.932] -- 0:07:54
      681500 -- (-7333.749) (-7324.378) (-7326.910) [-7328.626] * (-7327.837) (-7328.159) (-7330.842) [-7312.770] -- 0:07:53
      682000 -- (-7336.339) (-7325.749) [-7323.865] (-7328.321) * (-7329.895) (-7327.965) [-7321.177] (-7328.440) -- 0:07:53
      682500 -- [-7333.061] (-7330.896) (-7316.294) (-7325.105) * (-7323.747) [-7324.475] (-7335.051) (-7325.606) -- 0:07:52
      683000 -- [-7323.086] (-7330.367) (-7325.537) (-7331.273) * [-7317.660] (-7337.459) (-7318.297) (-7329.609) -- 0:07:52
      683500 -- (-7321.052) [-7330.584] (-7325.418) (-7339.443) * [-7319.255] (-7321.376) (-7320.186) (-7334.359) -- 0:07:50
      684000 -- (-7323.857) [-7328.290] (-7331.991) (-7321.102) * [-7321.430] (-7330.199) (-7326.519) (-7333.373) -- 0:07:50
      684500 -- (-7318.470) (-7326.521) [-7319.112] (-7322.882) * (-7330.541) (-7326.854) (-7330.957) [-7320.806] -- 0:07:49
      685000 -- [-7318.166] (-7323.544) (-7323.052) (-7333.655) * (-7326.503) (-7332.343) [-7329.580] (-7326.061) -- 0:07:49

      Average standard deviation of split frequencies: 0.007195

      685500 -- (-7328.526) [-7323.329] (-7325.862) (-7330.074) * (-7328.749) (-7330.009) (-7338.727) [-7328.436] -- 0:07:47
      686000 -- (-7329.621) [-7323.837] (-7329.955) (-7330.353) * (-7327.622) [-7330.124] (-7337.056) (-7319.110) -- 0:07:47
      686500 -- (-7322.076) [-7328.203] (-7327.768) (-7327.270) * [-7334.484] (-7330.816) (-7342.558) (-7323.023) -- 0:07:46
      687000 -- [-7326.742] (-7327.890) (-7326.028) (-7332.176) * (-7333.739) [-7324.623] (-7342.800) (-7322.952) -- 0:07:46
      687500 -- [-7320.652] (-7322.403) (-7329.139) (-7325.176) * [-7328.690] (-7337.226) (-7333.806) (-7334.004) -- 0:07:45
      688000 -- (-7332.612) [-7328.066] (-7327.176) (-7334.536) * [-7328.057] (-7346.026) (-7332.990) (-7329.809) -- 0:07:44
      688500 -- (-7327.524) [-7324.692] (-7327.981) (-7333.391) * (-7339.960) (-7339.616) (-7331.313) [-7323.392] -- 0:07:43
      689000 -- (-7316.881) (-7324.801) (-7330.398) [-7326.201] * (-7329.501) [-7336.007] (-7326.743) (-7329.910) -- 0:07:43
      689500 -- (-7321.857) (-7326.347) (-7324.301) [-7329.134] * (-7331.966) (-7344.564) (-7326.236) [-7329.971] -- 0:07:42
      690000 -- (-7321.487) (-7324.348) (-7321.977) [-7323.905] * [-7334.109] (-7337.886) (-7339.600) (-7323.273) -- 0:07:41

      Average standard deviation of split frequencies: 0.007147

      690500 -- [-7320.709] (-7344.230) (-7324.149) (-7327.667) * (-7322.105) (-7330.009) (-7336.392) [-7327.509] -- 0:07:40
      691000 -- (-7323.955) (-7337.610) [-7323.391] (-7333.725) * (-7328.053) [-7329.197] (-7336.460) (-7329.257) -- 0:07:40
      691500 -- (-7354.743) (-7332.062) [-7319.731] (-7326.712) * (-7334.039) (-7323.609) (-7328.383) [-7321.723] -- 0:07:39
      692000 -- (-7324.315) [-7326.908] (-7331.484) (-7327.803) * (-7328.089) [-7331.850] (-7324.469) (-7333.139) -- 0:07:38
      692500 -- [-7323.051] (-7331.731) (-7331.308) (-7327.853) * [-7324.684] (-7332.001) (-7320.349) (-7331.854) -- 0:07:37
      693000 -- (-7336.768) (-7324.240) [-7319.775] (-7328.188) * [-7332.992] (-7333.547) (-7327.861) (-7323.103) -- 0:07:37
      693500 -- (-7324.447) [-7334.398] (-7323.926) (-7333.416) * (-7318.927) (-7334.131) [-7328.834] (-7320.448) -- 0:07:36
      694000 -- (-7326.451) [-7322.299] (-7321.383) (-7333.624) * (-7325.017) (-7322.977) (-7337.980) [-7326.484] -- 0:07:35
      694500 -- (-7336.142) (-7341.223) (-7329.113) [-7325.902] * (-7334.334) [-7322.112] (-7330.150) (-7319.461) -- 0:07:34
      695000 -- [-7327.499] (-7331.943) (-7329.764) (-7328.161) * (-7332.697) (-7341.509) (-7330.935) [-7325.009] -- 0:07:34

      Average standard deviation of split frequencies: 0.007012

      695500 -- [-7323.317] (-7333.569) (-7330.390) (-7324.042) * [-7325.023] (-7321.864) (-7326.866) (-7333.792) -- 0:07:33
      696000 -- [-7320.553] (-7324.746) (-7333.012) (-7324.688) * (-7331.538) [-7321.298] (-7326.452) (-7340.053) -- 0:07:32
      696500 -- (-7332.330) [-7322.615] (-7331.998) (-7320.087) * [-7319.350] (-7330.698) (-7327.522) (-7324.193) -- 0:07:31
      697000 -- (-7335.787) [-7319.395] (-7326.406) (-7320.972) * (-7332.790) (-7332.538) [-7322.226] (-7329.988) -- 0:07:31
      697500 -- (-7330.464) (-7320.105) (-7331.196) [-7323.854] * (-7327.620) (-7328.308) [-7319.090] (-7321.205) -- 0:07:30
      698000 -- (-7326.837) (-7318.693) [-7327.737] (-7324.186) * (-7333.703) (-7336.689) (-7321.270) [-7323.769] -- 0:07:29
      698500 -- (-7340.363) (-7322.216) [-7328.393] (-7320.547) * (-7331.863) [-7321.081] (-7328.776) (-7323.094) -- 0:07:28
      699000 -- (-7318.916) (-7321.386) [-7324.495] (-7324.171) * (-7327.762) [-7325.801] (-7332.932) (-7321.839) -- 0:07:28
      699500 -- (-7327.513) (-7331.040) (-7321.399) [-7324.632] * (-7328.540) (-7326.914) (-7336.783) [-7319.458] -- 0:07:27
      700000 -- (-7322.048) (-7325.141) (-7315.698) [-7322.604] * (-7327.493) (-7329.921) (-7337.226) [-7319.697] -- 0:07:26

      Average standard deviation of split frequencies: 0.006649

      700500 -- (-7324.482) (-7326.023) [-7321.026] (-7327.703) * (-7326.285) (-7325.737) (-7332.580) [-7325.242] -- 0:07:25
      701000 -- [-7330.213] (-7332.603) (-7326.353) (-7327.007) * (-7335.966) (-7321.838) [-7323.753] (-7325.857) -- 0:07:25
      701500 -- [-7325.540] (-7322.996) (-7323.679) (-7319.812) * (-7341.211) (-7328.252) (-7331.792) [-7327.980] -- 0:07:24
      702000 -- (-7323.374) (-7327.708) (-7325.319) [-7321.599] * (-7337.766) (-7332.256) (-7326.652) [-7318.919] -- 0:07:23
      702500 -- (-7332.049) (-7317.300) [-7319.203] (-7323.815) * (-7337.704) [-7321.731] (-7336.584) (-7320.225) -- 0:07:22
      703000 -- (-7334.948) (-7326.438) [-7319.609] (-7327.431) * (-7327.480) (-7317.388) [-7323.217] (-7322.159) -- 0:07:22
      703500 -- [-7323.703] (-7321.483) (-7330.180) (-7325.046) * [-7324.923] (-7325.762) (-7335.040) (-7334.223) -- 0:07:21
      704000 -- (-7330.891) [-7322.758] (-7325.253) (-7318.944) * (-7331.845) [-7314.594] (-7326.155) (-7333.571) -- 0:07:20
      704500 -- (-7325.985) (-7327.680) [-7328.373] (-7320.279) * (-7326.621) [-7322.826] (-7324.982) (-7326.466) -- 0:07:19
      705000 -- (-7318.037) (-7331.483) [-7328.824] (-7330.360) * (-7330.211) [-7318.776] (-7320.989) (-7333.384) -- 0:07:19

      Average standard deviation of split frequencies: 0.005460

      705500 -- [-7319.585] (-7329.542) (-7329.218) (-7329.097) * (-7326.466) (-7324.994) (-7337.363) [-7321.031] -- 0:07:18
      706000 -- (-7330.604) [-7328.846] (-7324.283) (-7323.503) * [-7321.513] (-7319.795) (-7325.812) (-7335.022) -- 0:07:17
      706500 -- (-7333.563) [-7325.506] (-7327.501) (-7324.681) * (-7320.850) (-7327.213) (-7329.691) [-7321.035] -- 0:07:17
      707000 -- (-7325.239) [-7322.313] (-7315.797) (-7330.814) * (-7320.090) [-7328.417] (-7338.962) (-7330.305) -- 0:07:16
      707500 -- (-7329.925) (-7333.062) (-7330.774) [-7331.876] * [-7317.128] (-7331.835) (-7319.657) (-7327.341) -- 0:07:15
      708000 -- [-7321.964] (-7338.183) (-7335.351) (-7328.639) * (-7331.063) (-7333.876) (-7330.760) [-7322.789] -- 0:07:14
      708500 -- [-7319.285] (-7336.832) (-7332.573) (-7331.693) * (-7338.386) (-7326.175) (-7332.461) [-7324.893] -- 0:07:14
      709000 -- (-7321.477) (-7336.357) (-7328.734) [-7316.676] * (-7320.862) [-7322.059] (-7325.284) (-7323.567) -- 0:07:13
      709500 -- (-7320.157) (-7343.578) [-7324.006] (-7332.488) * (-7329.881) (-7335.193) (-7334.083) [-7325.029] -- 0:07:12
      710000 -- (-7325.883) (-7334.012) (-7325.584) [-7324.986] * (-7327.468) (-7326.939) [-7321.511] (-7321.863) -- 0:07:11

      Average standard deviation of split frequencies: 0.005931

      710500 -- (-7327.010) (-7321.106) (-7317.485) [-7327.170] * (-7328.318) [-7327.523] (-7336.095) (-7321.624) -- 0:07:11
      711000 -- (-7334.639) [-7318.458] (-7320.137) (-7327.926) * [-7335.852] (-7333.955) (-7328.216) (-7330.871) -- 0:07:10
      711500 -- (-7329.560) (-7325.949) (-7339.203) [-7329.320] * (-7336.798) [-7317.588] (-7323.779) (-7333.533) -- 0:07:09
      712000 -- [-7326.139] (-7332.236) (-7330.938) (-7336.612) * (-7326.239) (-7329.566) (-7322.024) [-7326.013] -- 0:07:08
      712500 -- (-7326.493) [-7323.323] (-7331.653) (-7333.068) * [-7321.862] (-7326.296) (-7329.911) (-7336.385) -- 0:07:08
      713000 -- [-7322.952] (-7331.497) (-7330.056) (-7332.328) * [-7324.217] (-7322.508) (-7326.304) (-7320.170) -- 0:07:07
      713500 -- (-7327.584) [-7332.661] (-7327.537) (-7325.088) * [-7323.478] (-7336.601) (-7329.528) (-7327.135) -- 0:07:06
      714000 -- (-7324.247) (-7327.464) [-7319.885] (-7327.660) * (-7327.227) (-7318.703) [-7323.205] (-7328.157) -- 0:07:05
      714500 -- (-7339.582) (-7329.154) [-7322.629] (-7330.979) * [-7329.074] (-7328.821) (-7326.310) (-7315.534) -- 0:07:05
      715000 -- [-7328.635] (-7329.291) (-7327.239) (-7336.570) * (-7336.080) (-7335.583) (-7328.349) [-7319.540] -- 0:07:04

      Average standard deviation of split frequencies: 0.005964

      715500 -- (-7333.616) (-7322.851) [-7325.362] (-7343.424) * [-7320.339] (-7334.064) (-7330.317) (-7315.220) -- 0:07:03
      716000 -- (-7321.188) [-7321.432] (-7340.378) (-7320.859) * (-7326.779) (-7334.830) [-7320.843] (-7318.676) -- 0:07:02
      716500 -- (-7314.464) [-7319.885] (-7340.420) (-7329.011) * (-7325.369) (-7326.455) (-7334.356) [-7328.978] -- 0:07:02
      717000 -- (-7325.690) [-7320.744] (-7329.525) (-7326.021) * (-7321.356) (-7331.994) (-7330.342) [-7323.076] -- 0:07:01
      717500 -- (-7323.470) [-7321.314] (-7329.774) (-7321.663) * (-7328.963) (-7328.109) (-7325.307) [-7327.107] -- 0:07:00
      718000 -- (-7318.515) (-7327.115) (-7334.735) [-7327.118] * (-7328.369) (-7328.763) [-7329.960] (-7326.326) -- 0:06:59
      718500 -- (-7323.271) [-7316.551] (-7334.137) (-7333.876) * (-7327.082) (-7330.869) [-7329.094] (-7323.947) -- 0:06:59
      719000 -- (-7337.141) [-7316.857] (-7333.895) (-7327.789) * (-7327.137) (-7322.349) (-7335.932) [-7316.624] -- 0:06:58
      719500 -- [-7323.656] (-7320.410) (-7337.696) (-7325.171) * (-7321.384) (-7343.535) (-7325.025) [-7325.566] -- 0:06:57
      720000 -- (-7329.012) (-7327.710) [-7318.832] (-7320.128) * [-7323.656] (-7328.397) (-7321.588) (-7320.308) -- 0:06:56

      Average standard deviation of split frequencies: 0.006003

      720500 -- (-7344.970) (-7321.220) (-7323.351) [-7319.654] * (-7322.220) (-7330.557) [-7313.894] (-7317.543) -- 0:06:56
      721000 -- (-7330.090) [-7317.970] (-7323.232) (-7326.669) * (-7318.798) (-7325.382) [-7322.526] (-7327.271) -- 0:06:55
      721500 -- (-7330.584) (-7320.384) (-7322.511) [-7322.988] * [-7319.994] (-7326.579) (-7340.895) (-7340.606) -- 0:06:54
      722000 -- (-7337.943) (-7324.665) [-7316.334] (-7324.707) * (-7331.248) (-7323.375) [-7318.363] (-7327.173) -- 0:06:53
      722500 -- (-7328.961) (-7332.610) [-7320.154] (-7324.935) * (-7329.623) [-7319.197] (-7315.094) (-7321.699) -- 0:06:53
      723000 -- [-7322.498] (-7315.765) (-7337.267) (-7325.016) * (-7334.381) (-7325.848) (-7322.174) [-7318.174] -- 0:06:52
      723500 -- (-7322.621) (-7332.117) [-7327.282] (-7327.702) * (-7322.424) (-7331.256) (-7327.752) [-7325.557] -- 0:06:51
      724000 -- (-7328.141) [-7320.059] (-7330.795) (-7322.999) * (-7324.268) (-7325.353) (-7332.362) [-7321.729] -- 0:06:50
      724500 -- [-7317.981] (-7340.250) (-7335.369) (-7331.302) * (-7329.862) [-7316.845] (-7328.866) (-7328.001) -- 0:06:50
      725000 -- (-7318.179) (-7334.024) [-7336.047] (-7328.156) * [-7316.897] (-7330.071) (-7327.687) (-7336.423) -- 0:06:49

      Average standard deviation of split frequencies: 0.006149

      725500 -- [-7318.041] (-7332.728) (-7342.476) (-7323.505) * (-7319.041) (-7333.557) (-7331.161) [-7319.603] -- 0:06:49
      726000 -- (-7329.843) (-7323.140) (-7324.594) [-7325.377] * [-7319.796] (-7331.752) (-7323.581) (-7327.630) -- 0:06:47
      726500 -- (-7326.531) [-7320.374] (-7336.235) (-7325.737) * [-7323.077] (-7336.220) (-7322.836) (-7332.994) -- 0:06:47
      727000 -- (-7331.709) (-7326.142) (-7327.833) [-7316.687] * (-7325.210) (-7328.986) (-7335.236) [-7318.053] -- 0:06:46
      727500 -- [-7319.112] (-7330.465) (-7325.270) (-7330.957) * (-7324.886) (-7323.932) (-7327.168) [-7329.655] -- 0:06:46
      728000 -- (-7326.237) (-7332.857) (-7320.059) [-7316.839] * (-7325.843) [-7326.732] (-7320.676) (-7329.915) -- 0:06:45
      728500 -- (-7324.021) [-7321.931] (-7334.494) (-7313.693) * [-7320.575] (-7328.332) (-7324.781) (-7326.149) -- 0:06:44
      729000 -- [-7328.691] (-7318.819) (-7326.007) (-7325.214) * (-7326.063) (-7336.161) (-7321.057) [-7319.380] -- 0:06:43
      729500 -- [-7318.024] (-7323.328) (-7332.222) (-7327.634) * (-7317.730) (-7329.231) (-7318.983) [-7322.304] -- 0:06:43
      730000 -- (-7333.488) (-7323.386) (-7328.916) [-7322.244] * (-7316.874) [-7319.497] (-7327.449) (-7325.603) -- 0:06:42

      Average standard deviation of split frequencies: 0.006566

      730500 -- (-7329.246) (-7324.247) [-7328.602] (-7319.240) * (-7318.923) [-7321.746] (-7324.874) (-7333.831) -- 0:06:41
      731000 -- (-7320.576) (-7329.511) (-7329.030) [-7316.620] * (-7322.297) [-7319.480] (-7325.260) (-7324.707) -- 0:06:40
      731500 -- (-7321.375) [-7312.004] (-7324.507) (-7330.187) * (-7332.780) (-7320.903) (-7331.443) [-7320.249] -- 0:06:40
      732000 -- [-7325.508] (-7322.081) (-7341.728) (-7330.865) * [-7329.050] (-7315.158) (-7324.531) (-7329.273) -- 0:06:39
      732500 -- [-7321.595] (-7328.164) (-7333.731) (-7328.535) * (-7330.425) [-7323.073] (-7323.001) (-7326.925) -- 0:06:38
      733000 -- (-7335.259) [-7319.738] (-7347.567) (-7329.474) * (-7327.700) (-7326.942) [-7334.388] (-7325.781) -- 0:06:37
      733500 -- (-7328.906) (-7323.200) [-7326.117] (-7335.123) * (-7329.208) (-7338.782) [-7324.437] (-7321.720) -- 0:06:37
      734000 -- (-7329.361) (-7325.284) [-7325.201] (-7331.164) * (-7326.449) (-7331.442) [-7320.493] (-7322.098) -- 0:06:36
      734500 -- [-7322.613] (-7336.649) (-7328.971) (-7327.233) * (-7322.557) (-7329.900) [-7316.894] (-7319.794) -- 0:06:35
      735000 -- [-7318.409] (-7322.679) (-7314.042) (-7338.345) * (-7323.261) (-7323.204) [-7317.139] (-7331.613) -- 0:06:34

      Average standard deviation of split frequencies: 0.005915

      735500 -- (-7326.443) (-7320.495) [-7320.457] (-7322.949) * (-7321.171) [-7320.182] (-7326.140) (-7332.827) -- 0:06:34
      736000 -- (-7335.610) (-7327.664) [-7335.730] (-7320.640) * [-7334.066] (-7321.971) (-7325.003) (-7338.437) -- 0:06:33
      736500 -- [-7321.927] (-7322.554) (-7330.910) (-7324.051) * (-7330.043) (-7317.543) [-7335.975] (-7338.372) -- 0:06:32
      737000 -- (-7329.530) (-7321.306) (-7326.071) [-7323.303] * (-7332.491) (-7321.165) [-7323.551] (-7331.154) -- 0:06:31
      737500 -- (-7331.360) (-7321.628) (-7326.650) [-7316.496] * (-7339.116) (-7328.104) (-7319.679) [-7327.990] -- 0:06:31
      738000 -- (-7341.653) (-7321.857) [-7323.236] (-7318.539) * (-7329.105) [-7320.110] (-7326.716) (-7329.350) -- 0:06:30
      738500 -- (-7325.406) [-7326.158] (-7325.538) (-7323.790) * [-7324.852] (-7324.784) (-7335.422) (-7331.133) -- 0:06:29
      739000 -- (-7319.766) (-7321.520) (-7313.914) [-7321.657] * [-7321.658] (-7330.787) (-7343.533) (-7327.987) -- 0:06:28
      739500 -- (-7338.980) (-7320.466) [-7318.888] (-7332.323) * [-7320.099] (-7330.172) (-7327.601) (-7328.798) -- 0:06:28
      740000 -- (-7331.698) (-7324.403) [-7317.326] (-7337.606) * (-7317.727) (-7329.433) [-7327.591] (-7325.013) -- 0:06:27

      Average standard deviation of split frequencies: 0.005766

      740500 -- (-7337.386) (-7324.710) [-7318.293] (-7333.996) * [-7324.164] (-7333.337) (-7322.920) (-7338.951) -- 0:06:26
      741000 -- (-7327.684) (-7328.980) [-7319.731] (-7324.018) * (-7331.436) (-7321.355) (-7320.067) [-7322.689] -- 0:06:25
      741500 -- (-7326.961) (-7333.568) [-7326.597] (-7330.932) * (-7328.959) [-7320.932] (-7318.513) (-7321.507) -- 0:06:25
      742000 -- [-7326.460] (-7336.413) (-7330.818) (-7328.632) * [-7316.672] (-7321.485) (-7319.097) (-7333.632) -- 0:06:24
      742500 -- (-7323.994) (-7324.446) (-7329.636) [-7327.286] * [-7315.995] (-7330.137) (-7320.972) (-7331.110) -- 0:06:23
      743000 -- (-7332.225) (-7334.243) [-7320.091] (-7323.323) * [-7324.953] (-7320.961) (-7324.832) (-7329.466) -- 0:06:22
      743500 -- (-7332.786) (-7332.507) [-7320.366] (-7325.763) * (-7328.754) [-7313.901] (-7323.543) (-7324.431) -- 0:06:22
      744000 -- (-7331.154) (-7333.410) [-7326.884] (-7322.174) * (-7340.743) (-7327.291) (-7316.605) [-7324.452] -- 0:06:21
      744500 -- (-7328.823) (-7331.495) (-7327.543) [-7324.090] * [-7327.059] (-7323.022) (-7322.799) (-7324.818) -- 0:06:20
      745000 -- (-7326.339) (-7327.487) [-7316.674] (-7321.318) * (-7332.978) [-7326.503] (-7320.119) (-7318.778) -- 0:06:19

      Average standard deviation of split frequencies: 0.006245

      745500 -- (-7327.410) [-7327.392] (-7328.737) (-7320.269) * (-7327.557) [-7321.465] (-7322.849) (-7325.345) -- 0:06:19
      746000 -- (-7320.111) [-7326.267] (-7315.129) (-7327.160) * (-7341.894) [-7323.033] (-7316.039) (-7327.942) -- 0:06:18
      746500 -- (-7333.185) [-7326.251] (-7336.201) (-7322.326) * (-7325.309) (-7336.502) [-7319.814] (-7329.386) -- 0:06:17
      747000 -- [-7328.451] (-7337.651) (-7324.780) (-7321.353) * [-7321.712] (-7326.127) (-7322.644) (-7332.241) -- 0:06:16
      747500 -- (-7326.460) [-7332.038] (-7328.220) (-7322.345) * [-7321.424] (-7326.013) (-7342.073) (-7327.499) -- 0:06:16
      748000 -- (-7331.674) (-7332.263) [-7328.214] (-7335.357) * (-7321.833) [-7333.006] (-7341.937) (-7326.918) -- 0:06:15
      748500 -- (-7324.118) (-7321.260) (-7322.132) [-7317.939] * (-7332.455) [-7322.160] (-7335.540) (-7329.719) -- 0:06:14
      749000 -- (-7330.025) (-7321.619) [-7315.663] (-7330.949) * (-7343.064) [-7324.581] (-7337.044) (-7326.791) -- 0:06:13
      749500 -- (-7324.025) (-7318.131) [-7324.722] (-7333.356) * (-7329.606) (-7329.922) (-7322.427) [-7324.240] -- 0:06:13
      750000 -- (-7331.834) (-7324.343) [-7318.424] (-7319.710) * (-7320.486) [-7316.702] (-7326.938) (-7320.247) -- 0:06:12

      Average standard deviation of split frequencies: 0.005984

      750500 -- (-7321.049) (-7337.040) (-7316.939) [-7323.374] * (-7334.011) (-7328.519) [-7324.045] (-7318.541) -- 0:06:11
      751000 -- (-7326.213) (-7324.565) [-7328.414] (-7327.285) * [-7323.563] (-7338.070) (-7319.133) (-7327.223) -- 0:06:11
      751500 -- (-7327.135) [-7327.310] (-7320.217) (-7328.150) * [-7318.236] (-7334.529) (-7324.674) (-7333.483) -- 0:06:10
      752000 -- (-7318.446) (-7329.649) [-7330.776] (-7330.904) * [-7332.680] (-7343.286) (-7328.051) (-7321.225) -- 0:06:09
      752500 -- [-7325.615] (-7328.046) (-7325.237) (-7329.438) * [-7334.358] (-7339.059) (-7321.009) (-7323.002) -- 0:06:08
      753000 -- (-7324.404) (-7324.091) (-7331.579) [-7319.934] * (-7321.358) (-7336.979) (-7324.313) [-7328.963] -- 0:06:08
      753500 -- (-7331.024) (-7319.782) [-7318.104] (-7335.602) * [-7317.113] (-7330.813) (-7317.031) (-7337.990) -- 0:06:07
      754000 -- (-7320.175) (-7323.282) [-7321.667] (-7337.139) * (-7326.493) [-7324.975] (-7327.689) (-7325.114) -- 0:06:06
      754500 -- (-7330.626) (-7325.547) [-7328.771] (-7339.702) * (-7324.918) (-7327.994) [-7324.647] (-7329.594) -- 0:06:05
      755000 -- (-7323.053) (-7330.541) [-7329.010] (-7337.554) * (-7327.085) (-7320.820) (-7330.461) [-7318.646] -- 0:06:05

      Average standard deviation of split frequencies: 0.006125

      755500 -- (-7326.436) [-7327.687] (-7321.323) (-7327.899) * [-7321.933] (-7327.886) (-7334.408) (-7328.860) -- 0:06:04
      756000 -- [-7331.758] (-7322.560) (-7333.312) (-7334.465) * (-7323.166) [-7320.196] (-7331.413) (-7325.152) -- 0:06:03
      756500 -- [-7327.293] (-7331.943) (-7337.559) (-7331.872) * (-7340.034) [-7325.568] (-7326.477) (-7326.594) -- 0:06:02
      757000 -- (-7319.406) (-7319.775) [-7328.070] (-7334.593) * [-7328.509] (-7330.893) (-7329.553) (-7322.910) -- 0:06:02
      757500 -- [-7317.533] (-7326.662) (-7330.740) (-7332.995) * (-7335.834) (-7323.939) [-7332.270] (-7314.538) -- 0:06:01
      758000 -- (-7337.419) (-7329.646) (-7328.314) [-7328.629] * (-7328.767) [-7323.118] (-7326.893) (-7316.347) -- 0:06:00
      758500 -- (-7323.177) (-7329.260) [-7334.213] (-7328.304) * (-7327.453) (-7315.844) (-7326.127) [-7326.642] -- 0:06:00
      759000 -- [-7325.033] (-7323.463) (-7322.328) (-7342.474) * [-7322.660] (-7340.363) (-7321.190) (-7320.985) -- 0:05:59
      759500 -- (-7322.371) [-7325.060] (-7335.894) (-7333.995) * (-7315.585) (-7326.677) (-7328.474) [-7321.849] -- 0:05:58
      760000 -- [-7319.168] (-7322.148) (-7325.770) (-7330.736) * (-7317.819) (-7323.977) (-7328.282) [-7326.656] -- 0:05:57

      Average standard deviation of split frequencies: 0.006343

      760500 -- [-7316.010] (-7328.803) (-7328.800) (-7331.288) * (-7332.108) [-7325.614] (-7334.438) (-7334.809) -- 0:05:57
      761000 -- [-7324.658] (-7331.918) (-7336.274) (-7336.264) * (-7322.578) (-7321.100) (-7329.041) [-7318.755] -- 0:05:56
      761500 -- (-7330.490) [-7324.523] (-7323.002) (-7328.996) * (-7335.086) (-7326.666) [-7319.600] (-7331.382) -- 0:05:55
      762000 -- (-7326.039) (-7323.500) [-7330.868] (-7329.594) * (-7339.081) (-7326.715) [-7321.412] (-7335.403) -- 0:05:54
      762500 -- (-7333.063) (-7319.067) [-7321.412] (-7325.059) * (-7325.448) [-7327.702] (-7321.520) (-7321.383) -- 0:05:54
      763000 -- (-7336.826) (-7327.103) (-7323.338) [-7333.450] * (-7320.503) (-7328.351) [-7325.611] (-7319.203) -- 0:05:53
      763500 -- (-7339.741) (-7331.039) (-7324.381) [-7324.541] * (-7336.352) [-7332.621] (-7323.473) (-7335.749) -- 0:05:52
      764000 -- (-7330.126) [-7327.577] (-7326.774) (-7336.832) * (-7320.998) [-7322.603] (-7325.761) (-7326.213) -- 0:05:51
      764500 -- (-7323.422) [-7326.233] (-7327.926) (-7324.800) * (-7337.156) (-7326.400) [-7321.287] (-7323.054) -- 0:05:51
      765000 -- (-7331.333) (-7322.195) [-7323.399] (-7325.463) * (-7337.507) (-7321.428) [-7320.230] (-7324.445) -- 0:05:50

      Average standard deviation of split frequencies: 0.005973

      765500 -- (-7322.939) (-7330.122) [-7325.892] (-7327.677) * (-7318.773) (-7323.379) [-7328.511] (-7329.248) -- 0:05:49
      766000 -- (-7330.083) (-7322.422) (-7331.270) [-7323.517] * [-7317.247] (-7323.910) (-7333.578) (-7322.094) -- 0:05:48
      766500 -- (-7329.324) (-7328.069) (-7326.052) [-7319.964] * (-7334.554) [-7317.969] (-7318.950) (-7319.813) -- 0:05:48
      767000 -- (-7333.518) [-7323.913] (-7323.377) (-7326.740) * (-7324.364) [-7326.817] (-7332.827) (-7320.268) -- 0:05:47
      767500 -- (-7337.302) [-7318.915] (-7322.947) (-7325.730) * (-7324.435) (-7321.148) (-7332.387) [-7313.964] -- 0:05:46
      768000 -- (-7330.081) (-7319.982) (-7321.022) [-7321.791] * (-7326.498) (-7332.740) [-7323.006] (-7329.274) -- 0:05:45
      768500 -- [-7318.494] (-7324.873) (-7325.104) (-7324.084) * (-7317.955) [-7326.999] (-7317.788) (-7319.122) -- 0:05:45
      769000 -- (-7325.899) [-7323.292] (-7329.544) (-7322.021) * (-7332.351) (-7324.917) (-7336.819) [-7326.886] -- 0:05:44
      769500 -- (-7329.155) [-7322.524] (-7339.719) (-7325.297) * (-7342.992) [-7319.139] (-7330.203) (-7331.239) -- 0:05:43
      770000 -- (-7332.138) (-7328.687) (-7323.310) [-7316.379] * (-7334.173) [-7325.862] (-7325.214) (-7320.559) -- 0:05:42

      Average standard deviation of split frequencies: 0.006009

      770500 -- (-7328.289) (-7325.743) (-7334.425) [-7325.220] * (-7322.833) (-7326.161) (-7327.824) [-7324.619] -- 0:05:42
      771000 -- (-7333.153) (-7335.588) (-7330.345) [-7319.454] * (-7324.458) (-7333.820) (-7330.550) [-7326.860] -- 0:05:41
      771500 -- [-7335.612] (-7329.708) (-7333.444) (-7326.944) * (-7324.421) (-7321.027) [-7324.321] (-7321.895) -- 0:05:40
      772000 -- (-7325.652) [-7329.464] (-7329.569) (-7331.812) * (-7324.745) (-7326.011) (-7324.300) [-7331.007] -- 0:05:39
      772500 -- [-7323.785] (-7326.229) (-7326.672) (-7333.988) * (-7322.170) [-7322.473] (-7323.991) (-7339.834) -- 0:05:39
      773000 -- [-7318.797] (-7322.362) (-7321.234) (-7320.966) * (-7324.578) (-7319.273) [-7329.145] (-7327.807) -- 0:05:38
      773500 -- [-7327.677] (-7337.338) (-7318.182) (-7322.468) * (-7332.343) [-7329.873] (-7337.584) (-7332.071) -- 0:05:37
      774000 -- [-7322.480] (-7327.791) (-7323.450) (-7330.986) * (-7322.555) (-7322.491) (-7335.647) [-7329.102] -- 0:05:36
      774500 -- (-7324.141) [-7326.547] (-7318.643) (-7337.071) * (-7321.980) (-7316.537) [-7320.930] (-7329.922) -- 0:05:36
      775000 -- (-7333.715) (-7322.344) [-7326.097] (-7322.584) * (-7331.288) [-7324.858] (-7334.038) (-7325.674) -- 0:05:35

      Average standard deviation of split frequencies: 0.005896

      775500 -- (-7330.754) (-7332.161) [-7321.943] (-7325.268) * (-7332.305) [-7315.300] (-7324.599) (-7323.924) -- 0:05:34
      776000 -- (-7338.007) (-7325.530) [-7330.893] (-7328.298) * (-7325.506) [-7320.949] (-7327.325) (-7330.185) -- 0:05:33
      776500 -- (-7336.188) [-7327.855] (-7331.382) (-7335.345) * (-7326.937) (-7324.517) (-7329.055) [-7328.060] -- 0:05:33
      777000 -- (-7332.677) [-7329.457] (-7326.607) (-7340.283) * (-7329.199) [-7332.475] (-7330.119) (-7334.207) -- 0:05:32
      777500 -- (-7325.305) (-7331.318) [-7317.987] (-7318.746) * (-7327.678) [-7323.212] (-7332.951) (-7332.807) -- 0:05:31
      778000 -- (-7329.955) (-7328.988) [-7319.344] (-7327.263) * [-7322.057] (-7325.615) (-7332.648) (-7326.821) -- 0:05:31
      778500 -- (-7348.216) (-7319.917) [-7327.819] (-7331.597) * [-7323.215] (-7319.792) (-7328.575) (-7336.280) -- 0:05:30
      779000 -- (-7339.893) [-7319.677] (-7321.568) (-7330.122) * [-7322.968] (-7326.860) (-7329.947) (-7336.907) -- 0:05:29
      779500 -- (-7340.936) (-7324.065) [-7325.948] (-7325.475) * (-7321.401) (-7332.343) [-7323.739] (-7328.395) -- 0:05:28
      780000 -- (-7343.063) (-7322.938) (-7318.942) [-7326.268] * (-7323.348) (-7329.800) [-7323.131] (-7336.103) -- 0:05:28

      Average standard deviation of split frequencies: 0.005825

      780500 -- (-7325.040) (-7329.076) [-7319.855] (-7319.121) * (-7327.276) [-7328.596] (-7327.055) (-7320.609) -- 0:05:27
      781000 -- (-7329.599) (-7323.618) (-7326.527) [-7322.013] * (-7329.965) (-7326.453) (-7326.258) [-7320.699] -- 0:05:26
      781500 -- (-7331.879) [-7331.146] (-7332.714) (-7321.670) * (-7321.536) [-7335.345] (-7323.311) (-7331.148) -- 0:05:25
      782000 -- (-7322.403) (-7332.340) [-7323.275] (-7323.639) * (-7323.021) [-7339.351] (-7330.359) (-7328.783) -- 0:05:25
      782500 -- (-7330.350) (-7330.765) [-7318.582] (-7319.993) * [-7327.605] (-7326.486) (-7322.748) (-7325.912) -- 0:05:24
      783000 -- [-7327.219] (-7334.090) (-7323.769) (-7322.905) * [-7333.889] (-7330.940) (-7329.518) (-7326.103) -- 0:05:23
      783500 -- (-7337.522) [-7326.128] (-7321.149) (-7332.950) * (-7333.500) (-7325.673) [-7327.613] (-7324.087) -- 0:05:22
      784000 -- (-7334.262) (-7331.566) [-7321.111] (-7322.661) * (-7324.004) (-7329.594) (-7335.188) [-7321.719] -- 0:05:22
      784500 -- (-7335.196) (-7329.119) [-7319.215] (-7319.498) * (-7329.931) (-7333.038) [-7329.791] (-7324.041) -- 0:05:21
      785000 -- [-7323.149] (-7327.102) (-7320.578) (-7317.777) * (-7324.594) (-7322.286) (-7325.475) [-7318.253] -- 0:05:20

      Average standard deviation of split frequencies: 0.005504

      785500 -- (-7328.213) (-7324.223) [-7321.985] (-7330.648) * (-7339.334) (-7328.933) [-7327.051] (-7331.877) -- 0:05:19
      786000 -- (-7320.364) [-7328.692] (-7332.325) (-7322.501) * (-7333.136) (-7330.800) [-7332.084] (-7329.176) -- 0:05:19
      786500 -- (-7323.085) (-7319.774) (-7326.359) [-7330.211] * [-7323.545] (-7329.926) (-7327.602) (-7326.339) -- 0:05:18
      787000 -- (-7326.650) [-7319.052] (-7337.743) (-7329.223) * [-7318.233] (-7332.053) (-7323.314) (-7320.496) -- 0:05:17
      787500 -- [-7328.098] (-7322.624) (-7332.159) (-7326.758) * (-7321.988) (-7323.376) (-7321.934) [-7316.998] -- 0:05:16
      788000 -- (-7316.496) (-7322.002) (-7329.775) [-7320.281] * (-7321.436) [-7323.548] (-7328.544) (-7314.171) -- 0:05:16
      788500 -- (-7319.677) (-7324.584) (-7325.746) [-7322.655] * (-7328.239) (-7333.642) (-7330.107) [-7323.745] -- 0:05:15
      789000 -- [-7323.829] (-7330.654) (-7330.121) (-7327.258) * (-7328.108) (-7332.960) [-7319.832] (-7328.465) -- 0:05:14
      789500 -- (-7324.828) (-7327.692) [-7323.406] (-7339.754) * (-7332.403) [-7317.115] (-7328.074) (-7323.408) -- 0:05:13
      790000 -- (-7338.600) (-7324.007) (-7326.955) [-7329.778] * (-7332.456) (-7317.649) [-7322.239] (-7327.068) -- 0:05:13

      Average standard deviation of split frequencies: 0.005997

      790500 -- [-7312.545] (-7333.299) (-7332.672) (-7323.106) * (-7321.535) [-7317.503] (-7323.371) (-7326.675) -- 0:05:12
      791000 -- (-7325.995) [-7328.899] (-7334.652) (-7319.701) * (-7333.826) [-7326.365] (-7331.368) (-7335.319) -- 0:05:11
      791500 -- (-7327.261) (-7333.746) (-7331.193) [-7319.076] * (-7324.841) (-7317.761) (-7335.273) [-7341.247] -- 0:05:10
      792000 -- (-7335.848) (-7325.799) [-7323.133] (-7331.887) * (-7327.501) (-7326.189) [-7332.132] (-7330.172) -- 0:05:10
      792500 -- [-7326.134] (-7326.477) (-7327.772) (-7339.634) * [-7335.318] (-7332.029) (-7329.144) (-7322.017) -- 0:05:09
      793000 -- (-7324.196) (-7317.518) [-7313.519] (-7333.371) * [-7325.817] (-7322.219) (-7330.818) (-7342.387) -- 0:05:08
      793500 -- [-7322.449] (-7323.817) (-7330.695) (-7335.835) * [-7325.135] (-7325.136) (-7330.034) (-7329.244) -- 0:05:07
      794000 -- (-7328.574) (-7318.630) [-7320.611] (-7346.865) * (-7331.598) [-7319.050] (-7325.928) (-7329.913) -- 0:05:07
      794500 -- (-7334.474) [-7321.714] (-7324.115) (-7324.875) * (-7333.107) [-7324.161] (-7327.018) (-7325.560) -- 0:05:06
      795000 -- (-7324.533) [-7319.085] (-7332.370) (-7332.766) * [-7323.808] (-7319.427) (-7325.326) (-7330.866) -- 0:05:05

      Average standard deviation of split frequencies: 0.006201

      795500 -- [-7318.688] (-7326.741) (-7334.455) (-7319.976) * [-7324.978] (-7329.683) (-7324.754) (-7336.952) -- 0:05:04
      796000 -- (-7336.947) (-7319.815) [-7333.536] (-7329.105) * (-7323.136) (-7324.318) (-7329.837) [-7325.319] -- 0:05:04
      796500 -- (-7331.157) (-7326.950) (-7329.657) [-7335.564] * (-7326.677) (-7318.122) [-7320.849] (-7332.295) -- 0:05:03
      797000 -- (-7325.550) (-7323.816) (-7326.997) [-7328.291] * (-7334.090) (-7335.213) [-7318.569] (-7324.035) -- 0:05:02
      797500 -- [-7318.288] (-7320.399) (-7332.223) (-7336.490) * (-7332.441) (-7327.173) [-7321.190] (-7323.296) -- 0:05:01
      798000 -- (-7324.140) [-7328.609] (-7342.071) (-7328.189) * (-7322.603) (-7328.365) [-7318.258] (-7318.818) -- 0:05:01
      798500 -- [-7327.533] (-7319.042) (-7327.612) (-7329.536) * [-7326.268] (-7336.367) (-7319.959) (-7325.781) -- 0:05:00
      799000 -- (-7337.103) [-7321.083] (-7332.456) (-7323.688) * [-7315.518] (-7328.251) (-7316.876) (-7320.520) -- 0:04:59
      799500 -- (-7328.030) (-7322.111) (-7328.145) [-7334.743] * (-7319.328) (-7338.171) [-7318.690] (-7325.104) -- 0:04:58
      800000 -- (-7321.103) (-7328.670) (-7331.691) [-7329.582] * (-7329.713) (-7336.625) (-7323.303) [-7330.372] -- 0:04:58

      Average standard deviation of split frequencies: 0.005749

      800500 -- [-7325.619] (-7317.141) (-7330.618) (-7346.418) * (-7325.463) (-7340.434) [-7330.547] (-7323.061) -- 0:04:57
      801000 -- (-7323.562) (-7334.900) (-7327.325) [-7326.568] * (-7334.906) (-7326.078) [-7323.337] (-7326.652) -- 0:04:56
      801500 -- [-7324.034] (-7323.158) (-7321.865) (-7329.315) * (-7321.983) [-7321.448] (-7328.532) (-7324.476) -- 0:04:55
      802000 -- (-7323.462) [-7319.578] (-7326.020) (-7332.012) * (-7324.090) [-7326.664] (-7321.986) (-7318.061) -- 0:04:55
      802500 -- (-7322.732) (-7323.604) [-7323.808] (-7328.936) * (-7332.283) [-7328.537] (-7322.389) (-7319.934) -- 0:04:54
      803000 -- (-7325.906) (-7335.074) (-7344.083) [-7326.383] * (-7326.605) (-7329.973) (-7320.927) [-7325.210] -- 0:04:53
      803500 -- (-7317.409) (-7334.441) [-7342.552] (-7336.525) * (-7322.382) [-7324.843] (-7324.096) (-7326.742) -- 0:04:52
      804000 -- [-7326.319] (-7325.120) (-7327.120) (-7328.707) * [-7317.578] (-7328.261) (-7333.546) (-7327.057) -- 0:04:52
      804500 -- (-7324.338) (-7321.734) (-7347.056) [-7327.132] * (-7323.044) (-7332.015) [-7324.639] (-7331.343) -- 0:04:51
      805000 -- (-7333.485) [-7329.004] (-7338.159) (-7331.969) * [-7328.633] (-7322.385) (-7327.044) (-7324.517) -- 0:04:50

      Average standard deviation of split frequencies: 0.005573

      805500 -- (-7331.202) (-7324.877) (-7322.840) [-7324.219] * [-7324.446] (-7330.525) (-7323.618) (-7327.134) -- 0:04:49
      806000 -- (-7335.706) [-7327.494] (-7319.549) (-7331.714) * [-7317.560] (-7334.244) (-7325.176) (-7328.602) -- 0:04:49
      806500 -- (-7322.858) (-7325.589) [-7327.776] (-7325.515) * (-7325.193) [-7328.135] (-7324.320) (-7326.162) -- 0:04:48
      807000 -- (-7324.114) (-7328.273) (-7322.237) [-7321.871] * (-7327.692) (-7339.860) [-7312.711] (-7321.074) -- 0:04:47
      807500 -- [-7324.432] (-7321.003) (-7321.855) (-7330.187) * (-7323.397) (-7324.846) (-7323.063) [-7328.955] -- 0:04:47
      808000 -- (-7323.016) (-7317.716) [-7322.917] (-7327.219) * (-7332.418) (-7337.613) [-7322.454] (-7324.097) -- 0:04:46
      808500 -- [-7332.648] (-7326.247) (-7322.223) (-7327.798) * (-7323.099) (-7339.026) [-7320.780] (-7319.165) -- 0:04:45
      809000 -- (-7333.957) (-7327.865) (-7323.792) [-7326.289] * (-7333.303) (-7324.243) [-7325.103] (-7327.794) -- 0:04:44
      809500 -- (-7335.983) (-7326.651) (-7320.196) [-7320.494] * (-7331.310) (-7332.364) [-7324.205] (-7322.949) -- 0:04:44
      810000 -- (-7325.563) (-7319.924) [-7329.888] (-7325.076) * [-7326.605] (-7326.434) (-7330.601) (-7323.375) -- 0:04:43

      Average standard deviation of split frequencies: 0.005097

      810500 -- (-7332.507) (-7326.461) (-7321.528) [-7317.821] * [-7323.762] (-7334.547) (-7323.906) (-7318.389) -- 0:04:42
      811000 -- (-7328.822) [-7317.262] (-7333.156) (-7331.388) * (-7318.938) [-7328.902] (-7326.184) (-7331.108) -- 0:04:41
      811500 -- (-7328.322) (-7326.652) (-7328.870) [-7316.836] * (-7329.882) (-7326.630) [-7315.186] (-7327.784) -- 0:04:41
      812000 -- [-7315.859] (-7324.360) (-7321.895) (-7324.927) * [-7329.097] (-7333.944) (-7322.044) (-7329.699) -- 0:04:40
      812500 -- [-7322.664] (-7325.453) (-7328.259) (-7323.464) * (-7333.141) (-7331.203) (-7318.164) [-7329.482] -- 0:04:39
      813000 -- (-7318.146) (-7334.152) (-7324.761) [-7319.989] * [-7332.182] (-7328.949) (-7338.899) (-7328.236) -- 0:04:39
      813500 -- (-7324.382) [-7327.039] (-7330.606) (-7324.721) * (-7328.384) [-7318.791] (-7338.487) (-7327.564) -- 0:04:38
      814000 -- (-7336.889) [-7325.666] (-7341.640) (-7322.896) * (-7319.339) (-7325.253) (-7327.625) [-7322.354] -- 0:04:37
      814500 -- (-7335.369) [-7327.111] (-7324.714) (-7327.574) * [-7328.536] (-7324.693) (-7329.637) (-7325.346) -- 0:04:36
      815000 -- (-7341.461) (-7332.404) (-7317.026) [-7330.457] * [-7329.525] (-7320.986) (-7332.861) (-7337.195) -- 0:04:36

      Average standard deviation of split frequencies: 0.005641

      815500 -- (-7343.284) (-7319.858) [-7323.150] (-7332.839) * (-7334.138) [-7316.313] (-7323.986) (-7327.963) -- 0:04:35
      816000 -- (-7339.118) (-7326.010) [-7328.936] (-7337.600) * (-7338.910) (-7316.453) (-7332.415) [-7326.197] -- 0:04:34
      816500 -- (-7334.917) (-7331.798) [-7322.790] (-7325.579) * (-7331.092) [-7325.233] (-7334.248) (-7322.097) -- 0:04:33
      817000 -- [-7326.946] (-7322.117) (-7325.439) (-7323.483) * (-7322.982) (-7324.356) (-7332.959) [-7328.636] -- 0:04:33
      817500 -- (-7339.101) (-7327.190) [-7318.963] (-7332.026) * (-7327.150) (-7325.462) (-7328.156) [-7325.593] -- 0:04:32
      818000 -- (-7326.172) (-7335.065) (-7325.065) [-7329.641] * (-7315.755) (-7316.126) (-7332.783) [-7323.856] -- 0:04:31
      818500 -- [-7323.556] (-7323.292) (-7320.132) (-7318.746) * [-7324.729] (-7323.366) (-7326.804) (-7324.824) -- 0:04:30
      819000 -- (-7329.175) [-7317.419] (-7323.197) (-7331.904) * (-7331.063) (-7321.041) [-7323.512] (-7330.589) -- 0:04:30
      819500 -- (-7326.545) (-7323.570) (-7331.124) [-7319.867] * (-7330.377) [-7321.262] (-7325.510) (-7326.782) -- 0:04:29
      820000 -- (-7326.769) [-7321.874] (-7326.399) (-7323.954) * (-7323.512) (-7319.619) (-7328.753) [-7336.076] -- 0:04:28

      Average standard deviation of split frequencies: 0.005541

      820500 -- (-7326.543) (-7321.593) [-7321.966] (-7320.851) * (-7329.359) (-7331.172) (-7318.994) [-7334.265] -- 0:04:27
      821000 -- (-7322.835) (-7329.254) [-7317.552] (-7324.021) * [-7328.000] (-7320.665) (-7319.025) (-7321.924) -- 0:04:27
      821500 -- (-7323.994) (-7343.843) [-7317.417] (-7322.806) * (-7347.119) (-7318.666) [-7324.147] (-7338.269) -- 0:04:26
      822000 -- (-7322.435) (-7336.623) (-7320.066) [-7321.007] * (-7332.393) (-7324.721) [-7323.050] (-7321.979) -- 0:04:25
      822500 -- (-7322.916) (-7321.284) [-7323.022] (-7319.178) * (-7323.667) [-7328.279] (-7320.626) (-7322.395) -- 0:04:24
      823000 -- (-7323.136) [-7321.246] (-7327.150) (-7321.536) * (-7322.874) (-7333.980) (-7334.825) [-7326.870] -- 0:04:24
      823500 -- (-7322.565) [-7315.492] (-7324.857) (-7321.393) * (-7329.689) [-7318.364] (-7325.151) (-7320.631) -- 0:04:23
      824000 -- (-7320.971) (-7318.250) (-7323.278) [-7318.870] * (-7333.787) (-7319.774) (-7331.303) [-7316.699] -- 0:04:22
      824500 -- [-7318.118] (-7317.369) (-7320.077) (-7324.370) * (-7330.143) [-7318.178] (-7328.662) (-7329.120) -- 0:04:21
      825000 -- [-7313.388] (-7324.039) (-7324.208) (-7319.759) * (-7335.602) (-7327.632) [-7335.472] (-7329.288) -- 0:04:21

      Average standard deviation of split frequencies: 0.005808

      825500 -- (-7328.784) (-7322.990) (-7322.799) [-7325.645] * (-7335.609) (-7329.217) (-7321.003) [-7321.651] -- 0:04:20
      826000 -- (-7317.218) [-7332.345] (-7334.384) (-7329.629) * (-7332.279) (-7338.353) (-7320.619) [-7327.361] -- 0:04:19
      826500 -- (-7325.433) [-7322.148] (-7334.967) (-7326.957) * (-7328.895) [-7327.388] (-7327.691) (-7335.432) -- 0:04:18
      827000 -- (-7321.430) (-7337.322) [-7330.416] (-7333.223) * (-7330.432) (-7322.080) (-7327.391) [-7321.453] -- 0:04:18
      827500 -- (-7332.971) (-7328.041) [-7329.922] (-7320.147) * [-7319.647] (-7323.957) (-7319.618) (-7331.964) -- 0:04:17
      828000 -- (-7326.515) [-7318.776] (-7335.432) (-7326.097) * (-7323.639) (-7321.025) [-7325.455] (-7322.338) -- 0:04:16
      828500 -- (-7319.667) [-7324.955] (-7329.465) (-7337.400) * (-7319.379) [-7316.627] (-7327.004) (-7323.260) -- 0:04:15
      829000 -- (-7321.604) [-7326.710] (-7321.250) (-7332.759) * (-7319.896) [-7320.337] (-7326.056) (-7326.405) -- 0:04:15
      829500 -- (-7323.827) [-7325.197] (-7334.042) (-7333.469) * [-7316.890] (-7332.666) (-7326.263) (-7327.573) -- 0:04:14
      830000 -- [-7327.055] (-7322.558) (-7328.444) (-7331.507) * [-7324.637] (-7320.264) (-7323.907) (-7334.373) -- 0:04:13

      Average standard deviation of split frequencies: 0.005809

      830500 -- (-7324.437) [-7325.883] (-7336.806) (-7334.685) * (-7316.886) (-7328.058) (-7321.530) [-7328.272] -- 0:04:12
      831000 -- (-7325.743) (-7330.028) (-7328.227) [-7328.177] * (-7321.802) (-7322.660) [-7320.882] (-7321.454) -- 0:04:12
      831500 -- (-7328.899) (-7326.662) [-7324.149] (-7321.895) * [-7330.968] (-7330.905) (-7320.772) (-7328.798) -- 0:04:11
      832000 -- (-7328.136) (-7327.946) (-7323.946) [-7325.565] * (-7330.715) [-7331.222] (-7337.422) (-7332.374) -- 0:04:10
      832500 -- (-7331.136) (-7331.868) (-7322.751) [-7324.215] * (-7327.553) (-7331.481) (-7325.524) [-7325.246] -- 0:04:09
      833000 -- (-7316.435) (-7326.294) [-7325.580] (-7324.769) * (-7339.534) (-7330.489) [-7328.887] (-7323.930) -- 0:04:09
      833500 -- [-7318.902] (-7331.452) (-7329.841) (-7322.173) * (-7324.862) (-7332.294) [-7323.732] (-7315.615) -- 0:04:08
      834000 -- (-7319.340) (-7330.897) (-7330.968) [-7320.658] * [-7328.363] (-7338.011) (-7332.528) (-7321.339) -- 0:04:07
      834500 -- (-7328.202) (-7327.910) (-7324.860) [-7321.990] * (-7324.727) (-7335.671) [-7326.719] (-7327.059) -- 0:04:06
      835000 -- [-7324.952] (-7322.958) (-7331.873) (-7326.997) * [-7326.803] (-7333.902) (-7326.448) (-7323.224) -- 0:04:06

      Average standard deviation of split frequencies: 0.005871

      835500 -- (-7330.571) (-7321.200) (-7332.090) [-7318.232] * [-7322.682] (-7330.969) (-7324.792) (-7333.267) -- 0:04:05
      836000 -- (-7323.987) (-7320.779) (-7327.565) [-7324.191] * (-7320.689) [-7328.849] (-7328.118) (-7326.411) -- 0:04:04
      836500 -- [-7322.222] (-7328.673) (-7328.571) (-7329.516) * (-7322.293) (-7326.332) (-7337.648) [-7324.406] -- 0:04:03
      837000 -- (-7317.297) [-7327.662] (-7327.948) (-7339.621) * (-7326.120) (-7333.868) (-7334.757) [-7325.682] -- 0:04:03
      837500 -- [-7319.378] (-7331.515) (-7334.825) (-7324.428) * (-7322.929) (-7327.072) (-7328.883) [-7323.089] -- 0:04:02
      838000 -- [-7326.003] (-7321.597) (-7323.420) (-7330.883) * (-7331.515) (-7338.667) [-7325.565] (-7315.358) -- 0:04:01
      838500 -- (-7328.573) [-7320.424] (-7340.894) (-7329.499) * [-7326.690] (-7334.148) (-7336.341) (-7325.950) -- 0:04:00
      839000 -- (-7335.728) [-7324.973] (-7332.308) (-7327.957) * (-7335.249) [-7325.796] (-7331.735) (-7326.492) -- 0:04:00
      839500 -- (-7330.650) (-7327.018) (-7338.119) [-7320.080] * (-7326.057) [-7327.558] (-7331.219) (-7331.109) -- 0:03:59
      840000 -- (-7327.012) [-7325.149] (-7343.037) (-7323.228) * [-7322.343] (-7329.255) (-7329.659) (-7326.014) -- 0:03:58

      Average standard deviation of split frequencies: 0.005772

      840500 -- [-7324.793] (-7322.126) (-7330.865) (-7321.642) * (-7330.363) [-7323.162] (-7333.675) (-7330.367) -- 0:03:57
      841000 -- (-7327.033) (-7318.898) (-7331.275) [-7324.172] * (-7326.354) (-7331.928) (-7340.395) [-7317.415] -- 0:03:57
      841500 -- (-7324.143) (-7320.542) (-7330.754) [-7322.701] * (-7334.415) [-7320.654] (-7339.544) (-7317.276) -- 0:03:56
      842000 -- (-7333.352) (-7330.550) (-7326.018) [-7323.873] * (-7324.660) (-7329.815) (-7334.258) [-7323.402] -- 0:03:55
      842500 -- (-7329.203) (-7325.784) (-7324.542) [-7323.501] * (-7324.144) (-7333.299) [-7321.115] (-7320.497) -- 0:03:54
      843000 -- (-7330.884) [-7319.517] (-7325.221) (-7322.760) * (-7326.231) (-7333.069) (-7330.742) [-7319.933] -- 0:03:54
      843500 -- (-7329.302) (-7318.088) [-7320.331] (-7332.323) * (-7323.946) (-7338.662) (-7324.089) [-7326.314] -- 0:03:53
      844000 -- (-7324.466) (-7330.113) [-7319.037] (-7327.868) * (-7323.919) [-7330.734] (-7324.884) (-7332.179) -- 0:03:52
      844500 -- [-7319.769] (-7324.144) (-7325.590) (-7328.051) * (-7327.308) (-7340.550) (-7327.852) [-7322.804] -- 0:03:52
      845000 -- [-7314.778] (-7320.350) (-7324.143) (-7330.646) * (-7324.953) (-7337.024) (-7329.955) [-7322.579] -- 0:03:51

      Average standard deviation of split frequencies: 0.005310

      845500 -- (-7323.180) [-7320.042] (-7327.326) (-7335.951) * (-7330.449) (-7334.859) (-7331.117) [-7314.390] -- 0:03:50
      846000 -- (-7333.932) (-7322.306) [-7326.132] (-7326.129) * (-7323.910) (-7332.721) [-7325.289] (-7324.705) -- 0:03:49
      846500 -- (-7322.304) [-7318.387] (-7331.687) (-7333.699) * [-7329.044] (-7326.892) (-7330.298) (-7325.392) -- 0:03:49
      847000 -- (-7321.594) (-7328.543) [-7326.206] (-7343.132) * (-7322.573) (-7332.575) [-7317.218] (-7335.922) -- 0:03:48
      847500 -- [-7327.861] (-7336.336) (-7324.848) (-7329.986) * (-7335.352) (-7329.673) (-7322.174) [-7322.596] -- 0:03:47
      848000 -- [-7330.546] (-7335.798) (-7336.681) (-7332.189) * (-7332.034) (-7322.348) [-7316.566] (-7332.257) -- 0:03:46
      848500 -- [-7329.079] (-7345.700) (-7329.915) (-7333.722) * (-7335.829) [-7318.492] (-7319.645) (-7323.211) -- 0:03:46
      849000 -- (-7329.778) [-7328.648] (-7330.864) (-7332.789) * [-7318.255] (-7329.417) (-7325.667) (-7326.951) -- 0:03:45
      849500 -- (-7332.272) [-7321.072] (-7319.532) (-7323.464) * [-7318.892] (-7337.047) (-7323.226) (-7331.670) -- 0:03:44
      850000 -- (-7321.003) (-7317.044) [-7330.936] (-7335.444) * (-7320.729) (-7330.549) (-7328.854) [-7327.945] -- 0:03:43

      Average standard deviation of split frequencies: 0.005281

      850500 -- (-7328.835) [-7318.556] (-7328.113) (-7327.842) * [-7323.730] (-7325.663) (-7326.942) (-7324.898) -- 0:03:43
      851000 -- (-7329.610) (-7323.698) [-7326.774] (-7335.682) * [-7324.250] (-7331.058) (-7324.924) (-7322.066) -- 0:03:42
      851500 -- [-7322.124] (-7321.821) (-7321.634) (-7346.801) * (-7325.376) (-7330.190) [-7329.206] (-7324.219) -- 0:03:41
      852000 -- (-7329.221) (-7327.058) (-7327.471) [-7317.681] * (-7325.219) (-7327.882) [-7326.979] (-7320.457) -- 0:03:40
      852500 -- [-7321.934] (-7323.487) (-7328.200) (-7324.330) * (-7327.128) (-7330.588) [-7325.312] (-7328.126) -- 0:03:40
      853000 -- [-7322.624] (-7329.445) (-7324.658) (-7327.712) * (-7321.805) (-7335.767) (-7323.032) [-7319.680] -- 0:03:39
      853500 -- (-7325.551) [-7322.204] (-7329.225) (-7335.502) * [-7324.029] (-7335.248) (-7333.077) (-7337.106) -- 0:03:38
      854000 -- (-7329.926) (-7327.269) [-7319.582] (-7330.704) * (-7334.160) (-7334.746) [-7332.119] (-7321.705) -- 0:03:37
      854500 -- (-7330.160) (-7322.821) [-7322.441] (-7328.492) * (-7325.614) [-7322.614] (-7333.511) (-7326.227) -- 0:03:37
      855000 -- (-7327.659) [-7320.967] (-7328.776) (-7326.795) * (-7328.314) [-7326.789] (-7330.466) (-7329.328) -- 0:03:36

      Average standard deviation of split frequencies: 0.005054

      855500 -- (-7324.265) (-7325.538) [-7333.275] (-7336.103) * (-7325.835) (-7331.880) (-7327.984) [-7332.731] -- 0:03:35
      856000 -- (-7325.091) (-7323.980) (-7327.604) [-7324.280] * [-7325.031] (-7329.303) (-7326.882) (-7330.579) -- 0:03:34
      856500 -- (-7321.877) (-7330.365) [-7317.105] (-7331.669) * (-7334.255) [-7328.790] (-7328.346) (-7327.113) -- 0:03:34
      857000 -- (-7322.313) [-7328.250] (-7325.857) (-7329.792) * [-7325.760] (-7321.680) (-7327.224) (-7327.642) -- 0:03:33
      857500 -- (-7323.298) (-7330.654) [-7329.342] (-7326.049) * [-7314.947] (-7327.347) (-7319.499) (-7322.443) -- 0:03:32
      858000 -- [-7323.746] (-7333.499) (-7329.828) (-7325.913) * [-7319.316] (-7331.853) (-7326.207) (-7321.302) -- 0:03:31
      858500 -- (-7334.024) (-7326.688) [-7325.451] (-7330.880) * (-7316.435) (-7329.911) (-7326.194) [-7323.380] -- 0:03:31
      859000 -- [-7316.942] (-7327.732) (-7337.120) (-7338.498) * [-7321.920] (-7326.404) (-7323.188) (-7324.172) -- 0:03:30
      859500 -- (-7328.853) [-7330.519] (-7327.995) (-7333.253) * (-7322.640) (-7331.743) [-7322.970] (-7330.535) -- 0:03:29
      860000 -- (-7317.456) (-7328.572) (-7327.321) [-7331.509] * (-7327.874) [-7338.014] (-7328.953) (-7325.290) -- 0:03:28

      Average standard deviation of split frequencies: 0.004640

      860500 -- (-7325.264) (-7327.950) (-7325.753) [-7321.078] * [-7329.180] (-7332.350) (-7328.116) (-7318.448) -- 0:03:28
      861000 -- (-7319.959) (-7328.343) (-7317.791) [-7320.015] * (-7329.767) (-7329.996) [-7327.168] (-7321.820) -- 0:03:27
      861500 -- (-7330.775) [-7322.453] (-7321.256) (-7318.375) * (-733