--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Fri Jan 24 08:53:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/6res/ML1119/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1568.15         -1571.30
2      -1568.18         -1571.52
--------------------------------------
TOTAL    -1568.17         -1571.42
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.890970    0.087365    0.339765    1.440078    0.861970   1276.24   1388.62    1.000
r(A<->C){all}   0.162313    0.018110    0.000095    0.430441    0.127371    184.98    196.32    1.003
r(A<->G){all}   0.214255    0.026797    0.000102    0.534841    0.182795    152.69    166.98    1.000
r(A<->T){all}   0.162849    0.019886    0.000021    0.458897    0.123174    212.66    218.36    1.005
r(C<->G){all}   0.150819    0.017791    0.000189    0.422305    0.112330    167.31    216.81    1.002
r(C<->T){all}   0.153210    0.017520    0.000007    0.415988    0.116922    325.11    325.70    1.000
r(G<->T){all}   0.156555    0.016864    0.000107    0.418120    0.122214    220.72    296.11    1.002
pi(A){all}      0.173420    0.000122    0.152287    0.194986    0.173316   1258.14   1297.21    1.000
pi(C){all}      0.304600    0.000180    0.277572    0.330038    0.304430   1259.31   1285.81    1.000
pi(G){all}      0.324219    0.000186    0.298796    0.351115    0.323997   1233.65   1255.13    1.000
pi(T){all}      0.197761    0.000132    0.175725    0.220429    0.197626   1029.33   1177.06    1.000
alpha{1,2}      0.407349    0.215531    0.000318    1.348235    0.246535   1096.28   1188.85    1.000
alpha{3}        0.432708    0.242352    0.000148    1.438672    0.260254   1210.95   1265.44    1.000
pinvar{all}     0.997333    0.000006    0.992953    0.999876    0.997930   1154.30   1205.90    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1507.527896
Model 2: PositiveSelection	-1502.172735
Model 0: one-ratio	-1506.968708
Model 7: beta	-1507.693057
Model 8: beta&w>1	-1502.172501


Model 0 vs 1	1.1183759999998983

Model 2 vs 1	10.710321999999906

Additional information for M1 vs M2:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634427_1_1163_MLBR_RS05455)

            Pr(w>1)     post mean +- SE for w

   144 V      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634427_1_1163_MLBR_RS05455)

            Pr(w>1)     post mean +- SE for w

   144 V      0.929         6.839 +- 2.877


Model 8 vs 7	11.041111999999885

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634427_1_1163_MLBR_RS05455)

            Pr(w>1)     post mean +- SE for w

   144 V      1.000**       999.000

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_012634427_1_1163_MLBR_RS05455)

            Pr(w>1)     post mean +- SE for w

   144 V      0.972*        6.757 +- 2.707

>C1
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C2
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C3
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C4
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C5
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C6
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=383 

C1              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C2              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C3              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C4              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C5              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C6              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
                **************************************************

C1              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C2              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C3              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C4              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C5              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C6              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
                **************************************************

C1              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
C2              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
C3              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
C4              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
C5              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
C6              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
                *******************************************:******

C1              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C2              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C3              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C4              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C5              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C6              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
                **************************************************

C1              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C2              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C3              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C4              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C5              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C6              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
                **************************************************

C1              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C2              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C3              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C4              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C5              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C6              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
                **************************************************

C1              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C2              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C3              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C4              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C5              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C6              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
                **************************************************

C1              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C2              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C3              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C4              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C5              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C6              ELVATAREGDTESAIDAQAALALLLRLADRGVA
                *********************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  383 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  383 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [11490]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [11490]--->[11490]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.529 Mb, Max= 30.960 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C2              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C3              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C4              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C5              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
C6              MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
                **************************************************

C1              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C2              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C3              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C4              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C5              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
C6              VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
                **************************************************

C1              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
C2              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
C3              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
C4              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
C5              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
C6              FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
                *******************************************:******

C1              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C2              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C3              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C4              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C5              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
C6              DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
                **************************************************

C1              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C2              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C3              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C4              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C5              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
C6              LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
                **************************************************

C1              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C2              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C3              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C4              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C5              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
C6              HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
                **************************************************

C1              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C2              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C3              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C4              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C5              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
C6              RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
                **************************************************

C1              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C2              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C3              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C4              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C5              ELVATAREGDTESAIDAQAALALLLRLADRGVA
C6              ELVATAREGDTESAIDAQAALALLLRLADRGVA
                *********************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 99.74 C1	 C2	 99.74
TOP	    1    0	 99.74 C2	 C1	 99.74
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 99.74 C1	 C5	 99.74
TOP	    4    0	 99.74 C5	 C1	 99.74
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 99.74 C2	 C3	 99.74
TOP	    2    1	 99.74 C3	 C2	 99.74
BOT	    1    3	 99.74 C2	 C4	 99.74
TOP	    3    1	 99.74 C4	 C2	 99.74
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 99.74 C2	 C6	 99.74
TOP	    5    1	 99.74 C6	 C2	 99.74
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 99.74 C3	 C5	 99.74
TOP	    4    2	 99.74 C5	 C3	 99.74
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 99.74 C4	 C5	 99.74
TOP	    4    3	 99.74 C5	 C4	 99.74
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 99.74 C5	 C6	 99.74
TOP	    5    4	 99.74 C6	 C5	 99.74
AVG	 0	 C1	  *	 99.90
AVG	 1	 C2	  *	 99.79
AVG	 2	 C3	  *	 99.90
AVG	 3	 C4	  *	 99.90
AVG	 4	 C5	  *	 99.79
AVG	 5	 C6	  *	 99.90
TOT	 TOT	  *	 99.86
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
C2              ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
C3              ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
C4              ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
C5              ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
C6              ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
                **************************************************

C1              CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
C2              CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
C3              CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
C4              CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
C5              CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
C6              CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
                **************************************************

C1              TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
C2              TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
C3              TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
C4              TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
C5              TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
C6              TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
                **************************************************

C1              GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
C2              GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
C3              GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
C4              GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
C5              GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
C6              GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
                **************************************************

C1              CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
C2              CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
C3              CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
C4              CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
C5              CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
C6              CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
                **************************************************

C1              CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
C2              CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
C3              CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
C4              CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
C5              CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
C6              CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
                **************************************************

C1              TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
C2              TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
C3              TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
C4              TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
C5              TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
C6              TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
                **************************************************

C1              CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
C2              CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
C3              CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
C4              CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
C5              CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
C6              CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
                **************************************************

C1              AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
C2              AGGCCCCGACCACGGACCTGGTCGCCGAGATGTTGGGGGGATTGACGGCG
C3              AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
C4              AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
C5              AGGCCCCGACCACGGACCTGGTCGCCGAGATGTTGGGGGGATTGACGGCG
C6              AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
                *****************************.********************

C1              GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
C2              GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
C3              GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
C4              GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
C5              GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
C6              GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
                **************************************************

C1              CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
C2              CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
C3              CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
C4              CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
C5              CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
C6              CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
                **************************************************

C1              CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
C2              CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
C3              CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
C4              CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
C5              CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
C6              CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
                **************************************************

C1              CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
C2              CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
C3              CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
C4              CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
C5              CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
C6              CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
                **************************************************

C1              AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
C2              AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
C3              AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
C4              AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
C5              AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
C6              AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
                **************************************************

C1              TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
C2              TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
C3              TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
C4              TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
C5              TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
C6              TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
                **************************************************

C1              CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
C2              CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
C3              CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
C4              CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
C5              CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
C6              CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
                **************************************************

C1              CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
C2              CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
C3              CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
C4              CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
C5              CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
C6              CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
                **************************************************

C1              ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
C2              ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
C3              ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
C4              ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
C5              ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
C6              ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
                **************************************************

C1              CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
C2              CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
C3              CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
C4              CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
C5              CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
C6              CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
                **************************************************

C1              GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
C2              GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
C3              GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
C4              GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
C5              GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
C6              GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
                **************************************************

C1              GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
C2              GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
C3              GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
C4              GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
C5              GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
C6              GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
                **************************************************

C1              GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
C2              GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
C3              GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
C4              GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
C5              GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
C6              GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
                **************************************************

C1              CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
C2              CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
C3              CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
C4              CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
C5              CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
C6              CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
                *************************************************



>C1
ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
>C2
ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
AGGCCCCGACCACGGACCTGGTCGCCGAGATGTTGGGGGGATTGACGGCG
GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
>C3
ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
>C4
ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
>C5
ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
AGGCCCCGACCACGGACCTGGTCGCCGAGATGTTGGGGGGATTGACGGCG
GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
>C6
ATGCGATTCCTGCACACCGCCGACTGGCAGCTCGGCATGACTCGGCACTT
CCTTGCCGGTGATGCCCAACCGCGGTACTCGGCGGCCCGCCGCGACGCGG
TGGCCGGGCTCGGTGCGTTGGCTGCGGAAGTAGGTGCCGAGTTTGTCGTG
GTGGCTGGTGACGTCTTCGAACACAACCAACTCGCGCCGCAGGTGGTCAG
CCAATCATTGGAGGCCATACGCGCCATCGGTATTCCGGTTTACCTGCTGC
CAGGCAACCACGATCCGCTGGACGCGTCGTCGGTGTACACCAGCGCGCTG
TTTACCGCCGAATGCCCGGATAACATCAATGTGCTTGACCGGGCCGGTGT
CCATCAGGTTCGGCCCGGACTCGAGATCGTCGCTGCGCCATGGCGGTCCA
AGGCCCCGACCACGGACCTGGTCGCCGAGGTGTTGGGGGGATTGACGGCG
GACATCGTCACGCGCGTGCTCGTTGCTCACGGCAGTATCGACGTGTTTGA
CCCGGATCGCGACAAACCCTCCCTGATCCGACTCGCTGGGATCGACGATG
CGCTGGCCGGCGGCGCGGTGCACTACGTGGCCCTAGGAGACAGGCATTCG
CTCACCCAGGTCGGCAGCAGTGGTCGGGTGTGGTACTCCGGCTCCCCGGA
AGTCACCAACTTTGACGACATCGAATCCAACTCTGGCCATGTCCTGGTCG
TCGAGATCGATGAAAATGACCCGCGCCGCCCCGTCACCGTGACGGCCCGA
CATGTCGGTCATTGGCGGTTTTTCACATTGCATTGGCAGGTGGATAACGG
CCGGGACATCGCGGATCTTGACATGAATCTAGATCAGATGATGGACAAGG
ACCGCAGTGTGGTAAGGCTCGCCCTGACCGGTTCGCTCACGATAACCGAC
CGCGCCGTGTTGGATGCTTGCCTGGACAGATATGCACGGCTATTCGCGTG
GCTAGGTCTCTGGGAACGCCGCAGTGACTTAGCGGTGATACCCGCTGACG
GCGAATTTACTGACATCGGCATCGGCGGGTTTGCGGCTGCCGCCGTCGAC
GAGCTGGTCGCTACCGCACGTGAAGGCGACACTGAATCGGCTATCGATGC
CCAGGCGGCGCTGGCACTACTGTTGCGGCTCGCTGATCGGGGAGTGGCA
>C1
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C2
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C3
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C4
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C5
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEMLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA
>C6
MRFLHTADWQLGMTRHFLAGDAQPRYSAARRDAVAGLGALAAEVGAEFVV
VAGDVFEHNQLAPQVVSQSLEAIRAIGIPVYLLPGNHDPLDASSVYTSAL
FTAECPDNINVLDRAGVHQVRPGLEIVAAPWRSKAPTTDLVAEVLGGLTA
DIVTRVLVAHGSIDVFDPDRDKPSLIRLAGIDDALAGGAVHYVALGDRHS
LTQVGSSGRVWYSGSPEVTNFDDIESNSGHVLVVEIDENDPRRPVTVTAR
HVGHWRFFTLHWQVDNGRDIADLDMNLDQMMDKDRSVVRLALTGSLTITD
RAVLDACLDRYARLFAWLGLWERRSDLAVIPADGEFTDIGIGGFAAAAVD
ELVATAREGDTESAIDAQAALALLLRLADRGVA


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 1149 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579855888
      Setting output file names to "/data/6res/ML1119/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1301012038
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 5024979041
      Seed = 1888447252
      Swapseed = 1579855888
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 5 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -2578.224001 -- -24.965149
         Chain 2 -- -2578.187577 -- -24.965149
         Chain 3 -- -2574.884365 -- -24.965149
         Chain 4 -- -2577.530772 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -2578.224149 -- -24.965149
         Chain 2 -- -2578.224149 -- -24.965149
         Chain 3 -- -2578.187429 -- -24.965149
         Chain 4 -- -2578.187577 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-2578.224] (-2578.188) (-2574.884) (-2577.531) * [-2578.224] (-2578.224) (-2578.187) (-2578.188) 
        500 -- (-1582.094) (-1580.567) [-1579.090] (-1586.597) * (-1613.495) [-1578.848] (-1591.655) (-1587.667) -- 0:00:00
       1000 -- (-1575.921) (-1581.281) [-1569.563] (-1579.651) * (-1573.678) [-1573.269] (-1583.972) (-1574.672) -- 0:00:00
       1500 -- [-1579.044] (-1580.498) (-1580.152) (-1578.904) * (-1570.337) [-1572.799] (-1578.719) (-1580.052) -- 0:00:00
       2000 -- [-1569.004] (-1572.162) (-1578.924) (-1574.891) * (-1569.976) (-1570.832) (-1586.569) [-1573.294] -- 0:00:00
       2500 -- (-1573.602) (-1570.593) (-1573.288) [-1571.095] * (-1571.382) [-1570.719] (-1569.485) (-1573.185) -- 0:00:00
       3000 -- (-1580.808) (-1571.702) (-1569.123) [-1570.207] * (-1571.926) (-1567.190) (-1571.843) [-1575.993] -- 0:00:00
       3500 -- (-1586.326) (-1580.678) [-1576.362] (-1570.339) * (-1577.460) [-1571.143] (-1571.659) (-1568.183) -- 0:00:00
       4000 -- (-1574.817) [-1573.049] (-1576.308) (-1576.131) * (-1578.884) (-1574.041) [-1576.588] (-1575.297) -- 0:00:00
       4500 -- (-1575.765) (-1575.686) (-1573.483) [-1571.624] * (-1570.813) (-1579.914) (-1573.339) [-1571.601] -- 0:00:00
       5000 -- (-1572.636) (-1574.923) (-1573.227) [-1568.411] * [-1573.117] (-1574.126) (-1571.109) (-1579.571) -- 0:03:19

      Average standard deviation of split frequencies: 0.142850

       5500 -- [-1567.529] (-1574.597) (-1567.140) (-1575.085) * (-1573.551) [-1574.189] (-1573.613) (-1575.469) -- 0:03:00
       6000 -- (-1574.869) [-1570.528] (-1572.157) (-1578.176) * (-1569.338) (-1578.447) (-1579.666) [-1571.891] -- 0:02:45
       6500 -- [-1570.146] (-1574.738) (-1570.084) (-1576.975) * (-1572.411) [-1573.024] (-1572.759) (-1576.245) -- 0:02:32
       7000 -- [-1567.897] (-1578.528) (-1569.252) (-1572.567) * (-1571.580) (-1579.103) [-1568.501] (-1580.429) -- 0:02:21
       7500 -- [-1573.421] (-1571.206) (-1576.931) (-1571.505) * (-1576.209) [-1572.607] (-1574.734) (-1573.131) -- 0:02:12
       8000 -- (-1575.340) (-1574.476) (-1573.812) [-1568.361] * [-1570.414] (-1570.148) (-1573.153) (-1571.002) -- 0:02:04
       8500 -- (-1573.070) (-1579.280) (-1572.725) [-1575.719] * (-1578.827) (-1571.011) [-1576.249] (-1583.513) -- 0:01:56
       9000 -- (-1574.118) (-1578.867) [-1565.436] (-1570.517) * [-1571.047] (-1582.884) (-1570.932) (-1571.884) -- 0:01:50
       9500 -- (-1570.931) (-1583.355) [-1572.695] (-1569.817) * (-1571.407) (-1571.993) (-1571.492) [-1573.617] -- 0:01:44
      10000 -- (-1571.979) (-1572.345) [-1571.168] (-1580.425) * (-1576.179) (-1570.443) (-1580.144) [-1574.515] -- 0:01:39

      Average standard deviation of split frequencies: 0.088388

      10500 -- (-1585.647) [-1567.826] (-1575.427) (-1572.146) * [-1573.335] (-1569.379) (-1569.105) (-1572.852) -- 0:01:34
      11000 -- (-1575.529) (-1576.203) (-1574.430) [-1567.854] * [-1565.977] (-1573.819) (-1571.707) (-1574.467) -- 0:01:29
      11500 -- (-1569.865) [-1571.818] (-1579.725) (-1569.620) * (-1573.513) (-1569.883) (-1571.241) [-1574.448] -- 0:01:25
      12000 -- (-1573.344) (-1574.196) [-1570.361] (-1567.259) * (-1568.212) (-1571.650) [-1568.745] (-1572.386) -- 0:01:22
      12500 -- (-1571.007) (-1573.427) (-1575.449) [-1573.621] * (-1571.576) (-1570.117) (-1572.466) [-1568.802] -- 0:01:19
      13000 -- (-1566.658) (-1581.467) [-1578.541] (-1570.001) * (-1574.860) (-1571.345) (-1576.377) [-1571.206] -- 0:01:15
      13500 -- (-1567.988) [-1571.492] (-1574.547) (-1572.181) * (-1575.420) (-1576.815) (-1573.350) [-1569.923] -- 0:01:13
      14000 -- (-1570.361) [-1574.567] (-1571.890) (-1573.190) * (-1569.365) (-1570.498) (-1568.083) [-1566.349] -- 0:01:10
      14500 -- [-1574.410] (-1578.845) (-1572.308) (-1570.411) * [-1568.443] (-1577.419) (-1571.060) (-1575.099) -- 0:01:07
      15000 -- (-1570.704) (-1581.463) [-1571.059] (-1570.216) * (-1574.477) (-1567.496) [-1573.964] (-1576.689) -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-1572.543) (-1578.291) [-1572.236] (-1572.529) * (-1576.681) [-1569.719] (-1573.096) (-1587.761) -- 0:01:03
      16000 -- (-1580.248) [-1581.281] (-1576.432) (-1575.226) * [-1575.690] (-1568.804) (-1567.493) (-1575.122) -- 0:01:01
      16500 -- (-1576.579) [-1574.547] (-1573.444) (-1569.356) * (-1568.674) (-1567.945) (-1573.912) [-1569.421] -- 0:00:59
      17000 -- (-1576.170) (-1574.905) (-1575.023) [-1571.399] * (-1582.159) [-1568.344] (-1571.940) (-1568.967) -- 0:00:57
      17500 -- (-1569.330) (-1577.135) (-1579.594) [-1573.068] * [-1569.151] (-1569.086) (-1567.478) (-1574.704) -- 0:01:52
      18000 -- (-1577.257) (-1575.083) [-1572.356] (-1570.508) * [-1576.224] (-1568.285) (-1573.098) (-1573.994) -- 0:01:49
      18500 -- (-1575.560) [-1571.660] (-1574.203) (-1574.070) * (-1575.674) (-1567.937) (-1574.529) [-1571.449] -- 0:01:46
      19000 -- (-1579.621) (-1573.223) (-1580.667) [-1579.130] * (-1573.846) (-1568.935) (-1580.389) [-1574.710] -- 0:01:43
      19500 -- (-1574.640) (-1601.421) [-1579.591] (-1575.149) * (-1570.304) (-1572.025) [-1568.641] (-1571.665) -- 0:01:40
      20000 -- [-1578.587] (-1573.331) (-1577.941) (-1577.172) * (-1576.389) (-1569.259) (-1581.340) [-1569.111] -- 0:01:38

      Average standard deviation of split frequencies: 0.053914

      20500 -- (-1576.518) [-1567.071] (-1572.596) (-1574.579) * (-1572.701) (-1570.202) [-1567.364] (-1575.275) -- 0:01:35
      21000 -- [-1574.307] (-1569.480) (-1569.183) (-1579.527) * (-1573.699) (-1569.050) (-1572.553) [-1566.769] -- 0:01:33
      21500 -- (-1575.864) (-1571.392) [-1571.541] (-1577.957) * (-1575.908) (-1564.987) [-1568.248] (-1569.518) -- 0:01:31
      22000 -- [-1569.785] (-1569.724) (-1578.272) (-1572.156) * (-1573.480) (-1569.373) (-1581.212) [-1573.003] -- 0:01:28
      22500 -- (-1571.020) [-1569.111] (-1571.477) (-1576.297) * [-1573.050] (-1568.591) (-1574.805) (-1575.455) -- 0:01:26
      23000 -- [-1568.187] (-1570.162) (-1576.378) (-1575.351) * [-1573.256] (-1568.756) (-1571.085) (-1576.597) -- 0:01:24
      23500 -- [-1567.571] (-1568.500) (-1574.267) (-1577.452) * [-1571.279] (-1570.859) (-1570.038) (-1568.605) -- 0:01:23
      24000 -- (-1573.631) [-1569.524] (-1569.266) (-1584.955) * (-1570.453) (-1572.176) [-1576.299] (-1576.656) -- 0:01:21
      24500 -- (-1571.333) (-1571.129) [-1567.182] (-1575.089) * [-1570.800] (-1570.018) (-1576.391) (-1569.212) -- 0:01:19
      25000 -- (-1576.405) (-1569.825) [-1578.623] (-1575.161) * (-1582.134) (-1573.161) [-1570.176] (-1570.553) -- 0:01:18

      Average standard deviation of split frequencies: 0.044503

      25500 -- (-1582.815) (-1568.430) [-1568.998] (-1571.235) * (-1579.288) (-1570.448) (-1573.911) [-1568.770] -- 0:01:16
      26000 -- (-1573.766) (-1568.312) [-1567.045] (-1571.308) * (-1568.092) (-1568.212) (-1574.679) [-1568.037] -- 0:01:14
      26500 -- (-1580.377) (-1566.919) (-1576.097) [-1569.367] * (-1568.526) [-1570.026] (-1576.473) (-1570.069) -- 0:01:13
      27000 -- (-1573.970) (-1571.039) (-1569.502) [-1565.973] * (-1575.136) (-1568.167) (-1588.656) [-1569.326] -- 0:01:12
      27500 -- (-1572.010) (-1569.944) [-1567.674] (-1574.466) * [-1575.907] (-1572.271) (-1569.553) (-1570.544) -- 0:01:10
      28000 -- (-1573.143) (-1572.945) [-1571.994] (-1572.736) * (-1569.126) [-1568.411] (-1568.333) (-1570.009) -- 0:01:09
      28500 -- [-1572.916] (-1567.792) (-1578.959) (-1572.855) * [-1570.058] (-1568.169) (-1569.026) (-1573.700) -- 0:01:08
      29000 -- [-1574.650] (-1569.532) (-1581.725) (-1570.641) * [-1573.583] (-1568.844) (-1569.726) (-1569.856) -- 0:01:06
      29500 -- (-1574.287) (-1569.327) (-1578.654) [-1566.585] * [-1571.514] (-1567.989) (-1570.286) (-1570.660) -- 0:01:05
      30000 -- [-1576.168] (-1570.196) (-1575.873) (-1571.565) * [-1568.698] (-1568.566) (-1568.506) (-1571.649) -- 0:01:04

      Average standard deviation of split frequencies: 0.046116

      30500 -- (-1575.784) (-1569.750) [-1573.482] (-1573.006) * (-1570.243) (-1569.371) [-1571.443] (-1571.056) -- 0:01:35
      31000 -- (-1572.206) (-1569.647) [-1571.842] (-1569.975) * (-1570.540) (-1568.380) (-1565.685) [-1569.927] -- 0:01:33
      31500 -- [-1572.102] (-1570.997) (-1574.352) (-1571.441) * (-1569.921) (-1570.833) (-1566.356) [-1569.578] -- 0:01:32
      32000 -- (-1577.887) [-1572.149] (-1573.570) (-1579.304) * (-1572.509) (-1569.031) (-1569.030) [-1570.568] -- 0:01:30
      32500 -- (-1580.853) [-1570.302] (-1577.919) (-1578.406) * (-1569.202) (-1568.843) [-1568.981] (-1570.454) -- 0:01:29
      33000 -- (-1573.147) [-1568.770] (-1566.509) (-1568.830) * (-1569.233) (-1568.037) [-1568.104] (-1571.179) -- 0:01:27
      33500 -- [-1569.440] (-1570.129) (-1578.248) (-1569.848) * (-1567.691) [-1571.308] (-1571.748) (-1572.308) -- 0:01:26
      34000 -- (-1572.339) (-1568.202) [-1570.067] (-1571.848) * (-1569.920) (-1568.508) [-1573.363] (-1569.368) -- 0:01:25
      34500 -- (-1571.217) (-1569.777) [-1568.751] (-1573.255) * (-1570.249) (-1571.537) (-1574.720) [-1569.086] -- 0:01:23
      35000 -- (-1575.642) (-1570.198) [-1575.787] (-1574.340) * (-1569.213) (-1572.434) (-1573.208) [-1568.571] -- 0:01:22

      Average standard deviation of split frequencies: 0.052378

      35500 -- (-1572.796) (-1570.085) [-1569.388] (-1572.705) * [-1573.243] (-1571.938) (-1568.057) (-1568.709) -- 0:01:21
      36000 -- (-1576.188) (-1569.871) (-1571.016) [-1568.306] * (-1570.696) (-1570.589) (-1568.847) [-1568.500] -- 0:01:20
      36500 -- [-1570.121] (-1569.685) (-1568.483) (-1569.609) * (-1567.333) (-1572.829) (-1567.557) [-1568.461] -- 0:01:19
      37000 -- [-1576.904] (-1572.483) (-1579.037) (-1569.823) * (-1567.713) [-1570.865] (-1568.910) (-1570.796) -- 0:01:18
      37500 -- [-1571.718] (-1568.505) (-1578.080) (-1569.368) * (-1566.065) [-1571.689] (-1567.721) (-1572.305) -- 0:01:17
      38000 -- (-1570.868) (-1571.113) [-1569.075] (-1571.041) * (-1568.345) [-1566.554] (-1566.200) (-1570.390) -- 0:01:15
      38500 -- (-1577.993) (-1571.722) (-1569.809) [-1566.654] * [-1567.589] (-1573.139) (-1570.556) (-1571.285) -- 0:01:14
      39000 -- (-1581.335) (-1567.713) (-1578.476) [-1572.632] * (-1568.868) [-1568.684] (-1569.634) (-1569.489) -- 0:01:13
      39500 -- [-1581.072] (-1568.006) (-1573.824) (-1566.800) * (-1569.840) (-1569.195) (-1567.719) [-1569.025] -- 0:01:12
      40000 -- [-1573.547] (-1569.680) (-1573.124) (-1569.521) * [-1572.043] (-1572.220) (-1570.118) (-1569.358) -- 0:01:12

      Average standard deviation of split frequencies: 0.060858

      40500 -- (-1576.035) (-1569.668) (-1573.757) [-1568.523] * (-1571.995) (-1569.523) [-1569.152] (-1569.547) -- 0:01:11
      41000 -- (-1577.476) (-1568.691) [-1574.604] (-1570.930) * (-1572.321) [-1568.231] (-1570.057) (-1568.087) -- 0:01:10
      41500 -- (-1578.743) (-1568.013) [-1576.593] (-1568.545) * (-1572.130) [-1567.591] (-1569.829) (-1570.179) -- 0:01:09
      42000 -- (-1577.885) (-1571.927) [-1570.046] (-1567.928) * (-1573.641) (-1568.677) [-1566.722] (-1569.035) -- 0:01:08
      42500 -- (-1576.648) (-1570.358) [-1572.075] (-1567.991) * (-1568.033) [-1568.631] (-1566.571) (-1572.010) -- 0:01:07
      43000 -- (-1575.275) (-1573.984) [-1571.056] (-1572.332) * (-1572.466) (-1569.857) [-1569.007] (-1570.115) -- 0:01:29
      43500 -- [-1578.400] (-1569.062) (-1575.761) (-1575.170) * (-1570.218) [-1567.485] (-1568.612) (-1569.563) -- 0:01:27
      44000 -- (-1574.348) [-1571.834] (-1572.945) (-1568.951) * (-1570.965) [-1569.368] (-1567.043) (-1568.495) -- 0:01:26
      44500 -- (-1573.444) [-1569.766] (-1567.976) (-1569.381) * [-1567.442] (-1571.290) (-1567.705) (-1571.625) -- 0:01:25
      45000 -- (-1571.259) (-1569.591) (-1572.316) [-1570.345] * (-1570.667) (-1574.052) (-1569.846) [-1572.737] -- 0:01:24

      Average standard deviation of split frequencies: 0.056364

      45500 -- [-1574.292] (-1569.583) (-1572.108) (-1568.909) * [-1570.820] (-1570.320) (-1569.888) (-1570.464) -- 0:01:23
      46000 -- (-1571.167) [-1569.479] (-1592.890) (-1571.645) * (-1571.828) (-1571.525) (-1568.862) [-1568.818] -- 0:01:22
      46500 -- (-1569.742) (-1571.191) [-1571.945] (-1568.448) * (-1571.711) [-1567.889] (-1568.921) (-1569.889) -- 0:01:22
      47000 -- (-1572.238) [-1570.319] (-1576.714) (-1568.187) * (-1568.408) [-1567.984] (-1567.910) (-1569.664) -- 0:01:21
      47500 -- [-1572.724] (-1568.980) (-1573.364) (-1569.363) * (-1568.900) (-1569.775) [-1567.059] (-1570.332) -- 0:01:20
      48000 -- (-1572.171) (-1572.144) [-1568.714] (-1570.570) * (-1568.874) [-1567.285] (-1571.471) (-1571.368) -- 0:01:19
      48500 -- (-1570.109) (-1570.762) [-1578.831] (-1566.877) * (-1572.581) [-1566.950] (-1571.792) (-1570.678) -- 0:01:18
      49000 -- (-1569.209) (-1571.271) (-1574.103) [-1567.406] * (-1569.179) (-1569.517) [-1569.827] (-1570.628) -- 0:01:17
      49500 -- [-1569.213] (-1569.718) (-1583.360) (-1568.354) * (-1568.566) (-1568.675) (-1572.857) [-1575.621] -- 0:01:16
      50000 -- (-1574.787) (-1568.651) [-1572.632] (-1568.211) * (-1571.696) (-1570.746) (-1572.034) [-1568.239] -- 0:01:16

      Average standard deviation of split frequencies: 0.070556

      50500 -- (-1571.998) [-1570.130] (-1584.080) (-1567.203) * (-1570.529) [-1572.003] (-1570.452) (-1573.246) -- 0:01:15
      51000 -- (-1572.929) (-1569.269) [-1570.644] (-1569.652) * [-1568.911] (-1572.876) (-1570.654) (-1568.859) -- 0:01:14
      51500 -- (-1567.609) [-1569.858] (-1572.159) (-1568.904) * (-1569.388) (-1568.911) (-1567.736) [-1570.429] -- 0:01:13
      52000 -- (-1584.740) (-1568.519) [-1580.925] (-1568.838) * (-1572.036) (-1570.714) (-1570.652) [-1568.365] -- 0:01:12
      52500 -- (-1569.107) [-1568.295] (-1569.260) (-1569.332) * (-1570.909) [-1570.100] (-1573.739) (-1571.889) -- 0:01:12
      53000 -- (-1570.732) (-1569.855) [-1566.175] (-1571.065) * (-1568.098) (-1573.176) [-1569.619] (-1568.202) -- 0:01:11
      53500 -- (-1575.993) [-1569.819] (-1578.302) (-1568.503) * (-1568.443) (-1569.131) (-1573.329) [-1567.550] -- 0:01:10
      54000 -- [-1570.960] (-1569.365) (-1575.185) (-1568.442) * (-1568.609) (-1572.253) (-1568.181) [-1567.531] -- 0:01:10
      54500 -- (-1573.503) (-1569.147) [-1578.872] (-1568.254) * (-1569.449) [-1568.242] (-1570.663) (-1568.583) -- 0:01:09
      55000 -- [-1567.470] (-1569.337) (-1574.407) (-1567.937) * (-1569.934) (-1567.653) (-1568.296) [-1567.155] -- 0:01:08

      Average standard deviation of split frequencies: 0.067344

      55500 -- (-1578.753) (-1568.086) (-1580.686) [-1568.790] * (-1567.801) (-1568.445) (-1568.883) [-1568.147] -- 0:01:08
      56000 -- (-1579.033) [-1569.910] (-1586.028) (-1572.754) * (-1567.535) (-1568.426) [-1568.805] (-1570.789) -- 0:01:07
      56500 -- (-1573.930) (-1565.736) [-1570.886] (-1572.952) * (-1571.932) [-1568.880] (-1572.630) (-1567.683) -- 0:01:23
      57000 -- (-1568.099) [-1570.343] (-1577.534) (-1572.360) * (-1571.541) (-1569.094) [-1568.550] (-1569.236) -- 0:01:22
      57500 -- (-1596.825) [-1569.133] (-1583.497) (-1571.158) * (-1573.167) (-1568.210) [-1570.486] (-1570.967) -- 0:01:21
      58000 -- (-1570.629) (-1570.487) (-1570.641) [-1569.438] * (-1576.486) (-1567.895) [-1568.913] (-1569.068) -- 0:01:21
      58500 -- (-1569.111) (-1569.430) [-1573.533] (-1571.746) * (-1575.649) [-1568.237] (-1568.781) (-1571.088) -- 0:01:20
      59000 -- (-1568.132) (-1570.506) [-1575.696] (-1567.584) * (-1570.612) (-1568.827) [-1569.173] (-1568.197) -- 0:01:19
      59500 -- (-1566.930) (-1572.509) [-1579.279] (-1568.711) * (-1570.280) (-1569.276) [-1567.599] (-1568.430) -- 0:01:19
      60000 -- (-1570.252) (-1571.653) (-1575.620) [-1569.885] * (-1569.327) (-1571.656) [-1570.030] (-1568.817) -- 0:01:18

      Average standard deviation of split frequencies: 0.061457

      60500 -- (-1567.237) (-1567.206) [-1568.985] (-1568.402) * (-1568.758) (-1572.909) (-1571.290) [-1568.962] -- 0:01:17
      61000 -- (-1567.135) (-1568.369) [-1570.437] (-1570.265) * (-1569.589) [-1568.481] (-1570.284) (-1569.440) -- 0:01:16
      61500 -- (-1568.134) (-1570.496) [-1567.629] (-1567.517) * (-1570.980) (-1570.501) [-1568.426] (-1567.820) -- 0:01:16
      62000 -- (-1566.294) (-1569.196) [-1577.003] (-1567.662) * [-1571.827] (-1569.464) (-1568.401) (-1567.256) -- 0:01:15
      62500 -- [-1567.485] (-1570.796) (-1574.135) (-1568.264) * (-1569.684) (-1569.370) [-1567.879] (-1568.861) -- 0:01:15
      63000 -- (-1566.143) (-1569.023) [-1573.322] (-1569.008) * (-1568.456) (-1569.195) [-1568.174] (-1570.714) -- 0:01:14
      63500 -- [-1567.425] (-1569.487) (-1571.804) (-1567.618) * (-1574.390) (-1569.173) [-1568.200] (-1570.736) -- 0:01:13
      64000 -- (-1567.199) (-1569.475) [-1583.541] (-1568.593) * (-1570.486) (-1568.437) (-1568.513) [-1571.577] -- 0:01:13
      64500 -- [-1569.546] (-1568.521) (-1573.781) (-1568.697) * (-1569.057) [-1570.350] (-1567.024) (-1570.160) -- 0:01:12
      65000 -- (-1571.901) [-1569.947] (-1573.894) (-1568.209) * (-1567.831) [-1568.160] (-1574.401) (-1569.727) -- 0:01:11

      Average standard deviation of split frequencies: 0.054589

      65500 -- (-1572.157) [-1571.971] (-1572.160) (-1568.787) * (-1568.449) [-1568.870] (-1569.704) (-1568.943) -- 0:01:11
      66000 -- (-1573.178) (-1575.491) [-1572.651] (-1568.559) * [-1569.282] (-1570.730) (-1570.580) (-1569.640) -- 0:01:10
      66500 -- (-1569.357) (-1568.723) [-1571.905] (-1568.540) * (-1568.874) (-1570.121) [-1571.332] (-1570.079) -- 0:01:10
      67000 -- (-1569.444) (-1570.845) [-1569.750] (-1569.029) * (-1568.826) (-1569.057) (-1571.557) [-1568.694] -- 0:01:09
      67500 -- (-1568.306) (-1570.287) [-1581.416] (-1570.241) * [-1570.403] (-1570.656) (-1571.270) (-1568.758) -- 0:01:09
      68000 -- (-1568.135) [-1567.697] (-1572.968) (-1569.543) * (-1570.175) [-1569.296] (-1569.233) (-1577.141) -- 0:01:08
      68500 -- (-1566.110) (-1569.021) (-1577.533) [-1568.726] * [-1571.816] (-1572.783) (-1570.427) (-1569.714) -- 0:01:07
      69000 -- (-1566.264) (-1574.619) [-1571.029] (-1568.256) * [-1572.605] (-1568.959) (-1576.652) (-1569.377) -- 0:01:07
      69500 -- (-1566.629) (-1577.257) (-1583.516) [-1569.788] * (-1571.707) (-1570.528) (-1574.075) [-1569.236] -- 0:01:06
      70000 -- [-1572.146] (-1572.272) (-1576.889) (-1568.456) * (-1572.589) (-1574.185) [-1568.670] (-1571.071) -- 0:01:06

      Average standard deviation of split frequencies: 0.054796

      70500 -- (-1572.484) (-1570.716) (-1576.330) [-1569.113] * (-1569.491) (-1569.110) (-1570.634) [-1569.264] -- 0:01:05
      71000 -- (-1569.441) (-1569.774) (-1574.793) [-1570.110] * (-1569.910) (-1569.949) [-1572.944] (-1570.927) -- 0:01:18
      71500 -- [-1567.631] (-1569.009) (-1572.023) (-1570.020) * (-1571.969) (-1569.629) (-1569.893) [-1569.137] -- 0:01:17
      72000 -- (-1566.703) [-1569.370] (-1573.917) (-1571.872) * (-1571.687) [-1570.037] (-1567.711) (-1569.578) -- 0:01:17
      72500 -- (-1566.412) (-1568.412) [-1568.705] (-1567.709) * (-1570.404) [-1570.797] (-1568.780) (-1570.782) -- 0:01:16
      73000 -- [-1568.021] (-1568.232) (-1577.461) (-1569.037) * (-1575.134) (-1570.752) [-1567.914] (-1571.171) -- 0:01:16
      73500 -- (-1568.576) (-1569.088) [-1574.993] (-1569.212) * (-1570.867) [-1568.910] (-1567.209) (-1570.758) -- 0:01:15
      74000 -- (-1567.134) (-1568.937) (-1575.900) [-1566.306] * (-1571.654) [-1567.493] (-1568.559) (-1571.040) -- 0:01:15
      74500 -- (-1567.296) [-1568.987] (-1571.169) (-1567.441) * (-1568.826) [-1568.200] (-1566.523) (-1571.125) -- 0:01:14
      75000 -- (-1569.221) (-1567.421) [-1570.678] (-1567.068) * (-1570.045) [-1566.435] (-1568.167) (-1566.792) -- 0:01:14

      Average standard deviation of split frequencies: 0.053609

      75500 -- (-1568.483) (-1569.862) [-1570.634] (-1568.639) * (-1570.173) [-1567.135] (-1568.177) (-1568.414) -- 0:01:13
      76000 -- (-1567.768) (-1570.880) [-1572.935] (-1567.904) * [-1568.875] (-1567.666) (-1567.588) (-1569.818) -- 0:01:12
      76500 -- [-1567.956] (-1569.001) (-1576.991) (-1569.350) * (-1567.677) [-1570.041] (-1569.373) (-1569.937) -- 0:01:12
      77000 -- (-1568.637) (-1569.698) [-1574.881] (-1569.832) * (-1569.608) [-1568.166] (-1568.761) (-1568.449) -- 0:01:11
      77500 -- (-1572.888) (-1574.137) (-1571.866) [-1568.617] * [-1568.898] (-1566.750) (-1569.686) (-1569.458) -- 0:01:11
      78000 -- (-1570.497) [-1568.885] (-1571.949) (-1569.787) * [-1569.507] (-1572.343) (-1570.269) (-1571.029) -- 0:01:10
      78500 -- (-1570.924) (-1568.051) (-1574.338) [-1568.871] * [-1568.002] (-1570.753) (-1572.764) (-1568.886) -- 0:01:10
      79000 -- (-1573.041) [-1569.410] (-1574.596) (-1570.807) * (-1569.215) [-1567.776] (-1571.013) (-1568.943) -- 0:01:09
      79500 -- (-1569.755) (-1570.897) [-1567.095] (-1566.798) * (-1565.759) [-1565.545] (-1570.029) (-1569.808) -- 0:01:09
      80000 -- (-1573.127) (-1569.213) [-1579.579] (-1568.366) * [-1573.328] (-1570.560) (-1569.364) (-1567.751) -- 0:01:09

      Average standard deviation of split frequencies: 0.049448

      80500 -- (-1574.899) (-1568.244) [-1573.387] (-1567.486) * (-1573.773) (-1569.660) [-1573.171] (-1567.300) -- 0:01:08
      81000 -- [-1572.737] (-1568.640) (-1572.018) (-1569.065) * (-1570.117) (-1567.204) (-1569.024) [-1568.683] -- 0:01:08
      81500 -- (-1568.973) (-1569.836) (-1580.844) [-1566.921] * [-1568.312] (-1573.719) (-1571.215) (-1570.395) -- 0:01:07
      82000 -- (-1570.977) [-1569.552] (-1577.723) (-1569.167) * (-1568.218) (-1569.827) [-1569.430] (-1570.163) -- 0:01:07
      82500 -- (-1570.736) (-1567.761) [-1571.845] (-1568.143) * (-1569.737) (-1574.264) (-1568.176) [-1570.052] -- 0:01:06
      83000 -- (-1573.168) (-1568.779) [-1572.894] (-1568.362) * (-1569.199) [-1570.482] (-1568.175) (-1569.014) -- 0:01:06
      83500 -- (-1569.431) (-1569.573) [-1571.385] (-1568.887) * (-1565.844) (-1567.923) (-1570.652) [-1567.772] -- 0:01:05
      84000 -- (-1568.906) [-1571.614] (-1571.722) (-1565.797) * (-1568.276) [-1567.999] (-1570.821) (-1568.708) -- 0:01:05
      84500 -- (-1567.461) (-1567.847) [-1568.921] (-1566.556) * (-1569.867) [-1570.644] (-1569.883) (-1570.050) -- 0:01:05
      85000 -- (-1570.211) (-1572.551) [-1568.820] (-1570.699) * (-1571.472) [-1572.573] (-1571.315) (-1568.623) -- 0:01:04

      Average standard deviation of split frequencies: 0.052622

      85500 -- (-1569.803) (-1570.089) [-1570.855] (-1570.838) * [-1568.742] (-1571.909) (-1574.086) (-1569.777) -- 0:01:14
      86000 -- (-1573.689) [-1572.609] (-1570.557) (-1568.290) * [-1571.973] (-1570.602) (-1571.925) (-1568.451) -- 0:01:14
      86500 -- (-1570.610) (-1567.835) (-1574.405) [-1568.723] * (-1568.694) (-1571.214) [-1568.386] (-1568.509) -- 0:01:13
      87000 -- (-1569.924) (-1568.839) (-1573.928) [-1568.070] * (-1571.277) (-1568.319) [-1569.714] (-1568.660) -- 0:01:13
      87500 -- (-1573.198) (-1570.637) (-1573.177) [-1569.471] * (-1569.655) (-1569.080) (-1568.118) [-1569.068] -- 0:01:13
      88000 -- (-1568.748) (-1572.442) [-1571.575] (-1569.989) * [-1568.178] (-1569.188) (-1574.954) (-1570.639) -- 0:01:12
      88500 -- (-1572.230) [-1572.445] (-1578.045) (-1567.202) * [-1569.569] (-1568.810) (-1572.193) (-1570.386) -- 0:01:12
      89000 -- (-1569.180) [-1567.563] (-1568.863) (-1568.871) * (-1569.245) [-1572.871] (-1570.895) (-1569.582) -- 0:01:11
      89500 -- (-1569.030) (-1566.597) [-1572.250] (-1568.804) * (-1570.225) (-1576.532) [-1570.038] (-1569.987) -- 0:01:11
      90000 -- (-1568.924) (-1569.449) [-1573.301] (-1568.082) * (-1571.058) (-1571.967) [-1570.333] (-1571.565) -- 0:01:10

      Average standard deviation of split frequencies: 0.055113

      90500 -- (-1569.824) (-1568.683) [-1566.499] (-1570.112) * (-1568.310) [-1571.512] (-1569.012) (-1569.869) -- 0:01:10
      91000 -- (-1569.408) (-1568.109) [-1568.296] (-1568.215) * [-1568.606] (-1568.426) (-1570.325) (-1572.676) -- 0:01:09
      91500 -- (-1569.280) (-1568.205) [-1569.292] (-1572.690) * (-1568.324) (-1571.514) [-1568.105] (-1569.370) -- 0:01:09
      92000 -- [-1568.314] (-1568.088) (-1580.447) (-1566.887) * (-1570.122) [-1569.385] (-1572.240) (-1568.358) -- 0:01:09
      92500 -- [-1568.171] (-1568.593) (-1573.281) (-1570.342) * [-1568.455] (-1573.413) (-1571.866) (-1572.412) -- 0:01:08
      93000 -- (-1570.550) (-1567.641) [-1568.337] (-1569.750) * (-1572.808) (-1571.096) (-1570.160) [-1570.527] -- 0:01:08
      93500 -- (-1568.942) (-1568.202) [-1571.381] (-1572.484) * (-1577.645) (-1570.075) (-1570.034) [-1569.315] -- 0:01:07
      94000 -- (-1567.854) (-1565.764) [-1571.747] (-1572.531) * (-1568.186) (-1569.497) (-1571.175) [-1570.569] -- 0:01:07
      94500 -- (-1568.879) (-1569.018) (-1576.200) [-1569.008] * [-1572.338] (-1572.173) (-1572.142) (-1570.867) -- 0:01:07
      95000 -- (-1569.927) (-1568.738) [-1576.651] (-1566.731) * (-1569.923) (-1572.172) (-1572.232) [-1574.789] -- 0:01:06

      Average standard deviation of split frequencies: 0.054015

      95500 -- [-1569.001] (-1571.024) (-1571.328) (-1568.206) * (-1568.418) [-1570.842] (-1571.992) (-1569.657) -- 0:01:06
      96000 -- (-1570.526) (-1570.961) [-1568.597] (-1567.852) * (-1570.195) (-1568.647) [-1568.484] (-1567.601) -- 0:01:05
      96500 -- (-1568.238) [-1567.066] (-1577.119) (-1568.101) * (-1570.824) (-1570.285) (-1568.547) [-1570.201] -- 0:01:05
      97000 -- (-1569.768) [-1569.935] (-1569.112) (-1568.508) * (-1568.782) [-1571.054] (-1568.991) (-1568.657) -- 0:01:05
      97500 -- (-1569.812) (-1570.929) [-1568.498] (-1570.054) * (-1570.404) [-1568.947] (-1568.746) (-1569.328) -- 0:01:04
      98000 -- (-1570.641) (-1568.658) [-1567.039] (-1568.352) * [-1569.615] (-1569.290) (-1571.165) (-1568.970) -- 0:01:04
      98500 -- (-1569.785) (-1571.173) (-1568.645) [-1568.972] * [-1567.965] (-1568.350) (-1572.216) (-1568.203) -- 0:01:04
      99000 -- (-1573.949) (-1569.454) [-1572.653] (-1572.195) * (-1569.814) (-1573.753) (-1574.384) [-1570.777] -- 0:01:03
      99500 -- [-1568.923] (-1572.930) (-1579.935) (-1569.266) * [-1570.500] (-1574.302) (-1573.466) (-1569.081) -- 0:01:03
      100000 -- (-1570.311) (-1568.658) (-1584.179) [-1567.819] * [-1571.607] (-1570.892) (-1573.757) (-1568.952) -- 0:01:02

      Average standard deviation of split frequencies: 0.055316

      100500 -- (-1571.565) (-1569.764) [-1569.961] (-1569.257) * (-1570.165) (-1571.035) (-1572.537) [-1570.928] -- 0:01:11
      101000 -- [-1569.206] (-1567.404) (-1574.975) (-1567.994) * (-1568.257) (-1569.910) (-1572.818) [-1570.338] -- 0:01:11
      101500 -- (-1568.416) (-1568.580) (-1575.252) [-1570.127] * (-1568.358) [-1568.315] (-1569.226) (-1568.790) -- 0:01:10
      102000 -- (-1567.281) [-1567.238] (-1571.641) (-1570.206) * (-1569.707) (-1568.806) (-1570.202) [-1570.847] -- 0:01:10
      102500 -- (-1573.958) (-1567.473) (-1574.479) [-1569.837] * [-1568.186] (-1568.455) (-1569.482) (-1572.192) -- 0:01:10
      103000 -- [-1572.184] (-1572.033) (-1568.736) (-1568.621) * (-1569.940) [-1569.527] (-1569.911) (-1572.278) -- 0:01:09
      103500 -- (-1570.397) (-1570.137) [-1575.518] (-1569.428) * (-1568.704) (-1567.559) [-1568.950] (-1568.233) -- 0:01:09
      104000 -- (-1570.132) (-1571.164) (-1575.403) [-1569.481] * (-1571.779) [-1568.883] (-1568.289) (-1571.593) -- 0:01:08
      104500 -- (-1570.242) (-1573.802) [-1569.859] (-1570.423) * (-1568.063) (-1567.943) [-1568.798] (-1569.807) -- 0:01:08
      105000 -- (-1570.247) (-1565.476) [-1573.785] (-1568.906) * [-1568.257] (-1568.757) (-1569.340) (-1569.793) -- 0:01:08

      Average standard deviation of split frequencies: 0.054602

      105500 -- (-1571.409) (-1570.087) [-1569.307] (-1571.423) * (-1568.564) [-1570.482] (-1569.091) (-1572.919) -- 0:01:07
      106000 -- (-1568.733) (-1568.959) (-1569.203) [-1571.477] * (-1567.817) (-1570.652) [-1570.466] (-1568.539) -- 0:01:07
      106500 -- [-1569.695] (-1569.389) (-1572.404) (-1572.053) * (-1567.828) (-1568.759) [-1571.631] (-1572.090) -- 0:01:07
      107000 -- (-1569.968) (-1569.091) (-1570.937) [-1568.267] * (-1571.789) (-1570.534) (-1570.993) [-1570.507] -- 0:01:06
      107500 -- (-1569.266) (-1570.023) [-1568.287] (-1570.672) * (-1568.126) (-1568.670) (-1569.992) [-1568.696] -- 0:01:06
      108000 -- (-1569.407) (-1571.170) [-1574.159] (-1569.917) * [-1568.151] (-1568.361) (-1569.081) (-1568.145) -- 0:01:06
      108500 -- (-1567.788) (-1569.783) (-1575.965) [-1569.069] * (-1569.898) (-1568.326) (-1573.009) [-1568.453] -- 0:01:05
      109000 -- (-1569.999) (-1576.268) [-1570.786] (-1568.014) * (-1570.422) (-1568.908) [-1572.522] (-1568.748) -- 0:01:05
      109500 -- [-1569.240] (-1568.923) (-1571.924) (-1567.599) * (-1568.605) (-1567.982) [-1570.661] (-1566.923) -- 0:01:05
      110000 -- (-1570.202) (-1567.882) [-1572.198] (-1571.092) * (-1571.627) (-1568.270) [-1569.586] (-1570.842) -- 0:01:04

      Average standard deviation of split frequencies: 0.053483

      110500 -- [-1568.682] (-1573.175) (-1574.290) (-1569.117) * (-1568.234) (-1567.926) (-1568.273) [-1568.220] -- 0:01:04
      111000 -- [-1569.062] (-1572.295) (-1571.400) (-1568.003) * (-1567.775) [-1568.420] (-1570.603) (-1568.962) -- 0:01:04
      111500 -- (-1567.100) [-1570.270] (-1569.757) (-1569.818) * (-1569.157) [-1567.346] (-1567.176) (-1567.718) -- 0:01:03
      112000 -- (-1572.322) (-1568.352) [-1567.395] (-1569.549) * (-1568.811) (-1570.311) (-1569.698) [-1574.628] -- 0:01:03
      112500 -- (-1569.343) (-1565.929) [-1573.129] (-1568.119) * (-1569.728) [-1568.607] (-1572.377) (-1568.264) -- 0:01:03
      113000 -- (-1568.886) (-1569.977) [-1568.853] (-1572.394) * (-1572.833) [-1568.759] (-1567.543) (-1571.786) -- 0:01:02
      113500 -- [-1568.446] (-1571.545) (-1580.648) (-1572.729) * (-1571.298) [-1568.911] (-1570.756) (-1571.811) -- 0:01:02
      114000 -- (-1573.091) (-1568.626) [-1578.147] (-1569.627) * (-1571.726) [-1571.895] (-1570.712) (-1573.884) -- 0:01:02
      114500 -- (-1569.438) (-1567.306) [-1572.705] (-1569.627) * (-1567.850) (-1569.987) [-1568.425] (-1572.635) -- 0:01:09
      115000 -- (-1570.623) (-1568.564) [-1570.248] (-1568.235) * [-1566.160] (-1570.975) (-1569.268) (-1568.610) -- 0:01:09

      Average standard deviation of split frequencies: 0.051560

      115500 -- (-1569.812) (-1571.297) [-1566.967] (-1571.612) * [-1567.505] (-1570.054) (-1569.293) (-1568.662) -- 0:01:08
      116000 -- [-1569.353] (-1577.072) (-1565.325) (-1571.562) * (-1567.447) (-1569.921) (-1569.220) [-1571.146] -- 0:01:08
      116500 -- (-1569.523) (-1569.641) (-1569.098) [-1568.164] * (-1570.387) [-1569.798] (-1567.916) (-1568.742) -- 0:01:08
      117000 -- [-1567.990] (-1569.138) (-1569.257) (-1568.023) * (-1568.735) (-1569.648) [-1569.545] (-1568.593) -- 0:01:07
      117500 -- (-1568.918) (-1569.141) [-1568.896] (-1569.118) * [-1568.084] (-1570.650) (-1571.638) (-1568.354) -- 0:01:07
      118000 -- (-1568.858) (-1568.787) [-1573.058] (-1569.387) * (-1567.775) [-1570.427] (-1571.143) (-1571.837) -- 0:01:07
      118500 -- [-1570.394] (-1569.948) (-1569.596) (-1567.861) * (-1569.735) [-1568.032] (-1572.570) (-1570.745) -- 0:01:06
      119000 -- (-1570.257) [-1568.407] (-1573.412) (-1568.021) * [-1572.891] (-1565.645) (-1569.572) (-1570.411) -- 0:01:06
      119500 -- (-1569.579) (-1569.347) [-1568.238] (-1568.061) * (-1571.148) (-1570.599) [-1573.346] (-1570.851) -- 0:01:06
      120000 -- (-1569.470) (-1568.117) (-1575.807) [-1567.816] * (-1567.872) [-1569.030] (-1570.711) (-1571.269) -- 0:01:06

      Average standard deviation of split frequencies: 0.052089

      120500 -- (-1568.775) (-1569.005) [-1568.314] (-1568.012) * [-1567.860] (-1565.960) (-1566.939) (-1572.344) -- 0:01:05
      121000 -- [-1568.791] (-1567.974) (-1579.127) (-1567.265) * [-1568.956] (-1569.458) (-1569.389) (-1567.937) -- 0:01:05
      121500 -- (-1567.962) (-1569.062) (-1573.577) [-1567.129] * [-1569.898] (-1569.095) (-1569.728) (-1569.198) -- 0:01:05
      122000 -- (-1567.989) (-1570.182) [-1569.693] (-1572.408) * (-1569.514) (-1569.166) [-1570.497] (-1568.213) -- 0:01:04
      122500 -- (-1568.341) (-1570.163) [-1572.459] (-1573.868) * [-1568.321] (-1568.390) (-1568.447) (-1568.622) -- 0:01:04
      123000 -- [-1570.050] (-1570.895) (-1571.990) (-1571.335) * (-1568.294) (-1568.574) [-1568.740] (-1568.576) -- 0:01:04
      123500 -- (-1570.623) (-1571.348) [-1567.261] (-1571.705) * (-1568.558) (-1574.550) (-1569.774) [-1571.033] -- 0:01:03
      124000 -- (-1571.092) (-1569.970) [-1565.582] (-1574.241) * (-1572.317) (-1574.182) [-1568.481] (-1569.371) -- 0:01:03
      124500 -- (-1568.794) (-1567.865) [-1569.076] (-1569.215) * (-1573.307) (-1569.510) (-1570.010) [-1570.774] -- 0:01:03
      125000 -- (-1572.515) (-1571.887) [-1569.225] (-1571.180) * [-1567.670] (-1568.758) (-1570.078) (-1571.612) -- 0:01:03

      Average standard deviation of split frequencies: 0.052170

      125500 -- [-1571.675] (-1569.293) (-1568.536) (-1567.751) * [-1570.363] (-1569.486) (-1569.108) (-1568.322) -- 0:01:02
      126000 -- (-1569.324) [-1570.132] (-1573.259) (-1570.727) * [-1565.760] (-1567.663) (-1569.698) (-1570.249) -- 0:01:02
      126500 -- [-1569.926] (-1565.943) (-1568.343) (-1569.788) * (-1572.248) (-1569.863) [-1569.996] (-1568.790) -- 0:01:02
      127000 -- (-1568.333) [-1571.134] (-1570.409) (-1568.523) * (-1568.948) (-1568.737) (-1570.842) [-1571.270] -- 0:01:01
      127500 -- (-1571.019) (-1568.140) (-1572.022) [-1569.777] * (-1569.813) (-1568.769) (-1568.799) [-1568.229] -- 0:01:01
      128000 -- (-1571.146) [-1567.087] (-1572.595) (-1569.604) * (-1568.131) (-1572.377) (-1570.119) [-1569.550] -- 0:01:01
      128500 -- (-1572.943) [-1567.336] (-1571.274) (-1569.977) * (-1568.342) (-1570.508) [-1571.276] (-1569.599) -- 0:01:01
      129000 -- (-1573.418) [-1568.267] (-1574.099) (-1571.160) * [-1567.604] (-1568.583) (-1568.928) (-1570.024) -- 0:01:07
      129500 -- (-1573.203) [-1568.004] (-1570.532) (-1568.703) * [-1568.774] (-1568.484) (-1569.006) (-1569.305) -- 0:01:07
      130000 -- [-1571.563] (-1568.648) (-1568.443) (-1570.141) * [-1568.478] (-1571.042) (-1572.348) (-1568.061) -- 0:01:06

      Average standard deviation of split frequencies: 0.048704

      130500 -- (-1569.168) (-1570.360) (-1575.280) [-1570.291] * [-1569.752] (-1570.625) (-1570.077) (-1570.167) -- 0:01:06
      131000 -- (-1569.483) (-1567.347) [-1569.125] (-1573.815) * (-1571.723) (-1569.492) (-1572.449) [-1569.676] -- 0:01:06
      131500 -- (-1568.302) [-1567.069] (-1574.343) (-1570.975) * [-1567.541] (-1570.609) (-1572.945) (-1567.931) -- 0:01:06
      132000 -- (-1568.498) (-1572.227) [-1571.691] (-1570.336) * [-1568.705] (-1570.527) (-1568.928) (-1573.764) -- 0:01:05
      132500 -- (-1570.063) (-1567.346) [-1569.658] (-1570.199) * [-1569.896] (-1569.308) (-1570.777) (-1571.143) -- 0:01:05
      133000 -- (-1568.023) (-1573.187) [-1571.621] (-1568.673) * (-1567.834) (-1569.189) [-1565.762] (-1570.821) -- 0:01:05
      133500 -- [-1570.443] (-1569.662) (-1571.729) (-1569.112) * (-1570.522) (-1567.918) (-1573.337) [-1570.558] -- 0:01:04
      134000 -- (-1569.502) [-1570.268] (-1578.416) (-1568.680) * (-1569.437) [-1569.516] (-1572.370) (-1569.383) -- 0:01:04
      134500 -- (-1568.749) (-1573.569) (-1569.808) [-1567.633] * (-1570.588) (-1569.157) (-1569.448) [-1568.482] -- 0:01:04
      135000 -- (-1569.823) (-1568.083) [-1570.293] (-1572.480) * (-1568.105) (-1567.799) (-1567.583) [-1568.743] -- 0:01:04

      Average standard deviation of split frequencies: 0.047949

      135500 -- (-1569.691) (-1569.248) (-1574.898) [-1571.966] * (-1569.555) (-1569.380) [-1568.797] (-1569.027) -- 0:01:03
      136000 -- (-1572.135) (-1569.309) (-1571.855) [-1566.933] * [-1569.871] (-1570.806) (-1568.619) (-1569.010) -- 0:01:03
      136500 -- (-1570.966) (-1568.144) [-1569.647] (-1567.533) * (-1567.630) [-1568.885] (-1567.945) (-1569.573) -- 0:01:03
      137000 -- (-1570.429) (-1566.994) [-1573.231] (-1568.164) * [-1569.276] (-1567.538) (-1568.220) (-1569.288) -- 0:01:02
      137500 -- (-1568.947) (-1570.213) (-1574.424) [-1569.570] * (-1571.594) [-1566.872] (-1570.164) (-1569.354) -- 0:01:02
      138000 -- [-1568.180] (-1569.902) (-1570.778) (-1568.695) * (-1573.201) [-1569.962] (-1571.158) (-1572.133) -- 0:01:02
      138500 -- (-1568.637) [-1570.031] (-1577.195) (-1568.926) * [-1570.519] (-1568.954) (-1570.038) (-1573.506) -- 0:01:02
      139000 -- (-1571.982) (-1569.331) [-1568.331] (-1569.002) * (-1571.458) [-1568.475] (-1568.714) (-1571.008) -- 0:01:01
      139500 -- (-1572.061) (-1572.181) [-1567.803] (-1569.452) * (-1572.173) (-1568.579) [-1569.519] (-1570.279) -- 0:01:01
      140000 -- (-1570.001) (-1572.153) (-1572.820) [-1567.394] * (-1568.712) (-1568.462) (-1569.408) [-1572.004] -- 0:01:01

      Average standard deviation of split frequencies: 0.049524

      140500 -- (-1570.058) (-1571.923) (-1572.294) [-1569.432] * (-1570.879) (-1568.577) (-1570.620) [-1574.284] -- 0:01:01
      141000 -- (-1570.852) [-1570.033] (-1566.078) (-1568.712) * (-1570.931) (-1567.809) [-1570.132] (-1572.132) -- 0:01:00
      141500 -- (-1574.281) (-1568.717) [-1571.817] (-1568.058) * (-1567.725) (-1570.201) (-1570.599) [-1573.432] -- 0:01:00
      142000 -- (-1565.727) (-1572.124) [-1571.566] (-1570.811) * (-1568.564) (-1568.035) [-1568.740] (-1570.355) -- 0:01:00
      142500 -- (-1567.836) (-1572.857) [-1567.903] (-1573.008) * (-1566.396) (-1571.964) [-1570.613] (-1569.157) -- 0:01:00
      143000 -- (-1568.558) (-1572.148) (-1568.971) [-1570.012] * (-1569.377) (-1568.038) [-1569.497] (-1570.755) -- 0:00:59
      143500 -- (-1571.894) (-1573.941) [-1572.508] (-1570.395) * (-1568.003) [-1574.703] (-1568.526) (-1570.144) -- 0:01:05
      144000 -- (-1569.418) (-1569.301) [-1571.130] (-1568.766) * (-1573.794) (-1569.285) [-1569.090] (-1570.681) -- 0:01:05
      144500 -- [-1569.356] (-1571.080) (-1583.185) (-1568.343) * (-1572.098) (-1565.477) [-1570.427] (-1572.115) -- 0:01:05
      145000 -- [-1570.650] (-1568.121) (-1567.463) (-1571.801) * [-1568.618] (-1567.735) (-1567.929) (-1571.480) -- 0:01:04

      Average standard deviation of split frequencies: 0.046733

      145500 -- (-1573.048) (-1568.702) [-1569.339] (-1572.639) * (-1569.259) [-1570.029] (-1568.791) (-1570.955) -- 0:01:04
      146000 -- (-1575.627) (-1568.589) (-1578.668) [-1571.473] * (-1565.616) [-1566.814] (-1569.728) (-1568.122) -- 0:01:04
      146500 -- (-1571.006) (-1568.070) (-1575.877) [-1572.633] * (-1567.788) [-1566.905] (-1568.244) (-1568.593) -- 0:01:04
      147000 -- [-1568.814] (-1568.045) (-1569.729) (-1573.927) * (-1566.547) [-1565.610] (-1571.663) (-1568.982) -- 0:01:03
      147500 -- (-1568.408) (-1568.293) [-1573.460] (-1571.627) * (-1569.109) (-1567.405) (-1569.549) [-1568.380] -- 0:01:03
      148000 -- (-1569.628) (-1567.954) (-1571.210) [-1570.510] * (-1568.190) (-1569.527) (-1571.697) [-1568.374] -- 0:01:03
      148500 -- [-1567.111] (-1569.079) (-1567.692) (-1569.760) * (-1567.850) (-1568.958) (-1572.462) [-1567.899] -- 0:01:03
      149000 -- (-1572.077) (-1575.176) (-1568.845) [-1567.477] * (-1569.512) (-1573.008) [-1572.176] (-1567.374) -- 0:01:02
      149500 -- (-1570.228) (-1571.261) (-1569.297) [-1569.392] * (-1569.923) (-1567.415) (-1569.561) [-1570.347] -- 0:01:02
      150000 -- (-1568.227) (-1570.018) (-1570.249) [-1567.811] * (-1572.464) [-1569.231] (-1569.318) (-1568.636) -- 0:01:02

      Average standard deviation of split frequencies: 0.043803

      150500 -- (-1569.416) (-1567.833) [-1565.469] (-1568.201) * (-1569.246) (-1568.177) (-1570.134) [-1567.695] -- 0:01:02
      151000 -- (-1566.726) (-1567.661) [-1569.414] (-1569.581) * (-1567.785) (-1568.231) (-1570.904) [-1569.531] -- 0:01:01
      151500 -- (-1567.180) [-1568.184] (-1567.882) (-1573.204) * [-1566.042] (-1568.628) (-1568.097) (-1568.788) -- 0:01:01
      152000 -- [-1567.583] (-1569.186) (-1568.312) (-1567.460) * (-1569.956) [-1567.334] (-1569.459) (-1567.893) -- 0:01:01
      152500 -- (-1567.409) (-1568.506) (-1568.322) [-1567.487] * (-1568.971) [-1565.762] (-1567.990) (-1568.487) -- 0:01:01
      153000 -- [-1566.457] (-1568.432) (-1569.185) (-1570.421) * (-1568.360) (-1568.059) (-1568.980) [-1570.899] -- 0:01:00
      153500 -- (-1569.082) (-1569.352) (-1568.749) [-1570.138] * (-1568.908) [-1569.098] (-1572.052) (-1571.083) -- 0:01:00
      154000 -- (-1571.650) (-1568.319) (-1568.549) [-1569.532] * (-1570.674) (-1569.656) (-1569.324) [-1569.690] -- 0:01:00
      154500 -- (-1569.496) [-1570.350] (-1569.734) (-1568.210) * [-1568.011] (-1568.741) (-1568.932) (-1569.465) -- 0:01:00
      155000 -- (-1571.524) (-1570.895) (-1572.585) [-1569.593] * (-1568.217) (-1568.811) (-1569.183) [-1568.432] -- 0:00:59

      Average standard deviation of split frequencies: 0.045495

      155500 -- (-1569.170) [-1569.557] (-1575.825) (-1567.093) * (-1568.481) (-1569.337) [-1567.762] (-1568.475) -- 0:00:59
      156000 -- (-1569.335) (-1569.656) (-1568.634) [-1569.733] * (-1567.563) [-1569.120] (-1568.204) (-1568.596) -- 0:00:59
      156500 -- (-1568.244) (-1570.887) (-1568.405) [-1569.395] * [-1567.945] (-1569.321) (-1570.809) (-1569.368) -- 0:00:59
      157000 -- (-1568.424) (-1572.915) [-1569.663] (-1569.702) * (-1569.966) [-1569.402] (-1569.205) (-1569.162) -- 0:00:59
      157500 -- (-1568.866) [-1567.628] (-1570.334) (-1570.153) * (-1572.072) (-1568.149) [-1567.947] (-1570.156) -- 0:00:58
      158000 -- [-1568.493] (-1570.016) (-1570.574) (-1568.761) * (-1572.052) (-1571.494) [-1568.978] (-1568.234) -- 0:01:03
      158500 -- (-1570.957) (-1568.561) (-1575.931) [-1565.944] * (-1567.309) (-1569.863) [-1568.399] (-1571.281) -- 0:01:03
      159000 -- (-1569.005) [-1568.136] (-1571.945) (-1573.478) * (-1566.612) (-1570.711) [-1566.310] (-1569.442) -- 0:01:03
      159500 -- [-1568.546] (-1567.997) (-1568.762) (-1573.311) * (-1567.583) (-1570.190) [-1567.552] (-1571.043) -- 0:01:03
      160000 -- (-1568.549) [-1568.127] (-1567.043) (-1570.835) * (-1567.545) (-1570.299) [-1566.672] (-1568.655) -- 0:01:02

      Average standard deviation of split frequencies: 0.042218

      160500 -- (-1567.827) (-1570.406) (-1568.996) [-1569.438] * [-1566.224] (-1571.986) (-1568.434) (-1570.530) -- 0:01:02
      161000 -- (-1570.822) (-1570.341) (-1568.302) [-1565.015] * (-1569.442) (-1579.516) (-1567.675) [-1567.103] -- 0:01:02
      161500 -- (-1578.093) [-1568.170] (-1567.944) (-1571.605) * (-1572.601) (-1572.696) [-1568.097] (-1570.003) -- 0:01:02
      162000 -- (-1568.891) (-1568.713) [-1570.366] (-1572.501) * (-1568.805) (-1568.404) (-1568.188) [-1566.302] -- 0:01:02
      162500 -- [-1566.947] (-1571.449) (-1567.244) (-1572.295) * (-1568.134) (-1568.119) (-1569.051) [-1568.122] -- 0:01:01
      163000 -- [-1569.324] (-1572.658) (-1568.694) (-1567.835) * (-1571.472) (-1568.119) (-1572.030) [-1566.260] -- 0:01:01
      163500 -- (-1570.812) (-1570.692) [-1570.059] (-1571.444) * (-1566.058) (-1570.484) (-1569.907) [-1568.607] -- 0:01:01
      164000 -- [-1570.479] (-1578.032) (-1570.676) (-1571.247) * (-1573.619) [-1567.704] (-1568.916) (-1567.809) -- 0:01:01
      164500 -- (-1568.833) [-1572.743] (-1569.752) (-1568.268) * (-1570.079) (-1567.823) (-1570.063) [-1568.790] -- 0:01:00
      165000 -- (-1567.773) [-1571.446] (-1569.962) (-1566.708) * (-1571.693) [-1570.349] (-1569.321) (-1569.368) -- 0:01:00

      Average standard deviation of split frequencies: 0.042597

      165500 -- (-1572.514) [-1569.584] (-1571.912) (-1571.549) * [-1568.693] (-1570.399) (-1568.613) (-1569.833) -- 0:01:00
      166000 -- (-1575.878) (-1570.121) (-1568.967) [-1569.268] * [-1571.470] (-1571.548) (-1569.184) (-1574.129) -- 0:01:00
      166500 -- [-1569.085] (-1570.538) (-1569.616) (-1572.369) * (-1569.580) (-1569.025) [-1571.331] (-1569.264) -- 0:01:00
      167000 -- [-1568.791] (-1570.716) (-1569.557) (-1566.652) * [-1568.658] (-1568.736) (-1568.670) (-1569.025) -- 0:00:59
      167500 -- (-1570.237) (-1570.462) (-1569.322) [-1569.380] * (-1569.378) (-1568.892) [-1567.702] (-1568.116) -- 0:00:59
      168000 -- (-1569.446) [-1568.621] (-1569.804) (-1572.256) * (-1572.219) [-1567.898] (-1568.270) (-1567.173) -- 0:00:59
      168500 -- [-1569.316] (-1568.709) (-1569.022) (-1570.413) * (-1569.678) [-1567.594] (-1567.980) (-1568.331) -- 0:00:59
      169000 -- (-1570.783) (-1570.363) [-1570.822] (-1573.531) * [-1573.195] (-1569.811) (-1570.609) (-1569.648) -- 0:00:59
      169500 -- [-1568.693] (-1571.176) (-1570.883) (-1567.105) * (-1571.780) (-1571.118) [-1568.140] (-1571.385) -- 0:00:58
      170000 -- (-1571.494) (-1568.148) [-1568.247] (-1569.310) * (-1571.260) (-1568.633) [-1567.650] (-1568.123) -- 0:00:58

      Average standard deviation of split frequencies: 0.042967

      170500 -- (-1570.789) (-1568.089) (-1568.268) [-1567.888] * [-1570.588] (-1569.430) (-1567.699) (-1569.930) -- 0:00:58
      171000 -- (-1566.560) (-1570.636) (-1570.143) [-1568.210] * (-1568.308) (-1570.405) [-1573.453] (-1570.161) -- 0:00:58
      171500 -- [-1569.634] (-1570.576) (-1568.589) (-1568.768) * [-1568.013] (-1569.271) (-1569.749) (-1569.471) -- 0:00:57
      172000 -- (-1568.690) (-1569.030) [-1568.445] (-1570.049) * (-1570.541) (-1568.526) [-1568.427] (-1574.403) -- 0:00:57
      172500 -- [-1567.252] (-1569.091) (-1568.467) (-1568.092) * (-1569.686) (-1568.525) (-1571.255) [-1569.753] -- 0:01:02
      173000 -- (-1569.169) (-1568.072) (-1568.575) [-1567.790] * (-1569.773) [-1568.645] (-1571.573) (-1569.406) -- 0:01:02
      173500 -- [-1568.747] (-1568.268) (-1568.079) (-1568.740) * (-1569.736) (-1566.348) (-1571.535) [-1569.667] -- 0:01:01
      174000 -- (-1570.214) [-1569.659] (-1569.581) (-1567.112) * (-1571.483) [-1568.399] (-1570.817) (-1570.412) -- 0:01:01
      174500 -- [-1568.783] (-1568.239) (-1570.720) (-1567.865) * (-1571.817) (-1567.995) [-1569.906] (-1568.233) -- 0:01:01
      175000 -- (-1568.860) (-1572.325) [-1569.855] (-1567.964) * (-1568.993) (-1571.668) [-1569.147] (-1572.377) -- 0:01:01

      Average standard deviation of split frequencies: 0.039581

      175500 -- (-1572.539) (-1572.536) [-1567.893] (-1568.856) * (-1570.510) [-1568.603] (-1568.697) (-1570.311) -- 0:01:01
      176000 -- (-1570.497) (-1569.895) (-1572.641) [-1571.408] * [-1570.066] (-1569.495) (-1575.444) (-1568.845) -- 0:01:00
      176500 -- (-1568.273) (-1568.876) [-1567.249] (-1568.629) * [-1569.963] (-1569.006) (-1571.763) (-1569.364) -- 0:01:00
      177000 -- (-1568.809) (-1570.004) [-1571.393] (-1568.851) * (-1570.947) (-1569.916) [-1570.463] (-1567.934) -- 0:01:00
      177500 -- (-1569.218) (-1569.678) [-1568.147] (-1567.800) * [-1569.651] (-1570.691) (-1570.109) (-1568.418) -- 0:01:00
      178000 -- (-1569.151) (-1570.168) [-1568.240] (-1570.373) * [-1567.677] (-1568.812) (-1572.927) (-1569.619) -- 0:01:00
      178500 -- [-1574.276] (-1571.302) (-1572.068) (-1568.799) * (-1568.379) (-1570.285) (-1570.059) [-1567.945] -- 0:00:59
      179000 -- [-1570.529] (-1569.106) (-1570.015) (-1571.032) * (-1570.951) (-1569.996) (-1567.898) [-1568.535] -- 0:00:59
      179500 -- (-1574.243) [-1571.567] (-1568.484) (-1574.752) * [-1567.944] (-1568.050) (-1571.327) (-1568.731) -- 0:00:59
      180000 -- (-1569.287) (-1570.200) [-1568.796] (-1570.511) * [-1565.536] (-1569.027) (-1568.411) (-1569.279) -- 0:00:59

      Average standard deviation of split frequencies: 0.039574

      180500 -- (-1568.190) (-1575.060) [-1567.079] (-1567.844) * (-1568.225) (-1567.907) [-1568.867] (-1569.418) -- 0:00:59
      181000 -- [-1568.968] (-1568.636) (-1570.368) (-1570.722) * [-1568.178] (-1567.771) (-1568.589) (-1572.257) -- 0:00:58
      181500 -- [-1567.377] (-1569.712) (-1572.322) (-1569.589) * (-1569.359) (-1570.690) (-1570.283) [-1570.925] -- 0:00:58
      182000 -- (-1567.403) (-1569.792) [-1570.053] (-1573.326) * (-1567.946) [-1570.673] (-1569.448) (-1568.991) -- 0:00:58
      182500 -- [-1567.223] (-1568.996) (-1570.068) (-1572.737) * (-1567.735) [-1569.771] (-1569.504) (-1568.447) -- 0:00:58
      183000 -- (-1568.158) [-1571.221] (-1569.241) (-1573.070) * (-1571.898) (-1571.982) [-1568.785] (-1569.817) -- 0:00:58
      183500 -- (-1567.649) (-1574.235) [-1569.480] (-1568.285) * (-1567.980) [-1572.389] (-1569.815) (-1569.219) -- 0:00:57
      184000 -- [-1567.570] (-1573.942) (-1573.024) (-1567.946) * (-1571.183) [-1572.266] (-1568.689) (-1569.649) -- 0:00:57
      184500 -- (-1573.384) [-1568.730] (-1569.501) (-1568.463) * [-1568.709] (-1570.907) (-1573.395) (-1569.499) -- 0:00:57
      185000 -- [-1572.684] (-1568.959) (-1572.883) (-1567.648) * [-1569.400] (-1572.283) (-1569.178) (-1568.265) -- 0:00:57

      Average standard deviation of split frequencies: 0.039847

      185500 -- (-1567.493) (-1571.664) (-1569.192) [-1570.170] * (-1569.077) (-1570.941) [-1568.292] (-1568.349) -- 0:00:57
      186000 -- (-1567.126) (-1568.409) [-1569.620] (-1571.712) * (-1567.645) (-1569.399) (-1569.078) [-1570.182] -- 0:00:56
      186500 -- (-1566.113) [-1568.950] (-1571.251) (-1568.840) * (-1567.051) (-1570.458) [-1571.683] (-1569.387) -- 0:00:56
      187000 -- (-1571.354) [-1569.046] (-1569.624) (-1569.880) * (-1566.145) [-1569.618] (-1568.899) (-1569.661) -- 0:01:00
      187500 -- (-1568.352) [-1566.364] (-1569.728) (-1569.201) * [-1568.731] (-1569.372) (-1570.832) (-1568.584) -- 0:01:00
      188000 -- [-1570.566] (-1566.987) (-1571.039) (-1571.272) * (-1573.797) (-1570.843) (-1570.913) [-1569.770] -- 0:01:00
      188500 -- [-1570.735] (-1567.648) (-1569.072) (-1569.025) * (-1571.061) (-1569.842) [-1570.234] (-1568.273) -- 0:01:00
      189000 -- (-1568.464) (-1571.118) [-1569.779] (-1569.279) * (-1570.408) [-1570.087] (-1571.566) (-1569.589) -- 0:01:00
      189500 -- (-1569.655) (-1569.853) [-1568.630] (-1573.718) * (-1568.364) [-1568.743] (-1569.273) (-1569.012) -- 0:00:59
      190000 -- [-1568.301] (-1567.077) (-1574.324) (-1574.075) * (-1568.875) (-1568.932) [-1568.579] (-1568.086) -- 0:00:59

      Average standard deviation of split frequencies: 0.037086

      190500 -- [-1568.305] (-1570.426) (-1568.819) (-1575.998) * (-1568.585) (-1570.828) [-1568.767] (-1568.094) -- 0:00:59
      191000 -- [-1568.414] (-1573.234) (-1570.173) (-1571.717) * [-1568.391] (-1570.270) (-1569.316) (-1568.000) -- 0:00:59
      191500 -- (-1569.071) (-1571.963) [-1568.995] (-1574.005) * (-1569.576) (-1568.088) (-1569.605) [-1567.777] -- 0:00:59
      192000 -- [-1569.626] (-1567.503) (-1569.153) (-1574.581) * (-1569.428) [-1567.886] (-1569.904) (-1568.787) -- 0:00:58
      192500 -- (-1570.370) (-1575.777) (-1570.599) [-1571.401] * [-1568.056] (-1573.294) (-1568.277) (-1568.906) -- 0:00:58
      193000 -- (-1568.665) (-1568.173) [-1569.217] (-1572.950) * (-1572.354) (-1569.519) (-1569.801) [-1567.914] -- 0:00:58
      193500 -- [-1568.063] (-1571.129) (-1570.305) (-1569.926) * (-1570.558) [-1568.554] (-1571.145) (-1568.661) -- 0:00:58
      194000 -- [-1566.859] (-1571.480) (-1568.916) (-1573.203) * (-1568.622) [-1568.546] (-1569.915) (-1569.970) -- 0:00:58
      194500 -- (-1568.615) (-1570.244) [-1569.713] (-1569.631) * (-1566.817) [-1569.372] (-1572.883) (-1568.123) -- 0:00:57
      195000 -- (-1569.367) [-1568.578] (-1571.202) (-1571.408) * (-1571.880) [-1568.651] (-1572.067) (-1568.715) -- 0:00:57

      Average standard deviation of split frequencies: 0.039150

      195500 -- [-1564.906] (-1568.843) (-1568.274) (-1572.687) * (-1569.418) (-1568.577) (-1573.656) [-1567.806] -- 0:00:57
      196000 -- (-1567.990) (-1572.160) (-1569.492) [-1568.469] * (-1571.075) [-1568.654] (-1571.203) (-1568.921) -- 0:00:57
      196500 -- [-1566.720] (-1570.884) (-1568.825) (-1570.671) * (-1570.171) [-1571.151] (-1570.783) (-1566.689) -- 0:00:57
      197000 -- (-1569.226) (-1568.357) (-1570.086) [-1568.610] * (-1571.716) (-1570.728) [-1568.171] (-1570.082) -- 0:00:57
      197500 -- (-1568.633) (-1568.880) [-1570.716] (-1569.862) * (-1570.368) [-1569.578] (-1568.329) (-1569.015) -- 0:00:56
      198000 -- [-1566.832] (-1569.017) (-1570.101) (-1570.311) * [-1568.137] (-1569.283) (-1567.747) (-1574.211) -- 0:00:56
      198500 -- (-1569.812) [-1569.228] (-1569.011) (-1574.032) * (-1568.724) (-1568.172) [-1565.961] (-1577.085) -- 0:00:56
      199000 -- [-1567.954] (-1569.489) (-1568.707) (-1573.627) * (-1580.042) [-1567.774] (-1570.812) (-1566.093) -- 0:00:56
      199500 -- (-1568.487) [-1571.590] (-1568.903) (-1572.311) * (-1570.210) (-1571.676) [-1568.979] (-1568.057) -- 0:00:56
      200000 -- (-1575.554) (-1573.261) [-1568.990] (-1568.507) * (-1569.600) (-1570.350) (-1569.428) [-1567.719] -- 0:00:55

      Average standard deviation of split frequencies: 0.037979

      200500 -- [-1568.340] (-1571.202) (-1568.935) (-1569.806) * (-1572.065) (-1571.162) [-1568.122] (-1570.147) -- 0:00:55
      201000 -- (-1569.926) [-1570.288] (-1567.952) (-1569.608) * (-1572.537) [-1568.497] (-1570.960) (-1566.698) -- 0:00:55
      201500 -- (-1568.549) (-1568.868) [-1568.617] (-1569.418) * (-1574.943) (-1568.774) (-1568.498) [-1569.665] -- 0:00:55
      202000 -- [-1568.346] (-1569.313) (-1568.763) (-1569.013) * (-1574.128) (-1575.444) (-1567.076) [-1567.592] -- 0:00:59
      202500 -- (-1568.239) [-1568.572] (-1569.903) (-1568.694) * [-1566.963] (-1572.410) (-1567.049) (-1567.533) -- 0:00:59
      203000 -- (-1570.068) (-1569.746) (-1568.635) [-1568.366] * (-1569.926) (-1571.271) (-1568.417) [-1569.523] -- 0:00:58
      203500 -- (-1570.683) (-1568.971) (-1572.262) [-1568.322] * [-1568.219] (-1568.578) (-1570.632) (-1568.112) -- 0:00:58
      204000 -- (-1567.454) [-1570.030] (-1569.228) (-1568.899) * (-1568.194) (-1572.359) (-1569.952) [-1568.722] -- 0:00:58
      204500 -- (-1567.616) (-1572.078) [-1570.484] (-1568.499) * (-1565.834) (-1568.750) [-1569.361] (-1566.519) -- 0:00:58
      205000 -- (-1566.372) [-1571.731] (-1568.842) (-1568.681) * (-1569.040) [-1568.790] (-1571.104) (-1565.987) -- 0:00:58

      Average standard deviation of split frequencies: 0.036233

      205500 -- (-1567.312) (-1571.349) (-1568.306) [-1569.814] * (-1568.603) [-1570.767] (-1567.736) (-1569.162) -- 0:00:57
      206000 -- [-1568.256] (-1568.413) (-1568.069) (-1569.039) * (-1567.709) [-1569.394] (-1567.998) (-1567.444) -- 0:00:57
      206500 -- [-1568.127] (-1571.045) (-1568.674) (-1571.166) * [-1568.048] (-1569.621) (-1567.101) (-1567.357) -- 0:00:57
      207000 -- [-1571.252] (-1569.025) (-1572.962) (-1570.760) * (-1570.041) (-1571.049) (-1569.414) [-1570.750] -- 0:00:57
      207500 -- (-1569.515) (-1571.266) (-1571.548) [-1569.069] * (-1568.495) (-1568.115) (-1570.587) [-1570.630] -- 0:00:57
      208000 -- (-1569.577) (-1569.436) [-1570.051] (-1572.180) * (-1568.981) (-1566.945) [-1570.139] (-1571.633) -- 0:00:57
      208500 -- (-1571.822) (-1569.980) [-1569.150] (-1568.884) * (-1571.605) (-1572.452) [-1567.361] (-1569.484) -- 0:00:56
      209000 -- (-1568.347) [-1569.845] (-1574.115) (-1570.345) * (-1567.904) (-1571.520) (-1570.145) [-1567.833] -- 0:00:56
      209500 -- (-1569.299) (-1569.661) [-1571.227] (-1569.246) * (-1569.533) [-1566.721] (-1569.353) (-1569.367) -- 0:00:56
      210000 -- (-1567.062) [-1570.959] (-1573.250) (-1570.474) * (-1567.978) [-1570.325] (-1567.631) (-1569.106) -- 0:00:56

      Average standard deviation of split frequencies: 0.034311

      210500 -- (-1568.724) (-1568.578) (-1574.623) [-1568.002] * (-1569.528) [-1568.897] (-1568.122) (-1572.707) -- 0:00:56
      211000 -- (-1567.756) (-1566.624) [-1572.552] (-1568.771) * (-1567.054) (-1569.010) [-1567.919] (-1568.040) -- 0:00:56
      211500 -- (-1573.121) [-1570.397] (-1572.637) (-1567.877) * (-1569.498) [-1568.306] (-1568.253) (-1568.783) -- 0:00:55
      212000 -- (-1567.850) (-1568.017) [-1570.963] (-1568.792) * (-1569.562) (-1569.274) [-1569.961] (-1568.663) -- 0:00:55
      212500 -- (-1577.137) (-1571.542) [-1568.183] (-1570.847) * (-1568.093) (-1568.171) [-1573.078] (-1567.129) -- 0:00:55
      213000 -- [-1573.170] (-1572.283) (-1568.506) (-1569.949) * (-1570.961) [-1568.813] (-1569.577) (-1570.387) -- 0:00:55
      213500 -- (-1567.793) (-1569.900) [-1568.967] (-1570.170) * (-1571.035) [-1568.644] (-1573.387) (-1569.536) -- 0:00:55
      214000 -- (-1569.171) [-1575.850] (-1570.223) (-1571.439) * (-1568.065) [-1568.097] (-1569.326) (-1566.652) -- 0:00:55
      214500 -- (-1570.326) [-1571.007] (-1570.769) (-1569.453) * (-1569.468) (-1572.028) [-1571.710] (-1567.142) -- 0:00:54
      215000 -- (-1569.468) (-1571.243) [-1568.930] (-1568.449) * (-1572.082) (-1570.279) [-1568.402] (-1565.502) -- 0:00:54

      Average standard deviation of split frequencies: 0.032858

      215500 -- (-1570.662) (-1570.251) (-1571.324) [-1572.353] * [-1569.368] (-1570.118) (-1569.174) (-1570.446) -- 0:00:54
      216000 -- (-1570.175) (-1569.093) (-1568.519) [-1568.893] * (-1569.559) (-1569.751) (-1569.379) [-1566.383] -- 0:00:54
      216500 -- (-1571.890) (-1567.071) (-1569.372) [-1568.107] * (-1569.369) (-1567.620) (-1571.476) [-1566.284] -- 0:00:57
      217000 -- (-1567.905) (-1568.325) (-1570.646) [-1569.490] * (-1569.379) [-1568.268] (-1570.354) (-1568.991) -- 0:00:57
      217500 -- (-1566.848) (-1566.364) (-1568.311) [-1568.953] * (-1570.211) (-1569.767) [-1568.729] (-1571.678) -- 0:00:57
      218000 -- [-1571.252] (-1571.476) (-1572.052) (-1569.037) * (-1571.521) (-1569.177) [-1568.665] (-1572.136) -- 0:00:57
      218500 -- (-1572.664) [-1570.575] (-1569.992) (-1568.179) * [-1569.176] (-1569.325) (-1570.888) (-1581.232) -- 0:00:57
      219000 -- (-1572.506) (-1571.964) [-1568.562] (-1568.754) * (-1568.961) (-1573.748) (-1570.615) [-1568.120] -- 0:00:57
      219500 -- [-1569.726] (-1568.163) (-1568.271) (-1568.778) * (-1568.672) [-1568.354] (-1570.365) (-1570.748) -- 0:00:56
      220000 -- (-1569.812) (-1570.145) (-1570.988) [-1568.730] * (-1568.725) [-1568.752] (-1570.017) (-1569.304) -- 0:00:56

      Average standard deviation of split frequencies: 0.032044

      220500 -- (-1569.541) [-1566.679] (-1569.442) (-1568.817) * [-1567.956] (-1569.094) (-1572.353) (-1570.814) -- 0:00:56
      221000 -- [-1572.913] (-1569.127) (-1571.470) (-1570.598) * [-1571.745] (-1570.611) (-1572.414) (-1568.178) -- 0:00:56
      221500 -- (-1571.107) [-1569.004] (-1573.841) (-1570.883) * (-1567.970) (-1571.589) (-1571.535) [-1569.593] -- 0:00:56
      222000 -- (-1575.503) (-1571.535) [-1570.109] (-1566.018) * [-1567.994] (-1571.881) (-1569.855) (-1569.432) -- 0:00:56
      222500 -- (-1570.782) [-1568.102] (-1570.052) (-1568.764) * [-1568.437] (-1576.348) (-1571.270) (-1569.236) -- 0:00:55
      223000 -- (-1567.857) (-1568.492) (-1571.001) [-1567.752] * (-1568.685) (-1575.466) (-1570.624) [-1573.007] -- 0:00:55
      223500 -- (-1571.886) (-1569.249) (-1569.825) [-1566.697] * [-1569.088] (-1568.924) (-1570.489) (-1574.237) -- 0:00:55
      224000 -- (-1565.448) [-1568.506] (-1568.563) (-1569.455) * (-1570.062) (-1568.105) [-1570.876] (-1572.874) -- 0:00:55
      224500 -- (-1569.551) [-1568.555] (-1570.050) (-1568.535) * (-1572.118) (-1569.198) (-1570.711) [-1569.319] -- 0:00:55
      225000 -- [-1567.293] (-1568.193) (-1570.293) (-1568.619) * (-1568.677) (-1569.381) (-1571.373) [-1569.374] -- 0:00:55

      Average standard deviation of split frequencies: 0.031867

      225500 -- [-1566.037] (-1568.845) (-1569.874) (-1570.489) * (-1569.834) (-1570.407) [-1570.341] (-1569.057) -- 0:00:54
      226000 -- (-1567.798) (-1567.142) (-1571.656) [-1570.398] * (-1570.768) (-1567.151) [-1569.271] (-1571.202) -- 0:00:54
      226500 -- (-1571.316) [-1571.230] (-1569.568) (-1570.558) * [-1574.610] (-1567.853) (-1569.020) (-1572.335) -- 0:00:54
      227000 -- (-1567.342) (-1570.070) (-1568.013) [-1571.683] * [-1572.301] (-1568.699) (-1569.837) (-1568.919) -- 0:00:54
      227500 -- [-1567.698] (-1574.754) (-1571.984) (-1570.620) * (-1568.380) [-1568.024] (-1571.253) (-1570.345) -- 0:00:54
      228000 -- (-1567.836) [-1571.470] (-1569.735) (-1571.815) * (-1568.855) (-1567.877) (-1569.263) [-1569.650] -- 0:00:54
      228500 -- (-1567.940) (-1570.172) [-1569.706] (-1570.923) * (-1567.394) (-1568.426) [-1571.152] (-1568.325) -- 0:00:54
      229000 -- [-1568.866] (-1569.431) (-1568.215) (-1573.233) * [-1568.757] (-1568.029) (-1568.854) (-1570.120) -- 0:00:53
      229500 -- [-1569.072] (-1571.346) (-1567.608) (-1571.933) * [-1566.057] (-1568.297) (-1571.322) (-1568.441) -- 0:00:53
      230000 -- (-1569.226) (-1569.465) (-1572.015) [-1568.992] * [-1572.352] (-1569.703) (-1574.525) (-1569.524) -- 0:00:53

      Average standard deviation of split frequencies: 0.030201

      230500 -- (-1568.096) (-1568.236) (-1568.294) [-1568.921] * (-1571.537) (-1572.938) (-1567.997) [-1568.082] -- 0:00:53
      231000 -- (-1567.969) [-1570.085] (-1571.331) (-1568.215) * (-1570.987) [-1567.779] (-1567.602) (-1568.224) -- 0:00:56
      231500 -- [-1567.060] (-1569.588) (-1574.100) (-1569.886) * (-1569.408) [-1567.713] (-1567.294) (-1567.091) -- 0:00:56
      232000 -- (-1567.847) (-1572.538) [-1573.538] (-1566.191) * [-1568.707] (-1566.472) (-1569.466) (-1568.484) -- 0:00:56
      232500 -- [-1567.408] (-1572.160) (-1571.498) (-1567.214) * [-1567.852] (-1568.991) (-1568.771) (-1568.955) -- 0:00:56
      233000 -- (-1568.671) (-1567.928) (-1570.081) [-1569.038] * [-1568.900] (-1567.280) (-1572.440) (-1568.947) -- 0:00:55
      233500 -- [-1572.996] (-1568.752) (-1569.104) (-1579.029) * (-1572.447) [-1567.769] (-1571.714) (-1568.219) -- 0:00:55
      234000 -- (-1568.178) [-1569.033] (-1570.139) (-1568.850) * (-1570.540) [-1564.956] (-1570.451) (-1569.603) -- 0:00:55
      234500 -- (-1567.020) [-1570.691] (-1567.551) (-1566.727) * [-1568.087] (-1565.723) (-1571.038) (-1568.627) -- 0:00:55
      235000 -- (-1568.579) (-1569.796) (-1567.704) [-1568.430] * (-1570.861) (-1566.279) [-1568.359] (-1568.441) -- 0:00:55

      Average standard deviation of split frequencies: 0.028298

      235500 -- (-1569.734) (-1570.928) (-1566.620) [-1569.748] * (-1567.189) (-1572.180) [-1567.143] (-1568.941) -- 0:00:55
      236000 -- (-1568.972) (-1571.370) (-1568.359) [-1566.651] * (-1571.960) [-1568.687] (-1568.868) (-1570.926) -- 0:00:55
      236500 -- [-1568.250] (-1571.176) (-1569.138) (-1568.718) * (-1570.366) [-1570.088] (-1567.298) (-1571.010) -- 0:00:54
      237000 -- (-1569.354) [-1570.068] (-1574.058) (-1570.143) * (-1569.619) [-1568.849] (-1568.173) (-1568.882) -- 0:00:54
      237500 -- (-1569.077) (-1569.051) [-1570.799] (-1569.505) * (-1569.838) (-1569.969) (-1569.224) [-1568.310] -- 0:00:54
      238000 -- (-1572.613) (-1568.171) [-1567.179] (-1571.365) * [-1571.618] (-1569.695) (-1570.248) (-1570.216) -- 0:00:54
      238500 -- (-1572.530) (-1568.375) (-1569.012) [-1569.118] * [-1567.193] (-1569.038) (-1568.460) (-1572.205) -- 0:00:54
      239000 -- (-1569.226) (-1568.347) (-1568.130) [-1570.220] * (-1568.578) [-1571.072] (-1570.457) (-1570.121) -- 0:00:54
      239500 -- [-1569.380] (-1569.594) (-1567.797) (-1577.313) * (-1566.725) (-1568.445) (-1568.942) [-1570.102] -- 0:00:53
      240000 -- (-1573.090) [-1569.514] (-1572.439) (-1575.869) * (-1568.357) (-1567.265) [-1569.087] (-1566.892) -- 0:00:53

      Average standard deviation of split frequencies: 0.026987

      240500 -- [-1567.181] (-1571.357) (-1566.913) (-1572.710) * (-1565.797) (-1569.554) (-1570.506) [-1570.915] -- 0:00:53
      241000 -- [-1568.772] (-1570.309) (-1570.985) (-1569.198) * (-1568.494) (-1569.268) (-1569.017) [-1567.437] -- 0:00:53
      241500 -- (-1569.195) [-1567.286] (-1569.971) (-1567.365) * (-1567.781) (-1569.711) [-1571.578] (-1568.263) -- 0:00:53
      242000 -- (-1567.769) (-1569.499) [-1566.106] (-1568.013) * (-1568.511) (-1567.848) (-1568.876) [-1569.026] -- 0:00:53
      242500 -- (-1568.461) (-1569.061) (-1569.917) [-1567.545] * (-1569.064) (-1570.616) (-1568.499) [-1567.500] -- 0:00:53
      243000 -- (-1571.516) (-1568.017) (-1567.556) [-1567.803] * (-1568.930) (-1568.289) (-1568.749) [-1570.069] -- 0:00:52
      243500 -- (-1567.792) (-1570.594) [-1567.944] (-1567.958) * (-1570.674) (-1571.356) [-1572.580] (-1569.431) -- 0:00:52
      244000 -- (-1567.510) (-1569.152) (-1567.353) [-1569.061] * [-1571.080] (-1570.419) (-1573.580) (-1568.374) -- 0:00:52
      244500 -- (-1571.114) (-1569.321) (-1573.671) [-1568.052] * [-1568.749] (-1568.304) (-1569.668) (-1568.484) -- 0:00:52
      245000 -- (-1568.128) (-1568.862) [-1569.833] (-1569.703) * (-1567.960) [-1567.578] (-1571.253) (-1567.565) -- 0:00:52

      Average standard deviation of split frequencies: 0.026615

      245500 -- (-1568.205) [-1567.600] (-1568.125) (-1569.432) * [-1568.020] (-1568.416) (-1572.050) (-1566.670) -- 0:00:55
      246000 -- (-1569.134) [-1568.973] (-1567.661) (-1568.554) * (-1569.531) [-1570.122] (-1570.745) (-1568.004) -- 0:00:55
      246500 -- (-1571.851) (-1568.306) [-1568.650] (-1569.400) * (-1570.358) (-1570.746) [-1569.114] (-1571.804) -- 0:00:55
      247000 -- (-1569.555) (-1570.747) [-1570.475] (-1566.797) * (-1568.833) (-1568.683) (-1569.515) [-1570.680] -- 0:00:54
      247500 -- [-1569.187] (-1571.575) (-1570.556) (-1568.136) * (-1568.774) (-1568.185) (-1572.306) [-1572.442] -- 0:00:54
      248000 -- (-1568.573) [-1570.613] (-1569.962) (-1569.650) * (-1568.537) (-1568.312) (-1572.677) [-1568.690] -- 0:00:54
      248500 -- (-1574.582) (-1568.075) (-1568.841) [-1568.901] * (-1569.472) (-1565.658) (-1568.781) [-1568.992] -- 0:00:54
      249000 -- (-1572.362) (-1576.050) (-1571.347) [-1568.439] * (-1568.601) [-1569.347] (-1567.913) (-1567.741) -- 0:00:54
      249500 -- (-1570.233) (-1569.626) [-1570.463] (-1570.234) * (-1568.272) [-1567.451] (-1569.481) (-1567.213) -- 0:00:54
      250000 -- (-1569.002) [-1569.194] (-1572.103) (-1570.895) * [-1568.627] (-1570.772) (-1569.015) (-1568.235) -- 0:00:54

      Average standard deviation of split frequencies: 0.025806

      250500 -- (-1569.374) (-1567.417) (-1568.550) [-1569.119] * (-1570.226) (-1569.765) [-1568.141] (-1567.011) -- 0:00:53
      251000 -- (-1568.625) (-1568.588) [-1569.475] (-1569.483) * [-1568.148] (-1569.568) (-1570.777) (-1570.485) -- 0:00:53
      251500 -- (-1569.616) (-1569.266) (-1570.920) [-1571.351] * (-1571.498) (-1569.165) [-1569.563] (-1570.569) -- 0:00:53
      252000 -- (-1570.320) (-1568.611) (-1568.411) [-1569.123] * (-1568.306) [-1568.806] (-1569.376) (-1569.457) -- 0:00:53
      252500 -- (-1573.931) (-1568.133) [-1571.469] (-1570.559) * (-1568.200) [-1568.224] (-1569.341) (-1570.908) -- 0:00:53
      253000 -- (-1570.060) (-1566.731) (-1570.461) [-1568.840] * (-1565.364) [-1570.226] (-1570.007) (-1569.385) -- 0:00:53
      253500 -- (-1569.400) [-1568.754] (-1567.823) (-1571.628) * (-1568.012) (-1569.452) (-1570.771) [-1567.656] -- 0:00:53
      254000 -- (-1570.294) [-1569.985] (-1568.207) (-1568.802) * [-1567.722] (-1572.151) (-1571.207) (-1569.136) -- 0:00:52
      254500 -- (-1573.285) (-1571.759) [-1567.887] (-1568.737) * (-1569.590) [-1569.392] (-1569.058) (-1570.355) -- 0:00:52
      255000 -- [-1568.507] (-1568.717) (-1573.951) (-1566.720) * (-1568.830) [-1569.231] (-1570.662) (-1568.389) -- 0:00:52

      Average standard deviation of split frequencies: 0.026361

      255500 -- (-1568.041) (-1569.552) [-1568.632] (-1570.547) * (-1568.453) (-1567.921) [-1571.026] (-1569.062) -- 0:00:52
      256000 -- (-1571.175) [-1568.980] (-1567.922) (-1571.265) * [-1571.532] (-1568.026) (-1569.210) (-1572.394) -- 0:00:52
      256500 -- (-1568.757) [-1569.142] (-1571.665) (-1569.512) * (-1573.622) (-1567.793) [-1565.977] (-1569.309) -- 0:00:52
      257000 -- (-1569.231) [-1568.845] (-1569.240) (-1570.733) * [-1569.199] (-1568.624) (-1567.327) (-1567.382) -- 0:00:52
      257500 -- (-1568.664) (-1566.938) (-1568.868) [-1571.914] * (-1571.296) [-1568.466] (-1569.700) (-1569.198) -- 0:00:51
      258000 -- (-1567.934) [-1567.979] (-1567.824) (-1574.255) * (-1571.028) (-1568.438) (-1568.858) [-1568.481] -- 0:00:51
      258500 -- (-1569.030) (-1569.506) (-1568.438) [-1569.583] * (-1569.367) [-1569.728] (-1566.360) (-1568.684) -- 0:00:51
      259000 -- (-1564.576) (-1568.831) (-1569.121) [-1569.491] * (-1571.049) (-1569.393) [-1566.395] (-1568.555) -- 0:00:51
      259500 -- (-1571.365) (-1568.899) [-1569.677] (-1568.763) * (-1567.676) (-1571.239) [-1565.103] (-1569.661) -- 0:00:51
      260000 -- (-1568.047) (-1567.994) [-1568.575] (-1568.507) * (-1568.347) (-1569.212) (-1568.344) [-1569.273] -- 0:00:51

      Average standard deviation of split frequencies: 0.026122

      260500 -- (-1569.956) (-1571.922) [-1569.828] (-1574.525) * [-1569.341] (-1567.345) (-1568.259) (-1568.064) -- 0:00:53
      261000 -- (-1568.933) [-1569.934] (-1572.343) (-1569.117) * (-1569.084) (-1568.226) [-1569.438] (-1568.288) -- 0:00:53
      261500 -- [-1567.295] (-1571.381) (-1568.199) (-1571.353) * (-1567.447) (-1568.510) (-1568.209) [-1569.394] -- 0:00:53
      262000 -- (-1569.722) (-1570.828) (-1569.445) [-1569.042] * (-1574.719) (-1570.293) [-1569.715] (-1569.130) -- 0:00:53
      262500 -- (-1568.562) [-1571.955] (-1569.620) (-1568.943) * (-1567.748) (-1571.103) (-1569.408) [-1569.966] -- 0:00:53
      263000 -- (-1568.716) (-1569.798) (-1569.680) [-1568.172] * (-1572.192) (-1571.642) (-1568.657) [-1570.683] -- 0:00:53
      263500 -- [-1568.700] (-1569.022) (-1572.800) (-1566.938) * (-1570.684) (-1572.061) (-1571.326) [-1569.925] -- 0:00:53
      264000 -- (-1569.134) (-1575.411) (-1572.240) [-1569.064] * (-1569.407) [-1572.763] (-1569.225) (-1567.613) -- 0:00:52
      264500 -- (-1567.775) (-1569.924) (-1569.572) [-1569.717] * (-1567.755) (-1568.154) [-1568.099] (-1570.667) -- 0:00:52
      265000 -- (-1570.359) (-1568.768) (-1570.540) [-1568.887] * (-1567.962) (-1567.675) (-1569.197) [-1571.963] -- 0:00:52

      Average standard deviation of split frequencies: 0.025743

      265500 -- (-1568.670) (-1569.070) [-1570.393] (-1571.358) * [-1567.885] (-1567.874) (-1573.233) (-1566.620) -- 0:00:52
      266000 -- (-1576.213) [-1571.044] (-1568.309) (-1574.161) * (-1568.936) [-1567.496] (-1566.311) (-1567.090) -- 0:00:52
      266500 -- (-1569.937) (-1569.145) [-1568.529] (-1566.016) * (-1573.810) (-1568.150) (-1570.399) [-1569.046] -- 0:00:52
      267000 -- (-1571.792) (-1569.102) (-1570.211) [-1568.583] * (-1570.918) [-1568.988] (-1568.355) (-1572.428) -- 0:00:52
      267500 -- [-1566.472] (-1569.943) (-1569.373) (-1567.659) * (-1569.726) [-1569.083] (-1570.926) (-1571.731) -- 0:00:52
      268000 -- (-1570.338) [-1567.201] (-1572.481) (-1568.547) * (-1570.022) (-1568.083) [-1570.305] (-1568.723) -- 0:00:51
      268500 -- (-1572.580) (-1570.939) [-1567.980] (-1568.333) * (-1572.413) (-1569.252) [-1568.082] (-1568.790) -- 0:00:51
      269000 -- (-1571.346) [-1571.011] (-1566.173) (-1568.063) * (-1572.238) [-1569.238] (-1569.957) (-1568.789) -- 0:00:51
      269500 -- (-1567.951) (-1568.615) [-1566.724] (-1571.551) * (-1572.669) [-1569.772] (-1569.041) (-1569.086) -- 0:00:51
      270000 -- (-1569.226) [-1567.902] (-1573.337) (-1570.758) * (-1567.430) (-1570.442) (-1568.703) [-1566.309] -- 0:00:51

      Average standard deviation of split frequencies: 0.025116

      270500 -- (-1568.904) [-1567.418] (-1570.464) (-1567.838) * (-1569.968) (-1571.086) (-1570.302) [-1568.521] -- 0:00:51
      271000 -- [-1568.449] (-1570.475) (-1569.144) (-1572.580) * [-1571.244] (-1568.847) (-1570.979) (-1568.621) -- 0:00:51
      271500 -- (-1572.069) [-1566.563] (-1569.082) (-1568.216) * (-1570.067) (-1568.031) (-1569.649) [-1568.735] -- 0:00:50
      272000 -- (-1570.025) (-1566.852) [-1571.588] (-1573.052) * (-1569.895) [-1566.676] (-1568.437) (-1570.719) -- 0:00:50
      272500 -- (-1570.314) [-1570.004] (-1569.251) (-1573.335) * (-1570.328) [-1569.276] (-1573.613) (-1569.519) -- 0:00:50
      273000 -- (-1571.141) [-1568.010] (-1568.581) (-1569.605) * [-1570.638] (-1573.218) (-1570.689) (-1569.334) -- 0:00:50
      273500 -- (-1569.766) (-1571.588) (-1567.152) [-1569.087] * (-1569.113) (-1569.952) (-1570.988) [-1567.700] -- 0:00:50
      274000 -- (-1569.712) (-1570.476) (-1568.173) [-1569.158] * (-1569.121) (-1568.461) (-1570.847) [-1568.118] -- 0:00:50
      274500 -- (-1568.107) (-1570.765) (-1565.196) [-1568.172] * (-1568.483) [-1568.949] (-1568.710) (-1568.561) -- 0:00:50
      275000 -- (-1571.012) (-1568.471) [-1566.244] (-1570.328) * (-1568.203) (-1569.986) (-1569.845) [-1569.238] -- 0:00:52

      Average standard deviation of split frequencies: 0.023732

      275500 -- (-1572.740) [-1567.348] (-1567.799) (-1568.955) * (-1568.154) (-1569.623) [-1568.910] (-1569.730) -- 0:00:52
      276000 -- (-1572.628) [-1567.771] (-1568.620) (-1569.190) * (-1569.788) (-1568.466) (-1570.327) [-1568.701] -- 0:00:52
      276500 -- (-1575.184) [-1565.372] (-1568.402) (-1568.765) * (-1568.972) [-1572.352] (-1570.894) (-1567.704) -- 0:00:52
      277000 -- (-1568.445) [-1570.789] (-1569.805) (-1570.407) * (-1569.491) (-1573.454) (-1569.284) [-1569.015] -- 0:00:52
      277500 -- (-1568.139) (-1567.379) (-1575.062) [-1570.389] * [-1566.166] (-1568.718) (-1568.727) (-1566.514) -- 0:00:52
      278000 -- (-1569.745) [-1569.074] (-1570.232) (-1573.423) * (-1567.909) (-1567.836) [-1568.701] (-1571.785) -- 0:00:51
      278500 -- (-1570.390) (-1571.117) (-1572.491) [-1569.000] * (-1568.888) (-1570.489) [-1570.650] (-1569.558) -- 0:00:51
      279000 -- (-1566.996) (-1571.642) [-1568.966] (-1569.784) * (-1572.812) (-1568.311) (-1571.003) [-1570.095] -- 0:00:51
      279500 -- (-1569.176) (-1569.757) [-1568.321] (-1568.836) * [-1570.209] (-1567.882) (-1569.284) (-1569.176) -- 0:00:51
      280000 -- (-1569.307) (-1571.579) (-1567.814) [-1568.680] * (-1572.846) (-1570.470) [-1568.323] (-1569.146) -- 0:00:51

      Average standard deviation of split frequencies: 0.023337

      280500 -- [-1568.499] (-1568.525) (-1568.166) (-1569.155) * [-1568.394] (-1572.065) (-1569.796) (-1572.284) -- 0:00:51
      281000 -- (-1567.840) [-1567.598] (-1569.200) (-1569.318) * (-1567.689) [-1571.487] (-1572.623) (-1567.519) -- 0:00:51
      281500 -- (-1568.294) [-1567.658] (-1569.331) (-1570.128) * [-1567.296] (-1571.201) (-1572.524) (-1570.100) -- 0:00:51
      282000 -- [-1568.388] (-1568.201) (-1573.628) (-1570.137) * (-1570.829) (-1570.142) (-1567.322) [-1568.230] -- 0:00:50
      282500 -- (-1567.851) (-1570.908) [-1571.229] (-1569.907) * (-1568.681) (-1573.107) (-1568.924) [-1567.943] -- 0:00:50
      283000 -- [-1567.847] (-1568.127) (-1568.061) (-1569.006) * (-1568.317) (-1570.951) (-1572.026) [-1568.849] -- 0:00:50
      283500 -- [-1568.562] (-1568.156) (-1568.708) (-1574.445) * (-1568.905) (-1572.509) (-1578.200) [-1569.075] -- 0:00:50
      284000 -- (-1572.989) [-1568.314] (-1571.990) (-1574.755) * (-1568.402) (-1569.666) (-1565.897) [-1569.094] -- 0:00:50
      284500 -- (-1569.268) (-1570.964) (-1569.409) [-1572.442] * (-1569.049) (-1569.026) (-1570.937) [-1567.884] -- 0:00:50
      285000 -- (-1569.722) [-1570.286] (-1570.062) (-1571.959) * (-1568.813) (-1569.765) (-1570.413) [-1571.034] -- 0:00:50

      Average standard deviation of split frequencies: 0.023770

      285500 -- (-1572.939) (-1565.637) [-1566.107] (-1568.235) * [-1568.793] (-1569.989) (-1571.785) (-1571.905) -- 0:00:50
      286000 -- (-1568.052) [-1566.700] (-1568.568) (-1568.667) * [-1569.404] (-1569.802) (-1569.768) (-1572.934) -- 0:00:49
      286500 -- [-1568.036] (-1566.613) (-1566.873) (-1570.099) * (-1571.578) (-1568.379) [-1568.576] (-1570.220) -- 0:00:49
      287000 -- [-1569.410] (-1568.333) (-1568.667) (-1570.132) * [-1570.415] (-1568.123) (-1567.785) (-1568.342) -- 0:00:49
      287500 -- (-1568.645) [-1566.833] (-1566.445) (-1569.290) * (-1569.728) [-1568.765] (-1569.412) (-1570.287) -- 0:00:49
      288000 -- [-1568.569] (-1569.004) (-1568.877) (-1570.109) * (-1569.603) (-1568.888) [-1568.805] (-1568.742) -- 0:00:49
      288500 -- (-1568.275) (-1571.369) [-1569.597] (-1572.115) * (-1569.581) [-1567.871] (-1574.056) (-1572.735) -- 0:00:49
      289000 -- (-1571.915) (-1569.311) [-1567.916] (-1569.703) * (-1571.408) (-1574.624) [-1570.222] (-1570.468) -- 0:00:49
      289500 -- (-1567.977) (-1567.295) (-1568.399) [-1569.692] * (-1572.731) (-1568.164) [-1568.559] (-1569.058) -- 0:00:49
      290000 -- (-1569.802) (-1569.007) (-1567.974) [-1568.432] * [-1568.302] (-1568.601) (-1569.790) (-1575.363) -- 0:00:51

      Average standard deviation of split frequencies: 0.022108

      290500 -- (-1567.842) (-1566.276) [-1567.727] (-1568.609) * [-1568.497] (-1570.159) (-1570.490) (-1570.487) -- 0:00:51
      291000 -- (-1568.161) [-1566.373] (-1578.570) (-1569.692) * [-1567.863] (-1569.999) (-1571.061) (-1574.048) -- 0:00:51
      291500 -- (-1571.698) [-1569.230] (-1567.513) (-1570.811) * [-1567.352] (-1567.822) (-1570.735) (-1572.049) -- 0:00:51
      292000 -- (-1571.863) (-1573.304) (-1567.859) [-1569.408] * [-1569.089] (-1568.595) (-1569.977) (-1570.819) -- 0:00:50
      292500 -- (-1574.337) [-1568.323] (-1568.075) (-1572.398) * (-1570.600) (-1569.834) (-1570.314) [-1569.121] -- 0:00:50
      293000 -- (-1567.802) (-1567.953) [-1567.561] (-1570.061) * (-1572.253) (-1570.961) [-1569.467] (-1568.760) -- 0:00:50
      293500 -- [-1568.186] (-1568.025) (-1568.879) (-1571.184) * (-1567.276) (-1571.296) (-1570.621) [-1568.308] -- 0:00:50
      294000 -- [-1568.596] (-1569.495) (-1570.720) (-1573.670) * (-1569.169) [-1568.217] (-1568.684) (-1570.227) -- 0:00:50
      294500 -- (-1569.169) [-1571.147] (-1570.323) (-1569.785) * (-1569.788) [-1568.943] (-1571.099) (-1569.235) -- 0:00:50
      295000 -- [-1569.495] (-1569.820) (-1573.640) (-1568.104) * (-1569.383) (-1568.832) (-1569.146) [-1567.658] -- 0:00:50

      Average standard deviation of split frequencies: 0.022129

      295500 -- [-1567.449] (-1569.913) (-1571.484) (-1567.845) * (-1570.783) (-1568.066) (-1570.621) [-1568.064] -- 0:00:50
      296000 -- (-1567.756) (-1575.231) (-1567.979) [-1570.178] * [-1568.100] (-1570.357) (-1570.916) (-1570.862) -- 0:00:49
      296500 -- (-1569.122) [-1567.556] (-1569.125) (-1568.443) * (-1568.635) [-1567.689] (-1571.135) (-1571.329) -- 0:00:49
      297000 -- (-1567.628) [-1569.021] (-1568.235) (-1569.733) * (-1569.425) (-1567.703) [-1569.061] (-1569.960) -- 0:00:49
      297500 -- (-1567.579) (-1566.101) [-1567.349] (-1570.185) * [-1570.051] (-1570.864) (-1568.141) (-1569.619) -- 0:00:49
      298000 -- [-1568.379] (-1569.064) (-1570.404) (-1571.261) * (-1570.967) [-1567.992] (-1568.659) (-1571.849) -- 0:00:49
      298500 -- [-1567.817] (-1570.922) (-1570.650) (-1571.733) * (-1570.914) (-1567.634) (-1569.325) [-1572.449] -- 0:00:49
      299000 -- (-1568.143) (-1569.572) [-1568.824] (-1572.642) * [-1569.903] (-1572.275) (-1569.450) (-1569.556) -- 0:00:49
      299500 -- [-1566.575] (-1572.389) (-1568.450) (-1571.092) * (-1571.460) (-1570.447) [-1569.510] (-1569.008) -- 0:00:49
      300000 -- [-1566.766] (-1568.257) (-1567.869) (-1570.707) * (-1570.187) [-1569.309] (-1572.659) (-1569.349) -- 0:00:48

      Average standard deviation of split frequencies: 0.022528

      300500 -- (-1569.285) (-1568.502) (-1568.550) [-1570.209] * (-1568.406) [-1568.575] (-1570.219) (-1570.928) -- 0:00:48
      301000 -- (-1567.562) (-1568.940) [-1568.146] (-1571.951) * (-1568.442) [-1568.952] (-1571.999) (-1571.585) -- 0:00:48
      301500 -- (-1567.081) (-1569.007) [-1571.387] (-1569.311) * (-1568.500) (-1568.787) (-1572.621) [-1569.392] -- 0:00:48
      302000 -- (-1566.884) [-1568.710] (-1570.343) (-1566.611) * (-1569.064) (-1568.672) [-1572.383] (-1571.082) -- 0:00:48
      302500 -- (-1566.695) (-1567.550) [-1567.763] (-1568.107) * [-1568.830] (-1570.821) (-1570.448) (-1569.330) -- 0:00:48
      303000 -- (-1564.778) (-1566.903) (-1569.686) [-1569.871] * (-1569.699) [-1570.997] (-1569.678) (-1571.811) -- 0:00:48
      303500 -- (-1568.056) (-1568.043) [-1569.598] (-1569.813) * (-1568.175) (-1569.253) (-1569.688) [-1568.699] -- 0:00:48
      304000 -- (-1571.502) (-1569.618) (-1573.996) [-1571.554] * (-1568.047) (-1569.959) [-1568.451] (-1567.877) -- 0:00:48
      304500 -- [-1569.231] (-1569.731) (-1569.414) (-1569.624) * (-1567.949) (-1570.804) [-1569.344] (-1569.122) -- 0:00:50
      305000 -- (-1571.493) (-1568.599) [-1570.665] (-1569.068) * (-1570.910) (-1569.192) (-1569.393) [-1574.158] -- 0:00:50

      Average standard deviation of split frequencies: 0.021973

      305500 -- (-1572.233) [-1570.703] (-1568.264) (-1572.769) * (-1569.713) (-1569.090) (-1569.964) [-1570.572] -- 0:00:50
      306000 -- [-1567.210] (-1570.433) (-1569.394) (-1572.554) * (-1570.912) (-1571.862) (-1569.574) [-1570.560] -- 0:00:49
      306500 -- [-1567.919] (-1578.568) (-1567.875) (-1576.136) * (-1571.928) (-1568.756) (-1568.950) [-1571.514] -- 0:00:49
      307000 -- (-1566.988) (-1572.492) (-1570.692) [-1567.341] * [-1573.267] (-1570.569) (-1568.236) (-1571.322) -- 0:00:49
      307500 -- [-1567.818] (-1573.554) (-1568.617) (-1569.206) * (-1571.490) [-1568.302] (-1571.119) (-1571.700) -- 0:00:49
      308000 -- (-1567.571) (-1571.786) (-1568.823) [-1566.729] * [-1567.485] (-1568.880) (-1573.346) (-1570.829) -- 0:00:49
      308500 -- (-1568.431) (-1568.441) [-1569.091] (-1568.588) * [-1571.181] (-1569.431) (-1569.679) (-1572.544) -- 0:00:49
      309000 -- [-1566.047] (-1568.152) (-1569.064) (-1567.151) * [-1571.608] (-1569.388) (-1569.616) (-1569.946) -- 0:00:49
      309500 -- (-1569.430) (-1569.744) [-1569.905] (-1573.469) * (-1569.874) (-1568.539) (-1570.256) [-1571.407] -- 0:00:49
      310000 -- (-1569.380) [-1567.824] (-1569.682) (-1569.288) * (-1571.108) (-1568.593) [-1568.909] (-1571.732) -- 0:00:48

      Average standard deviation of split frequencies: 0.021244

      310500 -- (-1567.849) (-1567.778) (-1570.059) [-1569.412] * (-1571.855) (-1568.215) (-1568.790) [-1567.934] -- 0:00:48
      311000 -- (-1571.205) [-1568.043] (-1568.791) (-1571.637) * [-1575.052] (-1568.098) (-1568.510) (-1569.332) -- 0:00:48
      311500 -- (-1570.818) (-1569.465) [-1569.771] (-1572.487) * (-1573.537) (-1569.537) (-1577.140) [-1568.952] -- 0:00:48
      312000 -- (-1569.909) (-1569.052) [-1568.708] (-1571.564) * (-1573.878) [-1568.142] (-1568.820) (-1568.554) -- 0:00:48
      312500 -- (-1569.755) [-1569.282] (-1569.760) (-1571.366) * (-1574.412) (-1569.312) (-1569.863) [-1570.093] -- 0:00:48
      313000 -- (-1568.717) (-1568.409) (-1569.151) [-1567.956] * (-1574.055) (-1569.714) (-1569.553) [-1570.745] -- 0:00:48
      313500 -- [-1569.539] (-1567.416) (-1569.448) (-1567.785) * (-1568.888) (-1569.387) (-1567.876) [-1568.877] -- 0:00:48
      314000 -- (-1568.604) [-1568.134] (-1568.427) (-1570.044) * (-1568.379) (-1570.737) [-1566.646] (-1567.806) -- 0:00:48
      314500 -- (-1572.005) (-1569.479) (-1571.420) [-1569.800] * (-1569.782) (-1572.743) [-1567.668] (-1568.008) -- 0:00:47
      315000 -- (-1568.356) (-1568.911) (-1569.779) [-1566.604] * (-1569.088) (-1573.752) [-1567.786] (-1574.604) -- 0:00:47

      Average standard deviation of split frequencies: 0.020571

      315500 -- (-1570.231) [-1569.418] (-1571.711) (-1567.940) * (-1568.635) (-1567.774) (-1569.240) [-1571.254] -- 0:00:47
      316000 -- (-1571.219) (-1571.044) (-1573.825) [-1570.636] * (-1569.073) (-1568.167) [-1571.515] (-1569.455) -- 0:00:47
      316500 -- (-1573.441) (-1571.580) (-1570.661) [-1568.103] * (-1571.632) (-1571.495) (-1568.458) [-1569.592] -- 0:00:47
      317000 -- (-1569.243) (-1571.307) (-1570.498) [-1568.008] * (-1571.516) (-1569.651) (-1569.469) [-1569.189] -- 0:00:47
      317500 -- [-1569.194] (-1571.643) (-1568.338) (-1566.733) * (-1574.054) [-1568.213] (-1568.716) (-1570.589) -- 0:00:47
      318000 -- (-1578.894) (-1568.813) [-1568.159] (-1570.605) * (-1570.251) (-1568.438) (-1567.838) [-1568.238] -- 0:00:47
      318500 -- (-1571.344) (-1576.846) (-1571.203) [-1571.455] * (-1568.857) (-1569.952) (-1570.455) [-1567.870] -- 0:00:47
      319000 -- [-1568.344] (-1570.354) (-1568.250) (-1568.065) * (-1572.574) (-1567.784) [-1567.478] (-1569.455) -- 0:00:49
      319500 -- [-1567.642] (-1576.338) (-1567.341) (-1569.352) * [-1568.617] (-1568.262) (-1569.179) (-1567.904) -- 0:00:48
      320000 -- (-1571.022) [-1567.361] (-1569.281) (-1570.618) * (-1568.514) (-1568.718) [-1569.179] (-1568.779) -- 0:00:48

      Average standard deviation of split frequencies: 0.021123

      320500 -- (-1571.614) (-1568.022) [-1571.976] (-1571.950) * (-1568.752) (-1572.415) (-1568.634) [-1570.391] -- 0:00:48
      321000 -- (-1566.971) (-1570.194) [-1572.830] (-1570.607) * (-1571.010) (-1571.880) (-1566.527) [-1571.193] -- 0:00:48
      321500 -- [-1567.112] (-1571.956) (-1569.402) (-1569.066) * (-1576.733) (-1569.529) [-1568.830] (-1567.273) -- 0:00:48
      322000 -- (-1566.411) (-1571.740) (-1567.783) [-1570.366] * (-1573.499) (-1570.544) (-1569.815) [-1568.960] -- 0:00:48
      322500 -- [-1566.624] (-1571.584) (-1569.838) (-1574.176) * (-1571.039) (-1569.775) [-1570.121] (-1568.627) -- 0:00:48
      323000 -- (-1570.449) (-1569.441) [-1568.357] (-1572.795) * (-1569.674) (-1573.327) [-1568.618] (-1568.037) -- 0:00:48
      323500 -- (-1570.388) (-1568.585) [-1568.005] (-1568.816) * (-1569.327) (-1573.797) [-1567.123] (-1568.517) -- 0:00:48
      324000 -- [-1569.753] (-1570.004) (-1570.645) (-1568.222) * (-1570.791) [-1569.189] (-1570.139) (-1569.217) -- 0:00:47
      324500 -- (-1571.070) [-1567.473] (-1574.844) (-1569.991) * (-1570.257) (-1572.558) [-1569.783] (-1571.104) -- 0:00:47
      325000 -- [-1569.735] (-1568.782) (-1568.661) (-1566.611) * (-1569.106) [-1571.028] (-1570.494) (-1572.170) -- 0:00:47

      Average standard deviation of split frequencies: 0.021462

      325500 -- [-1570.555] (-1568.532) (-1569.876) (-1566.046) * (-1568.510) (-1569.194) [-1567.934] (-1571.144) -- 0:00:47
      326000 -- (-1571.926) (-1570.277) (-1570.406) [-1568.752] * (-1569.539) (-1569.933) (-1569.019) [-1572.728] -- 0:00:47
      326500 -- [-1570.937] (-1569.124) (-1570.079) (-1566.575) * (-1573.062) [-1569.316] (-1570.457) (-1568.944) -- 0:00:47
      327000 -- (-1566.405) (-1571.687) (-1566.240) [-1567.749] * (-1569.403) [-1570.278] (-1569.709) (-1565.840) -- 0:00:47
      327500 -- [-1569.296] (-1571.721) (-1566.603) (-1569.031) * (-1567.697) (-1570.247) (-1569.476) [-1569.015] -- 0:00:47
      328000 -- (-1568.984) (-1568.921) [-1571.983] (-1569.030) * (-1569.306) [-1572.814] (-1570.014) (-1569.067) -- 0:00:47
      328500 -- (-1571.795) [-1568.606] (-1570.663) (-1568.392) * (-1569.912) (-1566.526) (-1568.843) [-1568.713] -- 0:00:47
      329000 -- [-1569.477] (-1569.447) (-1570.498) (-1567.956) * (-1574.286) (-1569.756) (-1570.619) [-1568.043] -- 0:00:46
      329500 -- (-1570.336) [-1568.338] (-1569.837) (-1567.707) * (-1570.595) (-1569.673) [-1568.766] (-1568.098) -- 0:00:46
      330000 -- (-1567.635) [-1568.943] (-1568.442) (-1567.934) * [-1567.047] (-1568.664) (-1570.368) (-1565.694) -- 0:00:46

      Average standard deviation of split frequencies: 0.020484

      330500 -- [-1568.745] (-1569.597) (-1568.149) (-1567.062) * [-1569.652] (-1569.785) (-1571.134) (-1564.889) -- 0:00:46
      331000 -- [-1568.158] (-1569.105) (-1571.499) (-1569.542) * (-1570.682) (-1571.685) (-1569.361) [-1567.988] -- 0:00:46
      331500 -- [-1568.369] (-1568.020) (-1568.267) (-1568.826) * (-1566.765) (-1573.298) [-1568.750] (-1570.519) -- 0:00:46
      332000 -- [-1569.793] (-1571.070) (-1568.681) (-1568.533) * (-1568.736) (-1571.882) (-1569.040) [-1568.941] -- 0:00:46
      332500 -- (-1570.527) (-1568.064) (-1568.521) [-1570.491] * (-1569.177) (-1568.795) [-1567.734] (-1567.477) -- 0:00:46
      333000 -- [-1568.580] (-1572.344) (-1568.824) (-1571.784) * (-1570.771) (-1568.270) (-1568.955) [-1568.860] -- 0:00:46
      333500 -- (-1565.547) (-1568.775) (-1569.782) [-1568.058] * [-1571.419] (-1574.319) (-1567.952) (-1572.782) -- 0:00:47
      334000 -- (-1567.643) [-1568.496] (-1571.479) (-1567.266) * (-1569.582) [-1569.008] (-1568.431) (-1569.133) -- 0:00:47
      334500 -- (-1568.905) [-1568.297] (-1569.654) (-1571.182) * (-1573.457) (-1568.269) [-1570.840] (-1569.255) -- 0:00:47
      335000 -- (-1568.672) (-1568.279) (-1570.333) [-1565.835] * (-1567.745) (-1571.395) [-1574.014] (-1570.639) -- 0:00:47

      Average standard deviation of split frequencies: 0.019790

      335500 -- (-1569.979) (-1569.042) (-1570.507) [-1567.613] * (-1570.156) (-1571.934) (-1568.894) [-1570.467] -- 0:00:47
      336000 -- [-1568.436] (-1568.802) (-1571.276) (-1567.782) * (-1569.168) [-1568.711] (-