--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Sat Dec 10 13:13:20 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/443/zetaCOP-PC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1328.57 -1345.71
2 -1330.08 -1347.49
--------------------------------------
TOTAL -1329.06 -1346.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.812469 0.017083 0.565368 1.071394 0.803883 1099.72 1135.93 1.000
r(A<->C){all} 0.083050 0.000901 0.029370 0.143340 0.080460 854.59 862.69 1.003
r(A<->G){all} 0.270828 0.004037 0.149900 0.397122 0.265829 671.76 720.90 1.001
r(A<->T){all} 0.173790 0.004304 0.047417 0.298054 0.168000 502.53 586.54 1.003
r(C<->G){all} 0.090911 0.000634 0.042961 0.139420 0.088329 895.41 947.16 1.000
r(C<->T){all} 0.346649 0.003951 0.226859 0.468267 0.343580 669.28 674.70 1.000
r(G<->T){all} 0.034772 0.000495 0.000043 0.078070 0.030445 789.58 896.37 1.001
pi(A){all} 0.246511 0.000347 0.210823 0.283027 0.246598 840.23 974.44 1.002
pi(C){all} 0.295129 0.000386 0.259351 0.335633 0.294347 1219.06 1256.28 1.000
pi(G){all} 0.255968 0.000366 0.217506 0.293281 0.255881 992.63 1172.40 1.001
pi(T){all} 0.202392 0.000304 0.169267 0.236723 0.202540 1034.59 1085.09 1.000
alpha{1,2} 0.088100 0.000351 0.055710 0.128792 0.088032 1116.18 1138.74 1.000
alpha{3} 2.539638 0.687588 1.140779 4.174147 2.406027 1130.41 1242.44 1.000
pinvar{all} 0.540672 0.002673 0.429888 0.631966 0.542966 1029.46 1143.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1131.01823
Model 2: PositiveSelection -1131.01823
Model 0: one-ratio -1143.646376
Model 3: discrete -1130.423813
Model 7: beta -1132.536572
Model 8: beta&w>1 -1132.537981
Model 0 vs 1 25.25629200000003
Model 2 vs 1 0.0
Model 8 vs 7 0.002817999999933818
>C1
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C2
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C3
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C4
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C5
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C6
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C7
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C8
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C9
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C10
MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT
ooooooooooooo
>C11
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=163
C1 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C2 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C3 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C4 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C5 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C6 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C7 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C8 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C9 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C10 MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
C11 MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
********:*****************************************
C1 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C2 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C3 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C4 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C5 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C6 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C7 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C8 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C9 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C10 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
C11 LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
**************************************************
C1 LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C2 LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C3 LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C4 LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C5 LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C6 LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL
C7 LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C8 LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C9 LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
C10 LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT
C11 LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
*: ***************:********:*********************
C1 QSAREQLKWSILK
C2 QSAREQLKWSILK
C3 QSAREQLKWSILK
C4 QSAREQLKWSILK
C5 QSAREQLKWSILK
C6 QSAREQLKWSILK
C7 QSAREQLKWSILK
C8 QSAREQLKWSILK
C9 QSAREQLKWSILK
C10 ooooooooooooo
C11 QSAREQLKWSILK
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnplugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 163 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 163 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [17930]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [17930]--->[17930]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.579 Mb, Max= 31.051 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C2
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C3
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C4
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C5
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C6
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C7
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C8
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C9
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C10
MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT
ooooooooooooo
>C11
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
FORMAT of file /tmp/tmp4619071855423929706aln Not Supported[FATAL:T-COFFEE]
>C1
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C2
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C3
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C4
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C5
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C6
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C7
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C8
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C9
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C10
MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT
ooooooooooooo
>C11
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:163 S:100 BS:163
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 99.39 C1 C2 99.39
TOP 1 0 99.39 C2 C1 99.39
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 99.39 C1 C4 99.39
TOP 3 0 99.39 C4 C1 99.39
BOT 0 4 99.39 C1 C5 99.39
TOP 4 0 99.39 C5 C1 99.39
BOT 0 5 99.39 C1 C6 99.39
TOP 5 0 99.39 C6 C1 99.39
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 99.39 C1 C8 99.39
TOP 7 0 99.39 C8 C1 99.39
BOT 0 8 99.39 C1 C9 99.39
TOP 8 0 99.39 C9 C1 99.39
BOT 0 9 89.57 C1 C10 89.57
TOP 9 0 89.57 C10 C1 89.57
BOT 0 10 99.39 C1 C11 99.39
TOP 10 0 99.39 C11 C1 99.39
BOT 1 2 99.39 C2 C3 99.39
TOP 2 1 99.39 C3 C2 99.39
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 98.77 C2 C5 98.77
TOP 4 1 98.77 C5 C2 98.77
BOT 1 5 98.77 C2 C6 98.77
TOP 5 1 98.77 C6 C2 98.77
BOT 1 6 99.39 C2 C7 99.39
TOP 6 1 99.39 C7 C2 99.39
BOT 1 7 98.77 C2 C8 98.77
TOP 7 1 98.77 C8 C2 98.77
BOT 1 8 98.77 C2 C9 98.77
TOP 8 1 98.77 C9 C2 98.77
BOT 1 9 90.18 C2 C10 90.18
TOP 9 1 90.18 C10 C2 90.18
BOT 1 10 98.77 C2 C11 98.77
TOP 10 1 98.77 C11 C2 98.77
BOT 2 3 99.39 C3 C4 99.39
TOP 3 2 99.39 C4 C3 99.39
BOT 2 4 99.39 C3 C5 99.39
TOP 4 2 99.39 C5 C3 99.39
BOT 2 5 99.39 C3 C6 99.39
TOP 5 2 99.39 C6 C3 99.39
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 99.39 C3 C8 99.39
TOP 7 2 99.39 C8 C3 99.39
BOT 2 8 99.39 C3 C9 99.39
TOP 8 2 99.39 C9 C3 99.39
BOT 2 9 89.57 C3 C10 89.57
TOP 9 2 89.57 C10 C3 89.57
BOT 2 10 99.39 C3 C11 99.39
TOP 10 2 99.39 C11 C3 99.39
BOT 3 4 98.77 C4 C5 98.77
TOP 4 3 98.77 C5 C4 98.77
BOT 3 5 98.77 C4 C6 98.77
TOP 5 3 98.77 C6 C4 98.77
BOT 3 6 99.39 C4 C7 99.39
TOP 6 3 99.39 C7 C4 99.39
BOT 3 7 98.77 C4 C8 98.77
TOP 7 3 98.77 C8 C4 98.77
BOT 3 8 98.77 C4 C9 98.77
TOP 8 3 98.77 C9 C4 98.77
BOT 3 9 90.18 C4 C10 90.18
TOP 9 3 90.18 C10 C4 90.18
BOT 3 10 98.77 C4 C11 98.77
TOP 10 3 98.77 C11 C4 98.77
BOT 4 5 98.77 C5 C6 98.77
TOP 5 4 98.77 C6 C5 98.77
BOT 4 6 99.39 C5 C7 99.39
TOP 6 4 99.39 C7 C5 99.39
BOT 4 7 98.77 C5 C8 98.77
TOP 7 4 98.77 C8 C5 98.77
BOT 4 8 98.77 C5 C9 98.77
TOP 8 4 98.77 C9 C5 98.77
BOT 4 9 88.96 C5 C10 88.96
TOP 9 4 88.96 C10 C5 88.96
BOT 4 10 98.77 C5 C11 98.77
TOP 10 4 98.77 C11 C5 98.77
BOT 5 6 99.39 C6 C7 99.39
TOP 6 5 99.39 C7 C6 99.39
BOT 5 7 98.77 C6 C8 98.77
TOP 7 5 98.77 C8 C6 98.77
BOT 5 8 98.77 C6 C9 98.77
TOP 8 5 98.77 C9 C6 98.77
BOT 5 9 88.96 C6 C10 88.96
TOP 9 5 88.96 C10 C6 88.96
BOT 5 10 98.77 C6 C11 98.77
TOP 10 5 98.77 C11 C6 98.77
BOT 6 7 99.39 C7 C8 99.39
TOP 7 6 99.39 C8 C7 99.39
BOT 6 8 99.39 C7 C9 99.39
TOP 8 6 99.39 C9 C7 99.39
BOT 6 9 89.57 C7 C10 89.57
TOP 9 6 89.57 C10 C7 89.57
BOT 6 10 99.39 C7 C11 99.39
TOP 10 6 99.39 C11 C7 99.39
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 90.18 C8 C10 90.18
TOP 9 7 90.18 C10 C8 90.18
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 8 9 90.18 C9 C10 90.18
TOP 9 8 90.18 C10 C9 90.18
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 9 10 90.18 C10 C11 90.18
TOP 10 9 90.18 C11 C10 90.18
AVG 0 C1 * 98.53
AVG 1 C2 * 98.22
AVG 2 C3 * 98.53
AVG 3 C4 * 98.22
AVG 4 C5 * 97.98
AVG 5 C6 * 97.98
AVG 6 C7 * 98.53
AVG 7 C8 * 98.34
AVG 8 C9 * 98.34
AVG 9 C10 * 89.75
AVG 10 C11 * 98.34
TOT TOT * 97.52
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
C2 ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
C3 ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTATTACGA
C4 ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
C5 ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
C6 ATGTGCATCATGGACAACGACGGCAACCGCATCCTGGCCAAGTACTACGA
C7 ATGTGCATCATGGACAACGACGGGAACCGCATCCTGGCCAAGTACTACGA
C8 ATGTGCATCATGGACAACGATGGAAACCGCATCCTGGCCAAATACTACGA
C9 ATGTGCATCATGGACAACGATGGCAACCGCATTCTGGCGAAGTACTACGA
C10 ATGTGCATCATGGACAATGATGGAGACCGCATCCTGGCCAAGTACTACGA
C11 ATGTGCATCATGGACAATGATGGCAACCGCATCCTGGCCAAGTACTACGA
***************** ** ** .******* ***** **.** *****
C1 CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C2 CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C3 CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C4 CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATC
C5 CAAGAACATCTTGTCCACGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATC
C6 CAAAAACATTCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C7 CAAGAACATACTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C8 TAAAAACATCTTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C9 CAAGAACATCTTGTCCACGCTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C10 CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
C11 CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
**.***** ******** ******************* **********
C1 TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATTATGCTGGACGGA
C2 TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA
C3 TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA
C4 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGATGGA
C5 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA
C6 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTGGACGGG
C7 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG
C8 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTGGACGGA
C9 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTCGACGGA
C10 TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG
C11 TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG
******* ***************************** ***** ** **.
C1 CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C2 CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C3 CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C4 CTTACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C5 CTCACCTGCGTCTACAAGAGCAACGTGGACCTGTTCTTCTACGTGATGGG
C6 CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C7 CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C8 CTCACCTGCGTCTACAAAAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C9 CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
C10 CTCACCTGCGTCTACAAGAGCAACGTGGACCTGTTCTTCTACGTGATGGG
C11 CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
** ******** *****.************** *****************
C1 CAACGCCTACGAGAACGAGCTCATCCTGCTGTCCGTGCTCAACTGCCTCT
C2 CAACGCCTACGAGAACGAGCTCATCCTCCTGTCCGTGCTAAACTGCCTCT
C3 CAACGCCTACGAGAACGAGCTCATCCTCCTGTCCGTGCTAAACTGCCTCT
C4 CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT
C5 CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT
C6 CAACGCCTACGAGAACGAGCTCATCCTGCTCTCGGTGCTCAACTGCCTGT
C7 CAACGCCTACGAGAACGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT
C8 CAACGCCTACGAGAACGAGCTGATCCTGCTGTCTGTGCTCAACTGCCTGT
C9 CAACGCCTACGAGAACGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT
C10 CAATGCCTACGAGAATGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT
C11 CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT
*** *********** ***** ***** ** ** *****.******** *
C1 ACGATTCCATTAGCCTGATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTG
C2 ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C3 ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C4 ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C5 ACGATTCTATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C6 ACGACTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C7 ACGACTCCATCAGCCTGATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTG
C8 ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C9 ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C10 ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
C11 ACGACTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGACTGGTG
**** ** ** *****.** *********** ** ********.******
C1 CTGGAAAACCTGGAGATCATCATGCTGGCATTTGACGAGATCTGCGACGG
C2 CTGGATAACCTGGAGATCATCATGCTGGCTTTTGACGAGATCTGCGACGG
C3 CTGGAAAACCTGGAGATCATCATGCTGGCATTTGACGAGATCTGCGACGG
C4 CTGGATAACCTGGAGATCATCATGCTGGCCTTTGACGAGATCTGCGACGG
C5 CTGGAATACCTGGAGATCATCATGCTGGCCTTTGACGAGATCTGCGATGG
C6 CTGGAGAACCTGGAGATCATCATGCTGGCCTTCGATGAGATCTGCGACGG
C7 CTGGAGAACCTGGAGATCATCATGCTGGCCTTCGACGAGATCTGCGACGG
C8 CTGGAGAACCTGGAGATCATCATGCTGGCCTTTGATGAAATCTGCGACGG
C9 CTGGAGAACCTCGAGATCATAATGCTGGCATTTGACGAGATCTGCGACGG
C10 CTGGACAACCTGGAGATCATCATGCTGGCCTTCGACGAGATCTGCGACGG
C11 CTGGAGAACCTGGAGATCATCATGCTCGCCTTCGACGAGATCTGTGACGG
***** :**** ********.***** ** ** ** **.***** ** **
C1 AGGCATTATTCTGGATGCGGATCCCTCGTCGGTGGTGAAACGCGTTGATC
C2 AGGCATTATTCTGGATGCGGATCCCTCGTCCGTGGTGAAACGCGTTGATC
C3 AGGCATTATTCTGGATGCGGATCCCTCGTCCGTGGTGAAACGCGTTGATC
C4 AGGCATAATTCTGGATGCCGATCCGTCGTCCGTGGTGAAACGCGTTGATC
C5 AGGCATAATTCTGGATGCGGATCCCTCGTCGGTGGTGAAACGCGTTGATC
C6 AGGCATAATCCTGGATGCCGATCCATCGTCCATTGTGAAACGTGTCGATC
C7 AGGCATTATCCTGGACGCGGATCCCTCGTCCGTGGTGAAACGCGTCGATC
C8 AGGCATGATTCTGGATGCGGATCCCTCCTCCGTAGTGAAACGCGTCGATC
C9 AGGCATGATCCTGGACGCGGATCCTTCGTCCGTGGTAAAACGTGTCGATC
C10 AGGCATGATCCTGGATGCGGATCCCTCGTCCGTGGTGAAACGAGTCGATC
C11 AGGAATGATCCTGGATGCGGATCCCTCATCCGTCGTGAAACGAGTCGATC
***.** ** ***** ** ***** ** ** .* **.***** ** ****
C1 TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
C2 TGCGCAACGATGACATTCCCATTGCCGAACAAACCGTTGCCCAGGTTCTG
C3 TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
C4 TGCGCAACGATGACATTCCAATTGCCGAACAGACCGTCGCCCAGGTTCTG
C5 TGCGCAACGATGACATTCCAATTGCCGAACAGACCGTTGCCCAGGTTCTG
C6 TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
C7 TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
C8 TGCGCAACGATGACATTCCTATTGCCGAACAAACCGTTGCCCAGGTTCTG
C9 TGCGCAACGACGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
C10 TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTAACT
C11 TGCGCAACGATGACATTCCCATCGCCGAACAGACCGTTGCCCAGGTTCTG
********** ******** ** ********.***** ********:.
C1 CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
C2 CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
C3 CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
C4 CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
C5 CAATCGGCACGTGAACAACTCAAATGGTCTATTCTGAAG
C6 CAGTCGGCGCGTGAACAGCTCAAATGGTCCATTCTGAAG
C7 CAGTCGGCGCGCGAGCAACTCAAATGGTCCATTCTGAAG
C8 CAATCGGCGCGTGAGCAACTCAAATGGTCCATTCTGAAG
C9 CAGTCGGCGCGTGAGCAGCTCAAATGGTCTATTCTGAAG
C10 ---------------------------------------
C11 CAGTCGGCGCGTGAACAACTCAAATGGTCCATTCTGAAG
>C1
ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATTATGCTGGACGGA
CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTGCTGTCCGTGCTCAACTGCCTCT
ACGATTCCATTAGCCTGATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTG
CTGGAAAACCTGGAGATCATCATGCTGGCATTTGACGAGATCTGCGACGG
AGGCATTATTCTGGATGCGGATCCCTCGTCGGTGGTGAAACGCGTTGATC
TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
>C2
ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA
CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTCCTGTCCGTGCTAAACTGCCTCT
ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGATAACCTGGAGATCATCATGCTGGCTTTTGACGAGATCTGCGACGG
AGGCATTATTCTGGATGCGGATCCCTCGTCCGTGGTGAAACGCGTTGATC
TGCGCAACGATGACATTCCCATTGCCGAACAAACCGTTGCCCAGGTTCTG
CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
>C3
ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTATTACGA
CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA
CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTCCTGTCCGTGCTAAACTGCCTCT
ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGAAAACCTGGAGATCATCATGCTGGCATTTGACGAGATCTGCGACGG
AGGCATTATTCTGGATGCGGATCCCTCGTCCGTGGTGAAACGCGTTGATC
TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
>C4
ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGATGGA
CTTACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT
ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGATAACCTGGAGATCATCATGCTGGCCTTTGACGAGATCTGCGACGG
AGGCATAATTCTGGATGCCGATCCGTCGTCCGTGGTGAAACGCGTTGATC
TGCGCAACGATGACATTCCAATTGCCGAACAGACCGTCGCCCAGGTTCTG
CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG
>C5
ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA
CAAGAACATCTTGTCCACGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA
CTCACCTGCGTCTACAAGAGCAACGTGGACCTGTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT
ACGATTCTATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGAATACCTGGAGATCATCATGCTGGCCTTTGACGAGATCTGCGATGG
AGGCATAATTCTGGATGCGGATCCCTCGTCGGTGGTGAAACGCGTTGATC
TGCGCAACGATGACATTCCAATTGCCGAACAGACCGTTGCCCAGGTTCTG
CAATCGGCACGTGAACAACTCAAATGGTCTATTCTGAAG
>C6
ATGTGCATCATGGACAACGACGGCAACCGCATCCTGGCCAAGTACTACGA
CAAAAACATTCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTGGACGGG
CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTGCTCTCGGTGCTCAACTGCCTGT
ACGACTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGAGAACCTGGAGATCATCATGCTGGCCTTCGATGAGATCTGCGACGG
AGGCATAATCCTGGATGCCGATCCATCGTCCATTGTGAAACGTGTCGATC
TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
CAGTCGGCGCGTGAACAGCTCAAATGGTCCATTCTGAAG
>C7
ATGTGCATCATGGACAACGACGGGAACCGCATCCTGGCCAAGTACTACGA
CAAGAACATACTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG
CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT
ACGACTCCATCAGCCTGATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTG
CTGGAGAACCTGGAGATCATCATGCTGGCCTTCGACGAGATCTGCGACGG
AGGCATTATCCTGGACGCGGATCCCTCGTCCGTGGTGAAACGCGTCGATC
TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
CAGTCGGCGCGCGAGCAACTCAAATGGTCCATTCTGAAG
>C8
ATGTGCATCATGGACAACGATGGAAACCGCATCCTGGCCAAATACTACGA
TAAAAACATCTTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTGGACGGA
CTCACCTGCGTCTACAAAAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTGATCCTGCTGTCTGTGCTCAACTGCCTGT
ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGAGAACCTGGAGATCATCATGCTGGCCTTTGATGAAATCTGCGACGG
AGGCATGATTCTGGATGCGGATCCCTCCTCCGTAGTGAAACGCGTCGATC
TGCGCAACGATGACATTCCTATTGCCGAACAAACCGTTGCCCAGGTTCTG
CAATCGGCGCGTGAGCAACTCAAATGGTCCATTCTGAAG
>C9
ATGTGCATCATGGACAACGATGGCAACCGCATTCTGGCGAAGTACTACGA
CAAGAACATCTTGTCCACGCTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTCGACGGA
CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT
ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGAGAACCTCGAGATCATAATGCTGGCATTTGACGAGATCTGCGACGG
AGGCATGATCCTGGACGCGGATCCTTCGTCCGTGGTAAAACGTGTCGATC
TGCGCAACGACGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG
CAGTCGGCGCGTGAGCAGCTCAAATGGTCTATTCTGAAG
>C10
ATGTGCATCATGGACAATGATGGAGACCGCATCCTGGCCAAGTACTACGA
CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG
CTCACCTGCGTCTACAAGAGCAACGTGGACCTGTTCTTCTACGTGATGGG
CAATGCCTACGAGAATGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT
ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG
CTGGACAACCTGGAGATCATCATGCTGGCCTTCGACGAGATCTGCGACGG
AGGCATGATCCTGGATGCGGATCCCTCGTCCGTGGTGAAACGAGTCGATC
TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTAACT
---------------------------------------
>C11
ATGTGCATCATGGACAATGATGGCAACCGCATCCTGGCCAAGTACTACGA
CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC
TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG
CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG
CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT
ACGACTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGACTGGTG
CTGGAGAACCTGGAGATCATCATGCTCGCCTTCGACGAGATCTGTGACGG
AGGAATGATCCTGGATGCGGATCCCTCATCCGTCGTGAAACGAGTCGATC
TGCGCAACGATGACATTCCCATCGCCGAACAGACCGTTGCCCAGGTTCTG
CAGTCGGCGCGTGAACAACTCAAATGGTCCATTCTGAAG
>C1
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C2
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C3
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C4
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C5
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C6
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C7
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C8
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C9
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
>C10
MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT
ooooooooooooo
>C11
MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
QSAREQLKWSILK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 489 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481375090
Setting output file names to "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1990768363
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 7714235038
Seed = 716267381
Swapseed = 1481375090
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 14 unique site patterns
Division 2 has 9 unique site patterns
Division 3 has 70 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2040.269740 -- -24.640631
Chain 2 -- -2014.203845 -- -24.640631
Chain 3 -- -2037.371870 -- -24.640631
Chain 4 -- -2058.230281 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2023.631963 -- -24.640631
Chain 2 -- -1997.381892 -- -24.640631
Chain 3 -- -2016.071333 -- -24.640631
Chain 4 -- -1991.682770 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2040.270] (-2014.204) (-2037.372) (-2058.230) * [-2023.632] (-1997.382) (-2016.071) (-1991.683)
500 -- (-1396.492) (-1403.583) (-1420.715) [-1405.131] * (-1402.449) (-1398.533) [-1392.416] (-1412.940) -- 0:33:19
1000 -- [-1377.677] (-1391.790) (-1388.266) (-1381.463) * (-1398.616) [-1374.538] (-1383.829) (-1396.275) -- 0:16:39
1500 -- [-1345.493] (-1369.740) (-1374.815) (-1359.143) * (-1385.653) (-1376.036) [-1364.664] (-1374.880) -- 0:11:05
2000 -- (-1345.265) (-1359.172) (-1360.122) [-1340.034] * (-1390.983) (-1384.601) [-1337.687] (-1355.499) -- 0:08:19
2500 -- (-1351.863) (-1350.664) (-1348.689) [-1334.490] * (-1367.241) (-1373.454) [-1337.108] (-1335.526) -- 0:06:39
3000 -- (-1339.294) (-1347.514) (-1336.531) [-1344.974] * (-1349.379) (-1362.060) [-1332.962] (-1348.831) -- 0:05:32
3500 -- [-1342.736] (-1338.570) (-1344.145) (-1345.714) * (-1346.079) (-1342.234) [-1327.685] (-1348.000) -- 0:09:29
4000 -- (-1334.557) (-1333.909) (-1340.727) [-1339.920] * (-1342.324) (-1341.213) [-1331.634] (-1343.488) -- 0:08:18
4500 -- (-1340.891) [-1332.033] (-1335.691) (-1339.829) * [-1339.603] (-1336.451) (-1339.174) (-1340.335) -- 0:07:22
5000 -- [-1330.582] (-1333.759) (-1341.265) (-1344.512) * (-1338.409) [-1335.931] (-1337.814) (-1342.405) -- 0:06:38
Average standard deviation of split frequencies: 0.066480
5500 -- [-1333.931] (-1340.459) (-1342.265) (-1347.331) * (-1341.063) [-1338.792] (-1332.707) (-1345.021) -- 0:06:01
6000 -- (-1329.655) (-1353.831) (-1346.462) [-1330.908] * (-1334.202) (-1342.681) [-1336.167] (-1339.769) -- 0:05:31
6500 -- (-1336.363) (-1344.709) [-1336.694] (-1335.446) * (-1336.765) (-1338.312) (-1340.492) [-1333.850] -- 0:05:05
7000 -- (-1343.803) (-1347.486) (-1330.706) [-1340.863] * [-1331.241] (-1336.544) (-1336.482) (-1338.304) -- 0:04:43
7500 -- [-1336.908] (-1337.653) (-1342.982) (-1349.644) * [-1342.302] (-1344.750) (-1344.246) (-1332.672) -- 0:06:37
8000 -- [-1333.528] (-1337.287) (-1337.129) (-1344.547) * (-1351.112) (-1336.586) [-1338.733] (-1337.779) -- 0:06:12
8500 -- (-1334.509) (-1338.073) [-1351.485] (-1339.830) * [-1335.990] (-1342.910) (-1341.653) (-1341.532) -- 0:05:49
9000 -- (-1344.936) (-1344.827) [-1328.026] (-1334.475) * [-1339.047] (-1343.258) (-1341.326) (-1336.735) -- 0:05:30
9500 -- (-1329.252) (-1333.940) [-1337.816] (-1344.637) * (-1336.348) (-1336.965) (-1339.933) [-1336.208] -- 0:05:12
10000 -- (-1332.551) (-1344.855) [-1335.303] (-1331.167) * (-1335.451) (-1332.239) (-1340.806) [-1333.716] -- 0:04:57
Average standard deviation of split frequencies: 0.048403
10500 -- [-1333.240] (-1336.240) (-1341.338) (-1337.884) * (-1332.936) [-1337.020] (-1338.745) (-1338.545) -- 0:04:42
11000 -- [-1330.916] (-1342.806) (-1330.885) (-1344.003) * (-1341.909) (-1338.939) [-1336.791] (-1336.665) -- 0:05:59
11500 -- [-1336.227] (-1341.701) (-1335.117) (-1333.464) * (-1338.242) [-1338.002] (-1341.826) (-1337.497) -- 0:05:43
12000 -- (-1337.436) [-1343.259] (-1334.575) (-1348.896) * [-1329.801] (-1339.784) (-1335.922) (-1345.893) -- 0:05:29
12500 -- [-1331.905] (-1336.977) (-1342.011) (-1340.443) * [-1342.094] (-1343.303) (-1336.206) (-1340.428) -- 0:05:16
13000 -- (-1335.277) (-1335.840) [-1330.049] (-1343.628) * (-1343.679) (-1361.255) (-1334.880) [-1341.638] -- 0:05:03
13500 -- (-1337.335) (-1341.101) [-1329.793] (-1354.488) * (-1343.684) [-1340.043] (-1332.077) (-1334.831) -- 0:04:52
14000 -- [-1336.990] (-1339.916) (-1351.325) (-1338.644) * (-1343.204) [-1335.195] (-1333.975) (-1350.339) -- 0:04:41
14500 -- [-1329.638] (-1338.578) (-1346.665) (-1336.049) * (-1349.985) [-1335.303] (-1333.638) (-1334.892) -- 0:04:31
15000 -- (-1344.352) [-1334.753] (-1347.679) (-1344.455) * (-1340.682) (-1352.335) (-1336.566) [-1333.983] -- 0:05:28
Average standard deviation of split frequencies: 0.058926
15500 -- (-1346.162) (-1335.836) (-1344.213) [-1335.293] * (-1347.089) (-1337.907) [-1337.712] (-1344.981) -- 0:05:17
16000 -- (-1341.202) [-1332.156] (-1345.200) (-1352.692) * (-1334.195) (-1340.685) (-1329.759) [-1340.835] -- 0:05:07
16500 -- (-1353.524) [-1334.467] (-1336.080) (-1341.068) * (-1343.227) (-1338.168) [-1338.961] (-1338.770) -- 0:04:58
17000 -- (-1327.771) [-1330.223] (-1338.737) (-1337.737) * (-1337.997) (-1332.028) [-1332.862] (-1329.278) -- 0:04:49
17500 -- (-1333.373) (-1339.987) [-1330.664] (-1354.415) * (-1341.192) [-1337.527] (-1351.997) (-1336.445) -- 0:04:40
18000 -- (-1346.482) (-1352.665) [-1335.333] (-1341.992) * (-1348.008) [-1343.672] (-1336.591) (-1338.471) -- 0:04:32
18500 -- [-1331.880] (-1335.742) (-1344.415) (-1339.212) * (-1342.669) (-1334.800) [-1337.992] (-1343.947) -- 0:05:18
19000 -- (-1335.794) (-1337.955) [-1342.152] (-1340.056) * (-1347.774) (-1344.713) (-1335.517) [-1333.915] -- 0:05:09
19500 -- (-1334.139) (-1330.400) [-1332.467] (-1342.200) * (-1339.972) (-1337.634) (-1339.523) [-1337.976] -- 0:05:01
20000 -- (-1335.720) (-1341.020) [-1334.291] (-1340.999) * (-1342.617) (-1344.010) (-1343.200) [-1347.103] -- 0:04:54
Average standard deviation of split frequencies: 0.053914
20500 -- (-1334.446) (-1338.725) [-1329.750] (-1346.631) * (-1345.091) (-1339.337) (-1342.239) [-1338.298] -- 0:04:46
21000 -- (-1341.065) [-1329.611] (-1342.512) (-1344.293) * [-1337.384] (-1348.176) (-1334.180) (-1340.778) -- 0:04:39
21500 -- (-1331.384) (-1345.832) [-1338.738] (-1343.643) * (-1334.995) (-1339.894) (-1333.594) [-1333.296] -- 0:04:33
22000 -- (-1344.370) [-1336.173] (-1340.647) (-1341.574) * [-1339.525] (-1333.340) (-1340.827) (-1342.527) -- 0:04:26
22500 -- (-1336.654) (-1352.014) [-1335.364] (-1348.641) * (-1335.063) (-1338.034) [-1336.722] (-1345.743) -- 0:05:04
23000 -- (-1340.992) [-1332.812] (-1340.193) (-1342.143) * [-1338.898] (-1328.839) (-1337.417) (-1353.608) -- 0:04:57
23500 -- (-1348.866) (-1346.734) [-1340.006] (-1344.076) * (-1346.484) (-1333.628) [-1339.083] (-1335.991) -- 0:04:50
24000 -- (-1352.286) [-1338.193] (-1329.567) (-1340.291) * [-1334.991] (-1333.973) (-1332.864) (-1332.922) -- 0:04:44
24500 -- (-1342.231) [-1333.752] (-1350.879) (-1334.288) * (-1338.547) [-1332.659] (-1338.350) (-1339.622) -- 0:04:38
25000 -- (-1335.307) (-1343.262) (-1345.084) [-1340.450] * (-1337.366) [-1340.278] (-1338.762) (-1359.328) -- 0:04:33
Average standard deviation of split frequencies: 0.037086
25500 -- (-1339.738) [-1336.306] (-1336.644) (-1342.240) * [-1346.406] (-1338.400) (-1347.307) (-1337.656) -- 0:04:27
26000 -- (-1335.230) (-1350.224) (-1342.986) [-1337.740] * (-1345.979) (-1334.652) [-1338.774] (-1327.878) -- 0:04:22
26500 -- [-1338.030] (-1345.508) (-1341.463) (-1331.905) * (-1337.640) (-1349.400) (-1341.476) [-1329.583] -- 0:04:53
27000 -- [-1327.889] (-1337.862) (-1339.866) (-1346.075) * (-1338.813) (-1350.665) (-1341.533) [-1341.396] -- 0:04:48
27500 -- (-1333.908) (-1338.332) [-1343.342] (-1336.421) * (-1344.127) (-1340.954) [-1332.514] (-1341.517) -- 0:04:42
28000 -- (-1337.286) (-1335.039) (-1341.366) [-1336.397] * (-1348.218) (-1354.769) [-1336.488] (-1337.461) -- 0:04:37
28500 -- (-1337.605) (-1331.879) [-1347.356] (-1335.212) * (-1340.034) (-1332.191) (-1339.117) [-1345.293] -- 0:04:32
29000 -- (-1343.919) (-1335.114) (-1352.028) [-1332.537] * [-1340.599] (-1334.346) (-1341.560) (-1343.898) -- 0:04:27
29500 -- [-1331.442] (-1341.824) (-1342.797) (-1341.011) * (-1338.860) (-1350.059) [-1329.764] (-1338.223) -- 0:04:23
30000 -- (-1347.105) (-1340.744) (-1336.444) [-1332.570] * (-1347.076) (-1343.186) [-1329.534] (-1345.700) -- 0:04:51
Average standard deviation of split frequencies: 0.038064
30500 -- (-1344.361) (-1346.378) (-1344.694) [-1341.726] * (-1332.698) [-1339.044] (-1339.804) (-1347.820) -- 0:04:46
31000 -- [-1335.500] (-1345.070) (-1338.003) (-1337.429) * [-1340.871] (-1342.965) (-1334.790) (-1333.992) -- 0:04:41
31500 -- [-1337.110] (-1340.472) (-1346.227) (-1340.715) * (-1345.467) (-1338.228) (-1337.655) [-1332.495] -- 0:04:36
32000 -- (-1343.239) (-1338.465) (-1335.967) [-1332.159] * (-1347.928) (-1337.775) (-1331.610) [-1333.116] -- 0:04:32
32500 -- (-1343.466) (-1341.609) [-1342.934] (-1339.743) * [-1330.896] (-1342.301) (-1341.543) (-1337.774) -- 0:04:27
33000 -- (-1342.895) (-1335.164) [-1331.993] (-1344.991) * (-1328.344) [-1340.824] (-1333.244) (-1345.152) -- 0:04:23
33500 -- (-1339.999) (-1335.124) (-1344.855) [-1333.928] * (-1334.029) [-1338.839] (-1328.579) (-1327.898) -- 0:04:19
34000 -- (-1352.152) (-1328.332) (-1347.861) [-1331.090] * (-1338.230) [-1343.115] (-1339.920) (-1333.297) -- 0:04:44
34500 -- (-1343.642) (-1343.667) [-1343.599] (-1343.721) * (-1332.061) (-1336.466) [-1337.588] (-1344.928) -- 0:04:39
35000 -- [-1338.849] (-1333.743) (-1335.009) (-1331.651) * [-1335.220] (-1338.835) (-1341.873) (-1344.112) -- 0:04:35
Average standard deviation of split frequencies: 0.042401
35500 -- (-1347.763) (-1333.507) (-1347.808) [-1334.423] * (-1342.772) (-1334.372) (-1351.688) [-1337.597] -- 0:04:31
36000 -- (-1344.228) [-1327.738] (-1345.688) (-1344.259) * (-1355.988) (-1340.013) [-1339.061] (-1340.955) -- 0:04:27
36500 -- (-1338.759) (-1340.271) [-1339.135] (-1342.315) * [-1337.808] (-1347.061) (-1340.932) (-1341.383) -- 0:04:23
37000 -- [-1338.364] (-1336.812) (-1334.922) (-1333.263) * [-1331.003] (-1340.632) (-1342.130) (-1345.430) -- 0:04:20
37500 -- (-1352.391) (-1329.663) (-1333.637) [-1336.064] * (-1336.108) [-1340.516] (-1350.292) (-1339.100) -- 0:04:42
38000 -- (-1341.122) (-1334.753) (-1340.794) [-1339.746] * (-1336.013) (-1335.173) [-1335.227] (-1342.893) -- 0:04:38
38500 -- [-1339.867] (-1348.203) (-1336.680) (-1332.835) * (-1338.951) (-1338.150) (-1347.900) [-1347.298] -- 0:04:34
39000 -- (-1362.551) [-1338.198] (-1341.580) (-1331.089) * (-1336.838) [-1337.416] (-1341.569) (-1338.093) -- 0:04:31
39500 -- (-1342.035) (-1345.874) (-1340.345) [-1332.636] * [-1335.785] (-1337.266) (-1343.879) (-1335.583) -- 0:04:27
40000 -- (-1344.072) [-1339.664] (-1343.829) (-1337.615) * (-1340.442) (-1338.593) (-1341.785) [-1341.501] -- 0:04:24
Average standard deviation of split frequencies: 0.034776
40500 -- (-1357.799) (-1337.071) (-1336.294) [-1332.954] * (-1348.454) (-1339.999) (-1332.400) [-1339.753] -- 0:04:20
41000 -- (-1353.330) (-1338.826) (-1350.874) [-1332.445] * (-1345.787) (-1337.362) [-1346.173] (-1327.557) -- 0:04:17
41500 -- (-1342.145) [-1329.729] (-1347.233) (-1343.634) * [-1334.153] (-1347.029) (-1341.326) (-1344.586) -- 0:04:37
42000 -- (-1340.634) [-1342.063] (-1341.115) (-1345.335) * (-1349.208) (-1339.100) (-1337.675) [-1353.242] -- 0:04:33
42500 -- (-1344.826) [-1334.833] (-1348.022) (-1336.328) * (-1333.255) [-1337.701] (-1340.707) (-1342.815) -- 0:04:30
43000 -- (-1337.675) [-1331.236] (-1338.711) (-1354.070) * [-1329.839] (-1344.545) (-1338.972) (-1342.438) -- 0:04:27
43500 -- (-1342.409) [-1338.231] (-1348.107) (-1347.619) * (-1335.590) [-1340.816] (-1334.178) (-1340.851) -- 0:04:23
44000 -- (-1335.556) [-1333.102] (-1339.109) (-1348.273) * [-1336.740] (-1334.765) (-1335.344) (-1345.780) -- 0:04:20
44500 -- (-1341.575) (-1342.646) [-1333.439] (-1340.178) * (-1341.946) (-1332.684) (-1340.267) [-1343.833] -- 0:04:17
45000 -- (-1334.521) (-1342.248) [-1338.816] (-1340.140) * (-1338.707) [-1334.924] (-1332.846) (-1340.602) -- 0:04:14
Average standard deviation of split frequencies: 0.030744
45500 -- (-1338.705) [-1338.225] (-1346.069) (-1338.915) * (-1354.000) [-1340.114] (-1334.748) (-1336.571) -- 0:04:32
46000 -- [-1334.973] (-1334.594) (-1347.843) (-1337.138) * (-1339.767) (-1334.142) [-1337.292] (-1332.695) -- 0:04:29
46500 -- (-1341.882) (-1343.972) (-1345.655) [-1334.342] * (-1330.918) (-1349.974) [-1329.654] (-1327.459) -- 0:04:26
47000 -- [-1337.722] (-1343.488) (-1335.314) (-1339.550) * (-1335.853) (-1343.831) (-1336.116) [-1329.399] -- 0:04:23
47500 -- [-1332.597] (-1349.164) (-1342.939) (-1349.127) * (-1341.969) [-1335.285] (-1333.107) (-1336.583) -- 0:04:20
48000 -- (-1337.833) (-1346.923) (-1337.806) [-1339.900] * (-1341.525) [-1342.367] (-1339.150) (-1337.143) -- 0:04:17
48500 -- (-1339.206) (-1344.346) [-1333.024] (-1358.704) * (-1342.822) (-1337.034) (-1345.202) [-1335.292] -- 0:04:15
49000 -- (-1334.008) (-1338.906) [-1328.590] (-1352.468) * (-1347.636) (-1352.517) (-1333.309) [-1329.444] -- 0:04:31
49500 -- (-1343.775) (-1346.902) [-1332.822] (-1349.980) * (-1335.454) (-1335.648) (-1335.245) [-1347.361] -- 0:04:28
50000 -- (-1341.190) (-1342.872) [-1331.712] (-1347.598) * [-1338.902] (-1330.157) (-1339.195) (-1335.764) -- 0:04:26
Average standard deviation of split frequencies: 0.026220
50500 -- (-1340.203) [-1335.983] (-1344.743) (-1344.778) * [-1336.489] (-1341.719) (-1343.742) (-1345.154) -- 0:04:23
51000 -- (-1336.870) [-1334.887] (-1338.021) (-1349.639) * (-1353.501) [-1339.159] (-1336.891) (-1345.365) -- 0:04:20
51500 -- (-1344.759) [-1337.890] (-1335.554) (-1345.089) * [-1330.675] (-1340.868) (-1339.687) (-1350.896) -- 0:04:17
52000 -- (-1339.434) (-1336.452) [-1334.604] (-1351.996) * (-1338.572) [-1329.864] (-1344.114) (-1339.203) -- 0:04:15
52500 -- [-1339.716] (-1335.439) (-1335.587) (-1348.893) * (-1345.022) (-1333.782) [-1347.400] (-1347.232) -- 0:04:12
53000 -- (-1347.201) [-1338.187] (-1340.580) (-1343.630) * (-1341.515) (-1334.708) (-1344.766) [-1335.626] -- 0:04:28
53500 -- (-1342.189) (-1333.381) (-1335.626) [-1350.596] * (-1341.049) (-1339.641) [-1332.915] (-1341.607) -- 0:04:25
54000 -- (-1346.061) (-1329.441) (-1330.096) [-1331.700] * (-1352.131) (-1334.471) (-1343.403) [-1337.106] -- 0:04:22
54500 -- (-1345.040) [-1336.824] (-1333.338) (-1334.470) * (-1344.006) (-1331.141) (-1340.447) [-1334.763] -- 0:04:20
55000 -- (-1339.165) (-1333.713) (-1342.691) [-1326.801] * [-1338.672] (-1336.421) (-1351.721) (-1332.082) -- 0:04:17
Average standard deviation of split frequencies: 0.020203
55500 -- (-1346.868) [-1328.660] (-1333.981) (-1337.476) * (-1345.049) [-1332.749] (-1342.995) (-1334.780) -- 0:04:15
56000 -- (-1350.759) (-1339.422) [-1334.123] (-1337.562) * (-1333.503) [-1336.643] (-1345.785) (-1336.756) -- 0:04:12
56500 -- (-1350.859) (-1338.850) [-1327.429] (-1342.129) * (-1333.914) [-1336.651] (-1339.034) (-1339.833) -- 0:04:27
57000 -- (-1337.819) (-1330.148) [-1333.936] (-1338.378) * (-1348.969) (-1339.732) (-1349.583) [-1334.894] -- 0:04:24
57500 -- (-1345.225) [-1332.180] (-1347.491) (-1333.057) * [-1333.065] (-1343.367) (-1341.905) (-1342.059) -- 0:04:22
58000 -- (-1336.832) [-1338.029] (-1347.765) (-1336.263) * (-1323.217) (-1339.581) (-1340.355) [-1336.359] -- 0:04:19
58500 -- (-1345.632) [-1336.811] (-1346.570) (-1337.843) * (-1332.501) (-1336.387) (-1342.204) [-1341.235] -- 0:04:17
59000 -- [-1337.971] (-1334.556) (-1338.457) (-1332.704) * (-1332.948) (-1332.489) [-1332.031] (-1341.026) -- 0:04:15
59500 -- (-1344.293) (-1343.731) (-1339.141) [-1341.486] * [-1333.950] (-1341.141) (-1338.421) (-1341.659) -- 0:04:12
60000 -- (-1344.039) (-1338.270) (-1340.571) [-1337.018] * [-1340.302] (-1335.083) (-1345.124) (-1345.658) -- 0:04:10
Average standard deviation of split frequencies: 0.020721
60500 -- (-1332.225) [-1335.345] (-1351.530) (-1338.242) * (-1336.413) [-1336.085] (-1334.657) (-1343.322) -- 0:04:23
61000 -- (-1338.068) (-1335.551) [-1338.830] (-1337.222) * (-1340.999) (-1345.621) (-1329.492) [-1335.083] -- 0:04:21
61500 -- [-1340.646] (-1333.736) (-1338.714) (-1339.840) * (-1341.853) (-1332.924) (-1328.323) [-1329.961] -- 0:04:19
62000 -- (-1334.481) (-1341.965) [-1333.683] (-1339.232) * (-1353.039) (-1337.498) [-1339.499] (-1329.925) -- 0:04:17
62500 -- (-1336.090) [-1337.917] (-1343.361) (-1343.957) * [-1332.897] (-1350.187) (-1335.906) (-1325.766) -- 0:04:15
63000 -- (-1341.815) (-1347.376) (-1348.766) [-1334.467] * [-1337.182] (-1341.124) (-1338.455) (-1337.401) -- 0:04:12
63500 -- (-1342.046) [-1336.156] (-1344.155) (-1338.528) * [-1338.687] (-1335.374) (-1343.204) (-1337.203) -- 0:04:10
64000 -- (-1333.616) (-1336.419) [-1334.566] (-1349.455) * (-1341.520) (-1344.166) (-1330.962) [-1334.087] -- 0:04:08
64500 -- [-1331.852] (-1337.567) (-1333.457) (-1344.279) * [-1327.302] (-1338.864) (-1344.096) (-1335.892) -- 0:04:21
65000 -- (-1333.798) [-1336.378] (-1334.483) (-1353.529) * (-1342.956) (-1332.051) [-1335.415] (-1334.357) -- 0:04:18
Average standard deviation of split frequencies: 0.021070
65500 -- (-1334.299) (-1341.788) [-1336.526] (-1352.799) * [-1341.473] (-1333.441) (-1331.290) (-1336.735) -- 0:04:16
66000 -- (-1331.911) (-1345.850) [-1336.531] (-1348.009) * [-1341.755] (-1340.013) (-1329.659) (-1333.750) -- 0:04:14
66500 -- (-1352.224) (-1341.473) [-1342.385] (-1338.817) * (-1338.366) [-1335.088] (-1337.414) (-1338.065) -- 0:04:12
67000 -- (-1340.995) (-1347.650) (-1348.929) [-1334.647] * (-1335.925) (-1344.839) (-1341.823) [-1336.230] -- 0:04:10
67500 -- [-1335.939] (-1337.961) (-1342.867) (-1334.091) * [-1339.283] (-1344.655) (-1338.946) (-1343.066) -- 0:04:08
68000 -- (-1335.254) [-1335.044] (-1339.313) (-1333.542) * [-1337.761] (-1337.983) (-1344.857) (-1340.770) -- 0:04:06
68500 -- [-1335.499] (-1329.846) (-1335.160) (-1337.251) * (-1336.607) (-1333.589) (-1344.622) [-1343.165] -- 0:04:18
69000 -- (-1340.790) [-1337.618] (-1339.712) (-1350.158) * [-1340.230] (-1343.245) (-1335.626) (-1337.785) -- 0:04:16
69500 -- [-1344.680] (-1336.976) (-1334.163) (-1344.871) * (-1343.233) [-1343.154] (-1333.860) (-1345.324) -- 0:04:14
70000 -- (-1336.741) [-1336.221] (-1330.655) (-1343.935) * (-1344.359) (-1332.289) [-1343.127] (-1337.418) -- 0:04:12
Average standard deviation of split frequencies: 0.024864
70500 -- (-1340.043) (-1338.744) [-1335.639] (-1353.596) * (-1335.965) (-1338.437) [-1328.593] (-1340.852) -- 0:04:10
71000 -- (-1343.081) (-1335.769) (-1347.232) [-1338.214] * (-1339.104) [-1336.997] (-1338.679) (-1339.400) -- 0:04:08
71500 -- (-1343.376) [-1334.736] (-1346.308) (-1339.607) * (-1333.673) (-1339.459) [-1334.279] (-1341.933) -- 0:04:06
72000 -- (-1338.240) [-1334.497] (-1340.660) (-1349.736) * [-1340.154] (-1347.348) (-1336.049) (-1337.595) -- 0:04:17
72500 -- (-1339.964) (-1329.639) [-1331.230] (-1333.839) * (-1338.774) (-1336.928) (-1351.686) [-1334.504] -- 0:04:15
73000 -- (-1345.901) [-1337.191] (-1335.401) (-1342.296) * (-1338.680) [-1338.772] (-1339.459) (-1335.472) -- 0:04:13
73500 -- (-1351.575) (-1333.628) (-1341.415) [-1334.718] * [-1343.821] (-1339.077) (-1339.557) (-1336.242) -- 0:04:12
74000 -- (-1337.197) (-1328.347) [-1340.234] (-1336.167) * (-1339.404) (-1346.182) (-1346.942) [-1328.014] -- 0:04:10
74500 -- (-1338.127) (-1343.620) [-1333.389] (-1343.716) * (-1343.900) [-1348.254] (-1334.336) (-1338.189) -- 0:04:08
75000 -- (-1345.724) (-1347.979) [-1333.533] (-1342.425) * (-1337.548) [-1340.491] (-1344.270) (-1337.203) -- 0:04:06
Average standard deviation of split frequencies: 0.022020
75500 -- (-1342.937) [-1336.952] (-1335.947) (-1342.161) * (-1345.596) (-1331.806) [-1335.485] (-1342.635) -- 0:04:04
76000 -- (-1331.707) [-1330.870] (-1341.231) (-1340.761) * (-1337.445) [-1335.313] (-1353.236) (-1350.756) -- 0:04:15
76500 -- (-1348.721) (-1336.988) (-1332.701) [-1342.926] * (-1352.005) [-1331.292] (-1342.292) (-1350.437) -- 0:04:13
77000 -- (-1331.598) [-1340.749] (-1334.694) (-1341.033) * (-1339.519) [-1329.558] (-1341.054) (-1349.150) -- 0:04:11
77500 -- [-1336.948] (-1345.036) (-1328.087) (-1336.154) * [-1340.565] (-1331.060) (-1343.853) (-1340.760) -- 0:04:09
78000 -- (-1347.547) [-1349.746] (-1339.377) (-1334.415) * (-1336.431) (-1339.646) [-1331.058] (-1333.866) -- 0:04:08
78500 -- (-1351.723) (-1338.774) [-1337.790] (-1339.904) * (-1336.859) (-1346.771) [-1340.547] (-1343.822) -- 0:04:06
79000 -- [-1343.892] (-1341.156) (-1341.003) (-1331.519) * (-1351.423) (-1328.923) [-1343.395] (-1335.812) -- 0:04:04
79500 -- (-1347.460) [-1332.390] (-1335.203) (-1336.695) * (-1346.841) [-1336.787] (-1338.121) (-1346.316) -- 0:04:14
80000 -- (-1339.944) [-1338.771] (-1337.309) (-1335.068) * (-1339.317) [-1333.510] (-1336.626) (-1340.837) -- 0:04:13
Average standard deviation of split frequencies: 0.020871
80500 -- (-1338.670) (-1335.955) (-1333.438) [-1338.283] * (-1340.981) [-1338.638] (-1337.228) (-1347.272) -- 0:04:11
81000 -- (-1335.386) [-1339.800] (-1352.818) (-1328.262) * [-1331.424] (-1337.999) (-1342.334) (-1339.645) -- 0:04:09
81500 -- (-1340.474) (-1333.204) (-1349.697) [-1337.212] * (-1344.474) [-1334.199] (-1346.880) (-1336.285) -- 0:04:07
82000 -- [-1337.535] (-1336.253) (-1342.557) (-1342.026) * (-1337.700) [-1330.733] (-1331.917) (-1336.128) -- 0:04:06
82500 -- (-1346.459) (-1345.211) (-1349.961) [-1335.089] * (-1343.924) [-1334.336] (-1336.746) (-1343.632) -- 0:04:04
83000 -- (-1334.068) (-1336.891) [-1341.968] (-1334.643) * (-1342.218) [-1340.266] (-1344.781) (-1339.045) -- 0:04:03
83500 -- (-1338.553) (-1335.128) (-1338.205) [-1332.656] * (-1339.151) (-1343.694) [-1336.031] (-1347.229) -- 0:04:12
84000 -- [-1333.949] (-1337.606) (-1353.409) (-1335.172) * (-1349.368) [-1329.471] (-1350.091) (-1348.814) -- 0:04:10
84500 -- (-1337.182) (-1336.947) (-1340.710) [-1333.031] * (-1347.985) (-1346.017) (-1348.303) [-1340.003] -- 0:04:09
85000 -- (-1327.808) (-1336.509) [-1335.910] (-1337.634) * [-1341.664] (-1334.843) (-1342.023) (-1340.998) -- 0:04:07
Average standard deviation of split frequencies: 0.017227
85500 -- (-1340.283) (-1341.098) (-1330.318) [-1336.019] * (-1348.355) (-1335.283) (-1333.171) [-1343.722] -- 0:04:06
86000 -- (-1338.777) [-1336.875] (-1338.629) (-1331.803) * (-1338.545) (-1335.183) [-1333.721] (-1346.687) -- 0:04:04
86500 -- (-1331.870) (-1340.923) [-1330.354] (-1341.048) * (-1352.431) (-1340.508) [-1334.123] (-1338.272) -- 0:04:02
87000 -- (-1342.322) (-1334.933) (-1337.966) [-1334.324] * (-1343.477) (-1348.631) (-1340.973) [-1335.494] -- 0:04:01
87500 -- [-1330.452] (-1330.504) (-1337.383) (-1338.038) * (-1347.453) [-1335.200] (-1345.160) (-1350.004) -- 0:04:10
88000 -- (-1349.174) (-1336.418) [-1337.670] (-1335.988) * (-1331.233) (-1336.816) (-1346.396) [-1340.801] -- 0:04:08
88500 -- (-1336.623) (-1336.127) (-1342.749) [-1328.854] * [-1332.250] (-1338.653) (-1346.802) (-1332.866) -- 0:04:07
89000 -- (-1337.975) (-1338.236) (-1336.739) [-1335.945] * [-1337.800] (-1334.711) (-1343.330) (-1337.827) -- 0:04:05
89500 -- (-1338.045) (-1345.303) (-1329.849) [-1339.946] * [-1334.653] (-1343.173) (-1355.314) (-1333.864) -- 0:04:04
90000 -- (-1335.064) (-1355.869) [-1335.739] (-1338.339) * [-1341.702] (-1342.308) (-1347.954) (-1335.909) -- 0:04:02
Average standard deviation of split frequencies: 0.017158
90500 -- (-1352.574) (-1352.157) (-1340.299) [-1332.250] * (-1331.508) (-1344.267) (-1333.085) [-1335.200] -- 0:04:01
91000 -- (-1339.682) [-1333.650] (-1336.681) (-1343.866) * (-1339.538) (-1335.963) [-1338.815] (-1339.962) -- 0:04:09
91500 -- (-1348.005) (-1336.770) (-1337.105) [-1337.826] * (-1345.096) [-1328.989] (-1338.655) (-1335.723) -- 0:04:08
92000 -- (-1340.181) [-1334.744] (-1341.700) (-1335.357) * (-1338.149) (-1338.694) [-1332.024] (-1335.097) -- 0:04:06
92500 -- (-1362.721) [-1335.938] (-1339.162) (-1335.396) * [-1334.099] (-1333.861) (-1340.429) (-1342.612) -- 0:04:05
93000 -- (-1348.781) (-1340.324) [-1335.041] (-1336.202) * (-1337.324) (-1342.218) [-1336.576] (-1342.472) -- 0:04:03
93500 -- (-1337.875) (-1334.025) (-1345.415) [-1341.743] * (-1355.036) (-1345.494) (-1334.760) [-1340.773] -- 0:04:02
94000 -- (-1334.182) (-1342.946) (-1336.228) [-1341.088] * [-1335.449] (-1335.085) (-1339.742) (-1331.148) -- 0:04:00
94500 -- (-1335.979) (-1343.192) (-1335.638) [-1343.904] * (-1344.676) [-1343.653] (-1334.620) (-1333.276) -- 0:03:59
95000 -- (-1331.382) (-1331.288) [-1346.522] (-1332.971) * (-1338.128) (-1334.381) [-1333.286] (-1333.814) -- 0:04:07
Average standard deviation of split frequencies: 0.018905
95500 -- (-1339.074) [-1333.350] (-1339.351) (-1327.809) * (-1339.810) (-1340.268) [-1333.890] (-1349.195) -- 0:04:06
96000 -- (-1347.219) (-1336.585) [-1337.385] (-1343.567) * (-1338.763) (-1338.318) [-1330.973] (-1341.538) -- 0:04:04
96500 -- (-1346.602) (-1335.697) (-1334.315) [-1331.636] * (-1338.227) (-1335.858) [-1336.514] (-1341.331) -- 0:04:03
97000 -- (-1341.416) [-1336.313] (-1338.172) (-1352.070) * (-1330.814) [-1333.057] (-1347.718) (-1341.339) -- 0:04:02
97500 -- (-1335.940) [-1336.262] (-1335.800) (-1336.759) * (-1340.130) (-1338.602) (-1337.233) [-1341.449] -- 0:04:00
98000 -- (-1350.261) [-1333.755] (-1339.324) (-1334.643) * (-1335.240) [-1332.592] (-1339.242) (-1342.531) -- 0:03:59
98500 -- (-1349.965) (-1334.115) (-1343.051) [-1342.036] * (-1332.053) [-1339.076] (-1334.841) (-1351.105) -- 0:04:07
99000 -- (-1350.849) (-1345.063) (-1341.832) [-1334.879] * (-1336.052) (-1348.676) [-1329.214] (-1351.180) -- 0:04:05
99500 -- (-1343.740) [-1334.728] (-1339.002) (-1339.822) * (-1339.985) [-1338.584] (-1341.076) (-1345.646) -- 0:04:04
100000 -- (-1355.074) (-1346.817) [-1341.483] (-1341.496) * [-1338.171] (-1339.949) (-1340.151) (-1349.538) -- 0:04:03
Average standard deviation of split frequencies: 0.016760
100500 -- (-1353.132) [-1335.049] (-1349.791) (-1338.124) * [-1335.115] (-1338.389) (-1335.784) (-1352.220) -- 0:04:01
101000 -- (-1349.709) (-1333.344) (-1343.200) [-1340.178] * (-1347.907) (-1340.093) [-1340.864] (-1341.039) -- 0:04:00
101500 -- (-1346.333) [-1333.049] (-1347.944) (-1335.714) * (-1337.566) [-1332.260] (-1357.116) (-1346.201) -- 0:03:59
102000 -- (-1343.285) [-1334.869] (-1342.259) (-1338.227) * (-1336.252) [-1334.273] (-1335.145) (-1342.049) -- 0:03:57
102500 -- (-1353.542) (-1338.634) (-1333.401) [-1333.114] * [-1334.899] (-1339.858) (-1334.798) (-1341.645) -- 0:04:05
103000 -- (-1345.076) [-1332.210] (-1337.379) (-1343.799) * (-1343.816) (-1344.779) [-1336.060] (-1338.748) -- 0:04:03
103500 -- (-1337.300) (-1336.377) (-1336.309) [-1334.069] * (-1331.997) [-1335.982] (-1343.164) (-1338.548) -- 0:04:02
104000 -- [-1342.407] (-1332.867) (-1346.736) (-1338.596) * (-1345.389) [-1334.943] (-1348.386) (-1342.541) -- 0:04:01
104500 -- (-1344.517) [-1343.975] (-1345.263) (-1340.857) * (-1341.624) (-1336.743) (-1343.818) [-1336.225] -- 0:03:59
105000 -- [-1333.491] (-1339.499) (-1342.150) (-1336.322) * (-1342.771) (-1349.525) (-1346.777) [-1339.381] -- 0:03:58
Average standard deviation of split frequencies: 0.017122
105500 -- [-1340.964] (-1345.718) (-1332.367) (-1348.853) * (-1340.326) [-1342.150] (-1337.817) (-1345.414) -- 0:03:57
106000 -- [-1343.148] (-1345.915) (-1347.509) (-1345.501) * (-1331.809) [-1350.570] (-1350.469) (-1342.703) -- 0:03:56
106500 -- (-1348.253) (-1337.709) (-1345.145) [-1333.180] * (-1337.153) [-1334.940] (-1352.770) (-1339.756) -- 0:04:03
107000 -- (-1339.662) [-1328.599] (-1335.749) (-1334.587) * (-1344.710) [-1333.034] (-1343.040) (-1342.426) -- 0:04:02
107500 -- (-1346.167) (-1333.286) [-1341.694] (-1332.758) * [-1331.752] (-1340.027) (-1340.735) (-1340.383) -- 0:04:00
108000 -- (-1331.272) (-1339.861) (-1342.742) [-1338.453] * [-1337.178] (-1331.427) (-1333.860) (-1341.152) -- 0:03:59
108500 -- [-1330.204] (-1337.256) (-1349.900) (-1336.919) * [-1339.113] (-1336.904) (-1339.530) (-1346.748) -- 0:03:58
109000 -- [-1331.173] (-1334.130) (-1340.911) (-1340.682) * (-1345.677) [-1330.489] (-1340.499) (-1336.099) -- 0:03:57
109500 -- (-1331.832) (-1341.946) [-1332.415] (-1334.646) * (-1337.697) (-1339.982) [-1335.541] (-1336.465) -- 0:03:55
110000 -- (-1339.618) (-1342.902) [-1336.990] (-1338.124) * (-1337.467) [-1337.299] (-1344.325) (-1339.042) -- 0:04:02
Average standard deviation of split frequencies: 0.017263
110500 -- (-1330.084) [-1328.713] (-1344.437) (-1340.708) * (-1343.263) (-1339.382) (-1342.169) [-1336.075] -- 0:04:01
111000 -- [-1336.033] (-1339.800) (-1338.327) (-1333.663) * (-1341.206) (-1335.914) (-1338.149) [-1331.468] -- 0:04:00
111500 -- (-1332.650) (-1342.409) [-1334.084] (-1338.740) * (-1336.937) [-1339.720] (-1331.544) (-1344.835) -- 0:03:59
112000 -- (-1345.067) (-1356.265) (-1326.532) [-1341.227] * [-1333.443] (-1340.074) (-1330.280) (-1331.762) -- 0:03:57
112500 -- [-1332.379] (-1337.893) (-1342.755) (-1340.520) * (-1331.287) (-1335.293) [-1337.698] (-1336.816) -- 0:03:56
113000 -- (-1329.777) (-1342.322) (-1337.669) [-1340.184] * (-1333.596) (-1334.988) [-1337.574] (-1339.196) -- 0:03:55
113500 -- (-1336.255) [-1333.472] (-1334.825) (-1338.759) * (-1329.827) (-1333.701) [-1335.005] (-1339.646) -- 0:03:54
114000 -- (-1334.804) (-1341.020) (-1347.496) [-1333.615] * [-1328.901] (-1336.371) (-1346.469) (-1339.714) -- 0:04:00
114500 -- (-1336.388) (-1342.103) [-1332.790] (-1330.316) * [-1341.136] (-1354.937) (-1332.468) (-1341.243) -- 0:03:59
115000 -- [-1332.214] (-1340.656) (-1336.670) (-1332.547) * [-1334.127] (-1345.154) (-1334.608) (-1344.379) -- 0:03:58
Average standard deviation of split frequencies: 0.016933
115500 -- (-1337.084) (-1350.014) (-1342.751) [-1328.630] * (-1339.079) (-1359.283) [-1335.143] (-1341.394) -- 0:03:57
116000 -- [-1332.766] (-1337.612) (-1345.148) (-1339.380) * (-1329.717) (-1344.320) (-1342.608) [-1328.823] -- 0:03:56
116500 -- (-1341.259) [-1336.693] (-1334.981) (-1336.678) * (-1337.784) (-1344.243) (-1331.626) [-1334.228] -- 0:03:55
117000 -- (-1342.783) (-1346.106) (-1348.571) [-1338.954] * (-1353.879) [-1338.533] (-1340.820) (-1341.141) -- 0:03:53
117500 -- (-1334.888) [-1336.118] (-1330.247) (-1352.809) * [-1340.363] (-1345.011) (-1346.330) (-1334.607) -- 0:03:52
118000 -- [-1336.420] (-1335.804) (-1341.146) (-1339.139) * [-1338.588] (-1338.702) (-1335.305) (-1341.416) -- 0:03:59
118500 -- (-1339.671) [-1340.183] (-1343.578) (-1336.677) * [-1330.385] (-1339.602) (-1341.718) (-1336.401) -- 0:03:58
119000 -- (-1337.761) [-1345.827] (-1363.475) (-1333.726) * (-1334.031) [-1339.424] (-1342.941) (-1346.762) -- 0:03:56
119500 -- (-1336.448) (-1332.347) (-1339.707) [-1332.500] * (-1335.597) (-1347.839) [-1336.485] (-1343.001) -- 0:03:55
120000 -- (-1349.633) [-1334.061] (-1343.783) (-1338.969) * (-1338.497) (-1342.323) [-1331.841] (-1343.897) -- 0:03:54
Average standard deviation of split frequencies: 0.018094
120500 -- (-1343.414) [-1341.817] (-1338.885) (-1340.256) * (-1344.727) [-1331.071] (-1338.150) (-1344.561) -- 0:03:53
121000 -- (-1338.225) (-1345.317) (-1347.617) [-1333.313] * (-1330.051) [-1329.974] (-1344.036) (-1348.184) -- 0:03:52
121500 -- [-1338.727] (-1337.179) (-1332.144) (-1338.825) * (-1329.250) [-1326.028] (-1335.972) (-1341.681) -- 0:03:58
122000 -- (-1336.975) [-1340.923] (-1339.510) (-1344.164) * (-1336.444) (-1336.123) [-1330.133] (-1348.988) -- 0:03:57
122500 -- [-1336.470] (-1330.011) (-1338.779) (-1346.288) * (-1344.668) (-1335.309) (-1341.284) [-1334.868] -- 0:03:56
123000 -- (-1340.977) [-1336.479] (-1338.029) (-1336.351) * (-1346.469) [-1334.040] (-1330.815) (-1348.782) -- 0:03:55
123500 -- (-1333.681) [-1332.652] (-1345.547) (-1351.545) * (-1347.581) (-1337.693) [-1330.429] (-1347.386) -- 0:03:54
124000 -- (-1351.754) (-1345.129) (-1338.179) [-1345.280] * (-1336.674) (-1339.453) (-1342.181) [-1345.555] -- 0:03:53
124500 -- (-1332.378) (-1341.852) (-1339.236) [-1337.629] * (-1343.417) (-1338.145) [-1334.096] (-1340.039) -- 0:03:52
125000 -- (-1348.792) (-1344.481) (-1350.086) [-1330.946] * (-1347.529) (-1351.118) [-1331.802] (-1341.560) -- 0:03:51
Average standard deviation of split frequencies: 0.020764
125500 -- (-1336.090) (-1336.328) [-1340.684] (-1341.877) * (-1335.968) (-1334.900) (-1342.549) [-1348.634] -- 0:03:56
126000 -- [-1333.035] (-1350.192) (-1340.306) (-1333.564) * (-1345.182) [-1335.483] (-1331.649) (-1344.504) -- 0:03:55
126500 -- [-1340.000] (-1331.411) (-1334.394) (-1341.331) * (-1344.172) (-1346.486) [-1339.644] (-1336.058) -- 0:03:54
127000 -- (-1330.587) (-1346.574) [-1336.477] (-1346.744) * [-1327.946] (-1343.249) (-1341.372) (-1340.481) -- 0:03:53
127500 -- (-1337.148) (-1339.876) (-1337.743) [-1331.405] * (-1335.053) (-1331.501) (-1331.544) [-1331.294] -- 0:03:52
128000 -- (-1340.515) (-1347.366) (-1335.299) [-1329.582] * (-1343.119) [-1334.899] (-1334.535) (-1342.293) -- 0:03:51
128500 -- (-1340.486) [-1334.944] (-1332.084) (-1338.234) * (-1344.933) [-1335.184] (-1336.277) (-1340.972) -- 0:03:50
129000 -- [-1337.751] (-1347.421) (-1333.892) (-1344.536) * [-1349.797] (-1335.823) (-1338.907) (-1340.273) -- 0:03:56
129500 -- (-1333.158) (-1352.295) (-1332.825) [-1327.489] * [-1328.994] (-1348.999) (-1338.617) (-1339.062) -- 0:03:55
130000 -- (-1333.971) (-1343.847) (-1334.272) [-1333.080] * [-1338.891] (-1334.441) (-1338.365) (-1346.396) -- 0:03:54
Average standard deviation of split frequencies: 0.018760
130500 -- (-1334.010) (-1337.161) (-1340.970) [-1336.864] * [-1330.196] (-1332.165) (-1343.442) (-1342.586) -- 0:03:53
131000 -- (-1341.390) (-1331.338) (-1340.515) [-1346.238] * (-1341.577) [-1334.753] (-1331.836) (-1341.284) -- 0:03:52
131500 -- [-1337.010] (-1342.937) (-1340.043) (-1351.716) * (-1339.988) [-1335.808] (-1328.667) (-1333.291) -- 0:03:51
132000 -- (-1354.454) [-1332.690] (-1340.047) (-1340.911) * (-1347.078) (-1334.816) [-1341.112] (-1333.982) -- 0:03:50
132500 -- (-1347.992) (-1335.564) (-1350.898) [-1333.015] * (-1342.045) (-1335.046) (-1338.081) [-1337.073] -- 0:03:49
133000 -- (-1347.090) (-1341.795) [-1341.994] (-1329.278) * (-1335.950) (-1340.965) [-1334.506] (-1335.112) -- 0:03:54
133500 -- (-1340.003) (-1331.515) (-1342.473) [-1327.948] * (-1344.691) (-1337.592) (-1339.978) [-1327.841] -- 0:03:53
134000 -- (-1340.289) (-1341.280) (-1336.117) [-1338.104] * (-1343.947) (-1341.384) (-1335.188) [-1331.756] -- 0:03:52
134500 -- (-1352.017) (-1354.214) (-1343.979) [-1335.155] * (-1337.521) (-1339.074) (-1339.307) [-1330.647] -- 0:03:51
135000 -- (-1351.995) [-1330.507] (-1333.966) (-1341.502) * (-1334.905) (-1334.349) [-1340.366] (-1336.265) -- 0:03:50
Average standard deviation of split frequencies: 0.020980
135500 -- (-1346.952) (-1332.335) [-1343.945] (-1346.376) * (-1334.341) [-1333.821] (-1351.641) (-1337.530) -- 0:03:49
136000 -- (-1345.889) (-1333.034) (-1341.012) [-1335.350] * [-1343.175] (-1345.450) (-1352.741) (-1337.309) -- 0:03:48
136500 -- [-1334.700] (-1345.275) (-1345.598) (-1342.302) * (-1341.736) (-1341.741) (-1346.422) [-1337.331] -- 0:03:47
137000 -- (-1343.259) (-1338.168) [-1341.460] (-1347.042) * (-1342.185) (-1342.955) [-1332.658] (-1343.825) -- 0:03:53
137500 -- (-1335.138) (-1330.432) (-1344.704) [-1337.897] * (-1338.346) [-1339.190] (-1327.309) (-1336.444) -- 0:03:52
138000 -- (-1345.690) [-1331.043] (-1343.397) (-1345.277) * (-1334.679) (-1344.983) (-1339.203) [-1335.877] -- 0:03:51
138500 -- (-1336.571) (-1339.744) (-1344.354) [-1343.433] * (-1332.242) (-1350.068) [-1337.672] (-1338.958) -- 0:03:50
139000 -- [-1334.683] (-1339.123) (-1338.063) (-1339.148) * (-1335.728) (-1342.442) (-1337.890) [-1331.474] -- 0:03:49
139500 -- (-1334.688) (-1347.866) [-1349.345] (-1345.018) * (-1335.752) [-1337.122] (-1343.983) (-1337.562) -- 0:03:48
140000 -- (-1339.515) [-1341.159] (-1341.211) (-1342.289) * [-1336.636] (-1339.587) (-1337.902) (-1347.191) -- 0:03:47
Average standard deviation of split frequencies: 0.020460
140500 -- (-1343.615) [-1331.012] (-1343.410) (-1344.292) * (-1336.851) (-1339.778) [-1332.690] (-1335.467) -- 0:03:52
141000 -- (-1343.077) [-1332.395] (-1344.958) (-1340.785) * [-1333.384] (-1340.642) (-1343.171) (-1344.029) -- 0:03:51
141500 -- (-1335.740) (-1343.670) (-1338.684) [-1337.303] * (-1337.219) (-1349.826) (-1346.878) [-1332.798] -- 0:03:50
142000 -- [-1355.644] (-1332.235) (-1339.670) (-1343.962) * (-1338.316) (-1338.803) (-1350.529) [-1338.447] -- 0:03:49
142500 -- [-1336.785] (-1346.812) (-1349.664) (-1334.064) * (-1344.668) (-1333.161) [-1345.320] (-1326.788) -- 0:03:48
143000 -- [-1330.337] (-1338.912) (-1355.114) (-1342.156) * (-1335.496) [-1339.752] (-1345.491) (-1338.595) -- 0:03:47
143500 -- (-1343.934) [-1338.682] (-1344.500) (-1336.381) * (-1348.136) [-1332.708] (-1349.297) (-1333.764) -- 0:03:46
144000 -- [-1337.168] (-1331.315) (-1353.705) (-1338.719) * (-1338.199) (-1340.590) [-1333.359] (-1349.010) -- 0:03:45
144500 -- (-1343.639) [-1338.145] (-1341.748) (-1337.085) * (-1330.907) (-1352.305) (-1333.818) [-1337.655] -- 0:03:50
145000 -- (-1338.472) (-1343.862) (-1348.464) [-1335.217] * (-1334.422) [-1338.606] (-1334.302) (-1335.643) -- 0:03:49
Average standard deviation of split frequencies: 0.017673
145500 -- (-1338.396) [-1343.021] (-1342.531) (-1340.019) * (-1340.526) (-1336.676) (-1335.424) [-1343.310] -- 0:03:49
146000 -- (-1346.544) (-1339.706) (-1344.888) [-1346.893] * (-1339.415) [-1337.934] (-1340.810) (-1336.320) -- 0:03:48
146500 -- (-1337.341) (-1352.284) [-1345.117] (-1349.639) * (-1341.755) (-1343.755) (-1333.225) [-1341.346] -- 0:03:47
147000 -- (-1331.792) (-1351.248) (-1348.567) [-1331.745] * (-1344.374) [-1338.084] (-1336.341) (-1342.623) -- 0:03:46
147500 -- (-1331.869) (-1353.570) (-1345.127) [-1332.329] * (-1345.833) (-1338.204) [-1330.268] (-1338.651) -- 0:03:45
148000 -- (-1339.431) (-1342.584) [-1335.922] (-1330.206) * (-1343.071) (-1334.746) (-1333.902) [-1328.435] -- 0:03:44
148500 -- (-1336.984) (-1342.455) [-1336.649] (-1337.516) * (-1335.196) (-1333.346) (-1341.965) [-1331.376] -- 0:03:49
149000 -- (-1343.127) (-1343.979) (-1343.272) [-1331.606] * (-1342.887) [-1336.831] (-1350.133) (-1340.811) -- 0:03:48
149500 -- (-1353.661) (-1351.627) [-1331.520] (-1334.859) * (-1341.493) [-1342.156] (-1345.004) (-1337.529) -- 0:03:47
150000 -- (-1358.441) (-1342.004) (-1344.969) [-1332.207] * (-1348.244) [-1336.537] (-1339.616) (-1336.239) -- 0:03:46
Average standard deviation of split frequencies: 0.017785
150500 -- (-1346.589) (-1331.116) (-1337.297) [-1343.881] * (-1345.895) (-1339.367) [-1332.576] (-1336.877) -- 0:03:45
151000 -- (-1339.744) (-1341.024) (-1343.865) [-1330.137] * (-1331.994) [-1334.636] (-1333.796) (-1336.361) -- 0:03:44
151500 -- (-1350.723) [-1333.386] (-1333.881) (-1331.835) * (-1341.459) [-1333.956] (-1333.141) (-1333.384) -- 0:03:44
152000 -- (-1342.834) (-1348.205) [-1332.444] (-1335.130) * (-1335.816) (-1342.479) (-1343.644) [-1338.942] -- 0:03:48
152500 -- (-1344.913) [-1338.987] (-1337.437) (-1348.508) * [-1340.875] (-1339.352) (-1339.828) (-1340.267) -- 0:03:47
153000 -- [-1339.867] (-1343.320) (-1336.038) (-1331.900) * (-1351.733) (-1337.575) [-1335.395] (-1336.426) -- 0:03:46
153500 -- (-1352.836) (-1352.413) [-1329.734] (-1341.558) * (-1339.691) [-1331.404] (-1344.819) (-1337.285) -- 0:03:46
154000 -- (-1353.278) [-1339.152] (-1347.625) (-1340.715) * [-1331.352] (-1337.200) (-1344.245) (-1350.067) -- 0:03:45
154500 -- (-1345.141) (-1342.353) (-1347.578) [-1340.667] * [-1335.640] (-1341.290) (-1336.699) (-1336.898) -- 0:03:44
155000 -- [-1337.877] (-1337.458) (-1339.854) (-1338.476) * (-1341.811) [-1338.543] (-1334.393) (-1350.515) -- 0:03:43
Average standard deviation of split frequencies: 0.016700
155500 -- (-1354.014) (-1338.374) (-1347.728) [-1334.671] * (-1336.539) (-1328.660) [-1334.898] (-1333.844) -- 0:03:42
156000 -- (-1349.589) (-1341.260) (-1337.568) [-1332.911] * (-1341.525) (-1333.577) [-1336.958] (-1333.370) -- 0:03:47
156500 -- (-1341.979) (-1341.066) (-1342.927) [-1333.053] * [-1339.587] (-1338.512) (-1337.363) (-1339.083) -- 0:03:46
157000 -- (-1342.698) (-1329.225) (-1346.715) [-1342.961] * (-1347.264) (-1339.945) (-1332.909) [-1343.900] -- 0:03:45
157500 -- (-1350.381) (-1339.608) [-1339.105] (-1331.948) * (-1335.687) (-1348.138) (-1338.531) [-1330.860] -- 0:03:44
158000 -- (-1344.785) (-1353.500) (-1349.027) [-1333.929] * [-1332.021] (-1329.923) (-1336.568) (-1344.934) -- 0:03:43
158500 -- (-1329.975) [-1332.408] (-1336.770) (-1334.846) * (-1336.887) (-1339.645) [-1335.719] (-1342.106) -- 0:03:42
159000 -- (-1337.635) (-1343.002) (-1347.100) [-1334.795] * [-1332.997] (-1337.369) (-1337.546) (-1346.372) -- 0:03:42
159500 -- (-1337.895) (-1335.031) (-1337.990) [-1333.176] * (-1343.672) (-1341.871) [-1326.238] (-1342.049) -- 0:03:41
160000 -- (-1338.954) [-1335.404] (-1338.678) (-1337.924) * (-1337.782) (-1340.737) (-1338.193) [-1336.029] -- 0:03:45
Average standard deviation of split frequencies: 0.017115
160500 -- (-1337.952) [-1334.213] (-1345.620) (-1341.984) * [-1331.674] (-1337.292) (-1338.103) (-1333.653) -- 0:03:44
161000 -- (-1337.067) (-1335.134) [-1336.381] (-1336.435) * [-1338.214] (-1335.458) (-1338.665) (-1339.683) -- 0:03:44
161500 -- (-1337.572) [-1333.083] (-1333.112) (-1336.491) * (-1339.769) [-1338.676] (-1342.225) (-1349.400) -- 0:03:43
162000 -- (-1341.430) (-1341.293) (-1337.989) [-1333.747] * (-1334.390) (-1342.585) [-1333.730] (-1372.755) -- 0:03:42
162500 -- (-1334.910) (-1331.481) (-1343.313) [-1331.785] * (-1337.492) (-1341.566) [-1334.224] (-1345.956) -- 0:03:41
163000 -- (-1341.389) [-1328.673] (-1342.838) (-1334.110) * (-1342.218) (-1337.904) [-1327.611] (-1340.603) -- 0:03:40
163500 -- (-1338.716) (-1333.017) (-1335.104) [-1337.658] * (-1338.219) (-1342.126) [-1332.539] (-1336.134) -- 0:03:45
164000 -- [-1335.481] (-1339.333) (-1349.374) (-1339.486) * (-1342.225) (-1342.811) (-1346.499) [-1336.270] -- 0:03:44
164500 -- (-1347.255) [-1337.792] (-1336.035) (-1341.866) * (-1340.838) (-1337.770) [-1332.677] (-1340.258) -- 0:03:43
165000 -- (-1336.811) (-1339.380) (-1335.085) [-1340.026] * (-1350.131) (-1340.145) (-1343.739) [-1334.193] -- 0:03:42
Average standard deviation of split frequencies: 0.016881
165500 -- (-1343.226) [-1341.030] (-1344.999) (-1336.867) * [-1335.757] (-1336.054) (-1337.191) (-1337.322) -- 0:03:41
166000 -- (-1351.312) (-1330.904) (-1342.503) [-1338.087] * (-1338.928) [-1343.668] (-1333.234) (-1335.670) -- 0:03:41
166500 -- (-1347.832) (-1345.839) (-1336.421) [-1334.989] * [-1336.476] (-1336.827) (-1340.788) (-1336.781) -- 0:03:40
167000 -- (-1349.276) (-1340.383) [-1336.219] (-1342.738) * (-1345.765) (-1345.639) [-1335.430] (-1340.512) -- 0:03:39
167500 -- (-1343.575) (-1333.870) [-1336.763] (-1342.478) * (-1347.758) [-1337.412] (-1341.127) (-1340.804) -- 0:03:43
168000 -- (-1348.396) (-1328.945) (-1336.472) [-1335.410] * (-1348.442) (-1338.610) (-1342.990) [-1335.702] -- 0:03:42
168500 -- (-1348.201) [-1332.156] (-1345.477) (-1337.631) * [-1345.701] (-1341.366) (-1341.090) (-1334.266) -- 0:03:42
169000 -- (-1341.941) [-1339.423] (-1352.025) (-1336.359) * (-1340.502) [-1335.208] (-1340.296) (-1345.581) -- 0:03:41
169500 -- (-1329.651) (-1347.418) (-1332.768) [-1332.520] * (-1337.804) [-1336.975] (-1348.490) (-1345.375) -- 0:03:40
170000 -- (-1330.653) [-1333.906] (-1341.212) (-1345.525) * (-1346.292) [-1340.441] (-1345.656) (-1344.006) -- 0:03:39
Average standard deviation of split frequencies: 0.016137
170500 -- (-1344.566) [-1332.288] (-1337.763) (-1342.144) * (-1354.635) [-1337.038] (-1331.633) (-1353.690) -- 0:03:38
171000 -- (-1335.706) [-1335.369] (-1338.545) (-1338.593) * [-1337.663] (-1340.813) (-1337.327) (-1336.667) -- 0:03:43
171500 -- [-1341.143] (-1329.798) (-1341.849) (-1342.232) * [-1335.564] (-1348.501) (-1338.841) (-1341.030) -- 0:03:42
172000 -- (-1338.987) [-1335.497] (-1338.836) (-1329.452) * [-1334.110] (-1341.141) (-1335.474) (-1352.814) -- 0:03:41
172500 -- [-1331.137] (-1332.148) (-1329.414) (-1343.485) * (-1333.026) (-1348.736) (-1339.019) [-1342.830] -- 0:03:40
173000 -- (-1335.987) (-1336.254) [-1338.398] (-1352.221) * [-1334.732] (-1345.600) (-1349.387) (-1336.354) -- 0:03:39
173500 -- (-1341.764) (-1340.508) [-1345.558] (-1339.590) * (-1332.648) [-1340.361] (-1333.722) (-1347.228) -- 0:03:39
174000 -- [-1332.464] (-1335.423) (-1351.854) (-1348.586) * (-1331.644) (-1343.754) [-1341.356] (-1340.192) -- 0:03:38
174500 -- (-1361.432) [-1326.144] (-1338.217) (-1337.083) * (-1334.455) (-1343.081) [-1340.467] (-1347.859) -- 0:03:37
175000 -- (-1349.560) [-1332.132] (-1336.568) (-1351.838) * (-1343.795) [-1334.027] (-1335.005) (-1343.214) -- 0:03:41
Average standard deviation of split frequencies: 0.017057
175500 -- (-1340.253) (-1336.649) [-1334.233] (-1341.593) * (-1350.050) [-1334.635] (-1346.414) (-1338.996) -- 0:03:40
176000 -- (-1334.721) [-1332.344] (-1333.706) (-1342.337) * [-1336.434] (-1331.212) (-1338.391) (-1340.292) -- 0:03:40
176500 -- (-1341.150) (-1344.311) (-1339.547) [-1332.312] * (-1340.200) [-1331.356] (-1334.482) (-1348.587) -- 0:03:39
177000 -- (-1338.625) [-1333.054] (-1337.782) (-1336.167) * (-1330.468) (-1344.567) [-1327.913] (-1349.733) -- 0:03:38
177500 -- (-1348.530) (-1333.522) (-1336.099) [-1337.987] * (-1332.945) [-1336.875] (-1334.367) (-1351.893) -- 0:03:37
178000 -- (-1330.324) (-1334.771) [-1328.409] (-1336.887) * [-1331.640] (-1338.477) (-1337.288) (-1349.175) -- 0:03:37
178500 -- (-1342.263) [-1335.441] (-1339.724) (-1338.422) * (-1337.204) [-1336.532] (-1337.655) (-1341.563) -- 0:03:36
179000 -- (-1339.057) (-1345.894) [-1330.266] (-1335.719) * (-1337.166) [-1334.100] (-1328.574) (-1330.189) -- 0:03:40
179500 -- (-1342.128) (-1335.198) (-1337.440) [-1328.023] * (-1339.441) (-1354.000) [-1330.312] (-1336.683) -- 0:03:39
180000 -- [-1329.050] (-1347.744) (-1337.982) (-1339.820) * (-1333.776) [-1329.675] (-1346.466) (-1337.714) -- 0:03:38
Average standard deviation of split frequencies: 0.017303
180500 -- (-1346.554) (-1349.158) (-1338.722) [-1337.550] * (-1336.191) (-1339.543) (-1355.856) [-1340.754] -- 0:03:37
181000 -- [-1336.517] (-1349.343) (-1342.611) (-1338.269) * [-1336.875] (-1341.036) (-1346.928) (-1343.704) -- 0:03:37
181500 -- [-1337.222] (-1340.383) (-1343.253) (-1343.019) * (-1340.884) (-1340.055) (-1349.114) [-1336.300] -- 0:03:36
182000 -- [-1345.401] (-1343.916) (-1339.910) (-1345.834) * (-1335.142) (-1337.986) [-1347.598] (-1348.375) -- 0:03:35
182500 -- [-1340.523] (-1342.488) (-1339.064) (-1332.250) * (-1331.428) (-1344.227) (-1343.143) [-1337.632] -- 0:03:39
183000 -- (-1341.138) (-1335.029) (-1346.801) [-1335.768] * (-1340.287) [-1337.072] (-1341.255) (-1340.357) -- 0:03:38
183500 -- (-1336.888) [-1332.295] (-1333.476) (-1332.685) * (-1331.521) (-1340.618) (-1345.202) [-1340.903] -- 0:03:38
184000 -- (-1337.248) (-1339.856) (-1335.914) [-1332.203] * [-1336.716] (-1348.186) (-1349.080) (-1334.818) -- 0:03:37
184500 -- (-1337.660) (-1350.387) (-1335.902) [-1340.911] * (-1344.549) [-1327.520] (-1347.546) (-1335.310) -- 0:03:36
185000 -- (-1338.504) [-1341.521] (-1337.295) (-1337.282) * (-1337.064) (-1336.294) (-1359.201) [-1335.772] -- 0:03:35
Average standard deviation of split frequencies: 0.015629
185500 -- [-1332.437] (-1350.581) (-1336.342) (-1344.332) * (-1335.934) (-1343.874) (-1340.766) [-1332.667] -- 0:03:35
186000 -- (-1343.765) (-1350.074) [-1338.707] (-1334.079) * (-1346.007) (-1336.029) [-1333.547] (-1339.271) -- 0:03:34
186500 -- (-1341.401) (-1344.708) [-1331.890] (-1332.797) * [-1338.882] (-1339.337) (-1338.780) (-1353.183) -- 0:03:38
187000 -- (-1340.840) [-1336.854] (-1336.789) (-1340.112) * (-1334.863) (-1331.330) (-1342.941) [-1336.540] -- 0:03:37
187500 -- (-1342.919) (-1347.930) (-1342.842) [-1339.342] * [-1334.204] (-1331.131) (-1332.150) (-1349.029) -- 0:03:36
188000 -- (-1334.792) [-1338.685] (-1339.267) (-1349.645) * (-1339.212) (-1333.002) [-1338.253] (-1337.900) -- 0:03:35
188500 -- (-1345.449) (-1336.078) (-1335.471) [-1344.899] * (-1344.022) [-1334.797] (-1348.120) (-1341.329) -- 0:03:35
189000 -- [-1333.577] (-1332.770) (-1336.247) (-1334.279) * [-1337.834] (-1342.325) (-1341.016) (-1343.595) -- 0:03:34
189500 -- (-1343.424) (-1331.544) (-1336.186) [-1339.163] * (-1335.400) (-1335.327) [-1346.397] (-1339.192) -- 0:03:33
190000 -- (-1334.916) [-1341.269] (-1339.851) (-1337.274) * (-1339.404) [-1325.705] (-1339.338) (-1333.291) -- 0:03:37
Average standard deviation of split frequencies: 0.015796
190500 -- [-1335.480] (-1331.576) (-1350.725) (-1340.309) * (-1335.041) [-1331.113] (-1337.701) (-1343.890) -- 0:03:36
191000 -- (-1342.861) (-1333.091) (-1354.446) [-1328.455] * [-1342.874] (-1338.781) (-1340.390) (-1336.914) -- 0:03:36
191500 -- (-1334.854) (-1338.326) (-1343.261) [-1338.807] * (-1339.247) (-1333.984) [-1329.935] (-1343.348) -- 0:03:35
192000 -- (-1337.820) (-1340.517) (-1341.398) [-1334.665] * (-1339.741) (-1344.271) [-1336.052] (-1335.080) -- 0:03:34
192500 -- (-1342.805) (-1339.394) (-1340.561) [-1338.337] * (-1341.927) (-1335.760) (-1332.964) [-1334.908] -- 0:03:33
193000 -- (-1335.725) (-1344.574) (-1350.219) [-1334.564] * (-1343.429) (-1343.278) [-1336.958] (-1337.563) -- 0:03:33
193500 -- (-1348.156) (-1348.899) [-1338.964] (-1340.664) * (-1349.374) (-1339.062) [-1339.683] (-1345.486) -- 0:03:32
194000 -- (-1339.051) [-1340.643] (-1345.513) (-1336.672) * (-1340.418) (-1345.013) (-1345.002) [-1348.584] -- 0:03:36
194500 -- [-1330.745] (-1343.505) (-1337.005) (-1344.312) * (-1339.849) (-1338.707) (-1326.567) [-1327.751] -- 0:03:35
195000 -- [-1339.449] (-1338.796) (-1345.307) (-1345.421) * (-1340.831) (-1341.925) (-1338.424) [-1330.634] -- 0:03:34
Average standard deviation of split frequencies: 0.017469
195500 -- (-1342.874) (-1329.616) (-1346.951) [-1330.703] * (-1344.821) [-1329.902] (-1346.343) (-1333.837) -- 0:03:33
196000 -- (-1346.999) (-1333.573) [-1336.042] (-1337.396) * (-1335.040) (-1327.699) (-1341.469) [-1346.550] -- 0:03:33
196500 -- (-1361.636) (-1333.330) (-1353.262) [-1329.721] * (-1334.991) (-1333.595) [-1336.679] (-1334.766) -- 0:03:32
197000 -- (-1346.335) (-1328.852) (-1332.502) [-1334.637] * (-1342.983) [-1336.694] (-1349.936) (-1340.442) -- 0:03:31
197500 -- (-1330.550) (-1342.381) (-1336.397) [-1343.503] * (-1337.609) (-1339.171) (-1343.668) [-1338.354] -- 0:03:31
198000 -- (-1337.630) (-1339.125) [-1333.778] (-1347.913) * (-1333.759) [-1333.288] (-1343.634) (-1339.607) -- 0:03:34
198500 -- (-1336.752) (-1341.530) (-1342.510) [-1335.702] * [-1334.180] (-1341.846) (-1331.624) (-1341.999) -- 0:03:34
199000 -- (-1345.474) [-1331.766] (-1338.373) (-1337.222) * (-1335.622) (-1345.605) (-1338.018) [-1336.138] -- 0:03:33
199500 -- (-1337.657) (-1330.241) (-1341.389) [-1333.029] * (-1339.491) (-1342.352) [-1340.740] (-1335.897) -- 0:03:32
200000 -- (-1335.891) [-1335.914] (-1336.990) (-1335.872) * (-1343.184) (-1351.337) (-1339.226) [-1333.007] -- 0:03:32
Average standard deviation of split frequencies: 0.015792
200500 -- [-1338.314] (-1348.592) (-1338.001) (-1341.634) * (-1351.836) (-1341.964) [-1332.414] (-1341.899) -- 0:03:31
201000 -- (-1330.870) [-1334.670] (-1343.580) (-1344.294) * (-1351.655) (-1344.174) [-1331.521] (-1342.201) -- 0:03:30
201500 -- (-1335.621) (-1352.682) [-1334.991] (-1340.309) * [-1339.943] (-1351.516) (-1338.335) (-1348.834) -- 0:03:33
202000 -- [-1330.897] (-1345.551) (-1344.622) (-1334.988) * (-1341.537) (-1345.212) [-1342.523] (-1342.114) -- 0:03:33
202500 -- (-1331.978) (-1338.253) [-1335.682] (-1349.864) * [-1347.403] (-1351.770) (-1349.818) (-1343.423) -- 0:03:32
203000 -- (-1330.641) (-1337.435) (-1332.363) [-1341.967] * [-1328.704] (-1334.457) (-1345.586) (-1346.963) -- 0:03:32
203500 -- (-1341.244) (-1340.576) [-1336.603] (-1338.983) * (-1335.529) (-1342.307) (-1341.809) [-1340.801] -- 0:03:31
204000 -- (-1330.645) (-1350.908) (-1342.955) [-1331.682] * (-1342.872) (-1335.446) (-1361.249) [-1340.463] -- 0:03:30
204500 -- (-1334.578) (-1350.775) [-1332.082] (-1341.202) * [-1337.663] (-1342.804) (-1338.241) (-1333.804) -- 0:03:30
205000 -- (-1334.502) (-1342.107) (-1347.949) [-1332.761] * (-1349.051) (-1335.118) [-1333.713] (-1341.429) -- 0:03:29
Average standard deviation of split frequencies: 0.016527
205500 -- (-1344.559) (-1346.077) [-1333.117] (-1337.658) * (-1340.468) (-1337.283) (-1330.916) [-1333.153] -- 0:03:32
206000 -- [-1336.496] (-1343.822) (-1346.412) (-1341.541) * (-1341.909) (-1342.334) [-1334.239] (-1340.301) -- 0:03:31
206500 -- (-1335.706) [-1333.585] (-1340.532) (-1342.069) * (-1345.780) (-1351.613) [-1337.192] (-1345.677) -- 0:03:31
207000 -- [-1341.986] (-1352.572) (-1336.207) (-1354.110) * (-1339.311) (-1348.234) [-1336.744] (-1336.988) -- 0:03:30
207500 -- (-1340.489) (-1338.571) [-1336.058] (-1335.346) * (-1336.924) (-1348.470) [-1335.163] (-1336.329) -- 0:03:30
208000 -- (-1346.190) (-1335.991) [-1335.029] (-1340.906) * (-1336.980) (-1354.282) (-1332.601) [-1336.761] -- 0:03:29
208500 -- [-1336.510] (-1327.922) (-1331.656) (-1344.346) * (-1343.386) (-1353.900) [-1332.838] (-1337.614) -- 0:03:28
209000 -- (-1348.236) (-1325.739) (-1345.169) [-1333.151] * [-1337.134] (-1351.078) (-1336.046) (-1348.858) -- 0:03:28
209500 -- (-1345.499) [-1336.030] (-1332.699) (-1363.984) * (-1342.838) (-1342.696) [-1326.366] (-1347.890) -- 0:03:31
210000 -- [-1334.633] (-1343.033) (-1331.419) (-1338.810) * (-1339.600) (-1338.686) [-1334.126] (-1344.651) -- 0:03:30
Average standard deviation of split frequencies: 0.016410
210500 -- (-1341.860) (-1333.167) (-1337.089) [-1336.336] * [-1336.400] (-1332.292) (-1343.542) (-1337.940) -- 0:03:30
211000 -- (-1340.647) (-1335.668) (-1346.658) [-1333.889] * [-1333.603] (-1350.847) (-1338.523) (-1337.030) -- 0:03:29
211500 -- (-1345.761) [-1338.594] (-1348.502) (-1338.356) * [-1338.644] (-1341.693) (-1339.412) (-1333.888) -- 0:03:28
212000 -- [-1329.668] (-1334.645) (-1343.493) (-1348.033) * [-1333.771] (-1346.913) (-1343.568) (-1346.742) -- 0:03:28
212500 -- [-1333.720] (-1339.003) (-1340.076) (-1338.088) * (-1340.579) (-1340.331) [-1335.518] (-1333.326) -- 0:03:27
213000 -- (-1350.986) (-1333.122) (-1338.432) [-1329.788] * (-1342.760) (-1334.949) (-1339.419) [-1338.586] -- 0:03:30
213500 -- [-1345.576] (-1337.732) (-1340.947) (-1339.568) * (-1338.620) [-1337.865] (-1343.173) (-1333.896) -- 0:03:29
214000 -- (-1341.524) [-1336.800] (-1329.568) (-1339.870) * (-1343.108) [-1332.345] (-1344.345) (-1337.506) -- 0:03:29
214500 -- [-1332.689] (-1355.111) (-1344.932) (-1339.150) * (-1348.594) (-1345.734) (-1345.386) [-1341.744] -- 0:03:28
215000 -- (-1342.806) (-1333.616) (-1336.255) [-1338.407] * (-1338.759) (-1327.680) (-1328.758) [-1339.447] -- 0:03:28
Average standard deviation of split frequencies: 0.015622
215500 -- (-1338.004) (-1340.416) (-1331.406) [-1336.267] * (-1348.557) (-1329.323) [-1331.782] (-1333.591) -- 0:03:27
216000 -- [-1337.070] (-1343.197) (-1339.198) (-1339.200) * (-1345.455) (-1335.122) [-1339.280] (-1339.209) -- 0:03:26
216500 -- (-1334.117) (-1344.420) [-1333.505] (-1343.507) * (-1342.777) [-1336.791] (-1334.890) (-1330.901) -- 0:03:26
217000 -- (-1342.205) (-1335.238) [-1342.318] (-1348.830) * (-1348.473) (-1338.259) (-1339.210) [-1331.763] -- 0:03:29
217500 -- (-1339.628) (-1341.405) (-1333.880) [-1343.578] * (-1342.052) [-1329.061] (-1334.975) (-1338.723) -- 0:03:28
218000 -- [-1337.397] (-1336.066) (-1334.464) (-1351.724) * [-1333.743] (-1332.096) (-1353.255) (-1334.952) -- 0:03:28
218500 -- (-1338.577) [-1334.690] (-1339.210) (-1339.944) * (-1344.416) [-1341.521] (-1339.429) (-1340.902) -- 0:03:27
219000 -- (-1345.840) (-1345.088) [-1338.265] (-1335.193) * (-1340.622) [-1332.621] (-1344.993) (-1349.779) -- 0:03:26
219500 -- (-1353.429) [-1336.674] (-1348.854) (-1351.332) * (-1335.487) [-1326.152] (-1342.641) (-1336.910) -- 0:03:26
220000 -- (-1334.231) (-1341.992) [-1327.316] (-1349.432) * (-1338.689) [-1331.802] (-1338.284) (-1358.101) -- 0:03:25
Average standard deviation of split frequencies: 0.013605
220500 -- (-1336.526) [-1341.647] (-1333.914) (-1340.737) * (-1338.736) [-1335.549] (-1341.789) (-1353.017) -- 0:03:25
221000 -- (-1345.174) (-1339.823) [-1338.800] (-1337.726) * (-1333.817) (-1340.091) [-1342.993] (-1344.919) -- 0:03:27
221500 -- (-1329.868) (-1346.566) (-1331.421) [-1335.136] * [-1341.274] (-1344.439) (-1338.187) (-1340.293) -- 0:03:27
222000 -- (-1338.263) [-1347.269] (-1340.233) (-1349.988) * (-1332.783) (-1337.046) [-1337.586] (-1336.627) -- 0:03:26
222500 -- (-1339.921) [-1335.650] (-1333.559) (-1339.457) * (-1342.417) (-1332.207) [-1341.918] (-1348.377) -- 0:03:26
223000 -- (-1342.535) [-1342.121] (-1338.248) (-1353.037) * (-1345.548) [-1332.370] (-1342.576) (-1333.971) -- 0:03:25
223500 -- [-1335.775] (-1333.265) (-1334.364) (-1342.994) * [-1328.671] (-1337.054) (-1337.811) (-1341.731) -- 0:03:24
224000 -- (-1333.681) (-1337.787) [-1332.379] (-1338.814) * (-1335.724) [-1332.544] (-1335.435) (-1340.578) -- 0:03:24
224500 -- [-1334.843] (-1342.894) (-1339.165) (-1341.965) * [-1340.420] (-1342.950) (-1331.559) (-1340.589) -- 0:03:27
225000 -- (-1339.313) (-1337.801) [-1331.714] (-1344.671) * (-1340.468) [-1330.713] (-1333.848) (-1349.008) -- 0:03:26
Average standard deviation of split frequencies: 0.014914
225500 -- (-1344.194) (-1356.751) (-1332.051) [-1339.453] * [-1328.012] (-1335.865) (-1336.452) (-1338.695) -- 0:03:26
226000 -- (-1338.044) [-1344.197] (-1336.669) (-1339.377) * (-1339.203) (-1335.480) (-1338.968) [-1332.976] -- 0:03:25
226500 -- (-1360.847) [-1337.030] (-1338.766) (-1336.738) * [-1336.856] (-1340.726) (-1343.959) (-1340.972) -- 0:03:24
227000 -- (-1354.462) (-1336.041) (-1335.108) [-1334.339] * [-1337.204] (-1335.010) (-1338.384) (-1349.254) -- 0:03:24
227500 -- (-1345.272) (-1334.444) (-1344.154) [-1345.017] * (-1332.269) [-1331.383] (-1340.198) (-1336.418) -- 0:03:23
228000 -- (-1344.797) (-1336.911) (-1335.029) [-1336.628] * (-1338.599) (-1337.352) [-1337.303] (-1343.168) -- 0:03:23
228500 -- (-1344.720) [-1330.871] (-1334.835) (-1338.815) * (-1341.473) (-1342.650) (-1340.513) [-1339.647] -- 0:03:25
229000 -- (-1347.269) (-1336.590) [-1343.725] (-1344.574) * (-1334.319) (-1341.605) [-1330.719] (-1345.343) -- 0:03:25
229500 -- (-1341.866) (-1334.141) [-1339.809] (-1345.265) * [-1330.795] (-1329.023) (-1334.824) (-1335.883) -- 0:03:24
230000 -- (-1365.032) [-1334.977] (-1340.634) (-1351.498) * [-1329.488] (-1343.586) (-1350.434) (-1340.299) -- 0:03:24
Average standard deviation of split frequencies: 0.015941
230500 -- (-1342.091) [-1337.739] (-1361.347) (-1347.532) * (-1336.165) [-1333.946] (-1345.674) (-1335.933) -- 0:03:23
231000 -- (-1334.834) [-1336.519] (-1340.149) (-1350.065) * (-1344.293) (-1338.711) (-1350.862) [-1352.030] -- 0:03:23
231500 -- (-1330.368) [-1330.519] (-1334.481) (-1355.094) * (-1338.873) [-1338.673] (-1369.466) (-1329.793) -- 0:03:22
232000 -- (-1339.352) (-1333.547) (-1342.004) [-1349.198] * [-1334.398] (-1346.047) (-1338.972) (-1338.625) -- 0:03:21
232500 -- [-1334.020] (-1340.046) (-1340.744) (-1343.434) * (-1344.221) (-1347.663) [-1341.167] (-1337.325) -- 0:03:24
233000 -- (-1348.494) (-1356.141) [-1337.110] (-1341.598) * (-1342.968) (-1336.032) (-1346.686) [-1335.692] -- 0:03:24
233500 -- [-1329.759] (-1352.006) (-1335.349) (-1339.681) * (-1364.309) (-1335.490) (-1345.545) [-1336.633] -- 0:03:23
234000 -- (-1336.526) (-1354.627) [-1335.468] (-1344.648) * (-1347.368) [-1335.266] (-1345.215) (-1338.547) -- 0:03:22
234500 -- (-1330.837) (-1341.739) [-1336.640] (-1344.345) * (-1343.897) (-1345.737) (-1338.848) [-1333.860] -- 0:03:22
235000 -- (-1333.578) (-1354.578) (-1341.949) [-1337.165] * (-1340.854) [-1335.091] (-1341.421) (-1328.334) -- 0:03:21
Average standard deviation of split frequencies: 0.016279
235500 -- [-1336.225] (-1347.143) (-1340.855) (-1334.375) * (-1345.581) [-1330.796] (-1351.705) (-1334.453) -- 0:03:21
236000 -- (-1337.807) (-1345.490) (-1330.993) [-1332.090] * (-1350.384) [-1336.029] (-1348.237) (-1340.749) -- 0:03:23
236500 -- (-1346.250) (-1344.926) (-1331.736) [-1338.873] * (-1333.131) (-1339.170) [-1342.686] (-1343.844) -- 0:03:23
237000 -- (-1342.238) (-1343.183) [-1337.419] (-1344.816) * (-1330.638) (-1342.005) [-1339.269] (-1339.822) -- 0:03:22
237500 -- (-1343.676) (-1347.340) [-1335.944] (-1331.450) * (-1345.302) (-1341.035) (-1340.666) [-1337.364] -- 0:03:22
238000 -- (-1347.122) (-1348.939) [-1334.894] (-1339.508) * (-1333.866) (-1343.558) (-1352.553) [-1333.308] -- 0:03:21
238500 -- (-1340.656) (-1346.461) (-1339.794) [-1338.719] * (-1332.208) (-1340.941) (-1337.839) [-1336.651] -- 0:03:21
239000 -- (-1333.055) (-1342.433) [-1350.378] (-1350.527) * (-1337.560) (-1330.802) (-1335.192) [-1336.418] -- 0:03:20
239500 -- (-1337.831) (-1343.418) [-1337.634] (-1335.347) * (-1339.735) (-1337.638) [-1338.572] (-1343.764) -- 0:03:20
240000 -- [-1338.509] (-1344.613) (-1336.653) (-1343.853) * (-1337.401) [-1334.238] (-1349.797) (-1341.926) -- 0:03:22
Average standard deviation of split frequencies: 0.016160
240500 -- [-1332.386] (-1333.016) (-1336.480) (-1337.489) * (-1339.318) (-1344.382) [-1335.259] (-1341.720) -- 0:03:22
241000 -- (-1342.787) (-1331.993) [-1340.605] (-1339.782) * (-1340.601) (-1337.819) (-1350.579) [-1335.754] -- 0:03:21
241500 -- [-1335.146] (-1338.159) (-1339.333) (-1335.230) * (-1342.995) (-1335.182) (-1345.147) [-1335.201] -- 0:03:21
242000 -- [-1339.257] (-1340.399) (-1345.282) (-1327.953) * [-1333.165] (-1338.859) (-1344.409) (-1332.836) -- 0:03:20
242500 -- (-1338.024) [-1344.144] (-1340.771) (-1340.539) * (-1336.350) (-1342.828) [-1335.130] (-1337.607) -- 0:03:19
243000 -- (-1347.160) (-1341.838) [-1334.676] (-1347.002) * (-1334.888) (-1339.627) (-1337.006) [-1338.888] -- 0:03:19
243500 -- (-1333.076) (-1344.567) (-1336.774) [-1328.251] * (-1332.869) (-1344.306) (-1338.619) [-1333.044] -- 0:03:21
244000 -- [-1339.352] (-1346.070) (-1340.256) (-1335.333) * [-1339.101] (-1339.987) (-1347.575) (-1341.388) -- 0:03:21
244500 -- (-1334.005) (-1345.307) (-1345.246) [-1339.893] * [-1332.492] (-1339.013) (-1342.558) (-1334.780) -- 0:03:20
245000 -- [-1343.846] (-1340.276) (-1352.903) (-1334.794) * [-1340.728] (-1349.709) (-1337.452) (-1345.121) -- 0:03:20
Average standard deviation of split frequencies: 0.015935
245500 -- (-1349.074) (-1345.429) (-1338.109) [-1334.092] * (-1338.121) [-1334.133] (-1335.830) (-1340.552) -- 0:03:19
246000 -- (-1342.891) (-1345.473) [-1329.429] (-1334.512) * [-1332.407] (-1338.875) (-1344.255) (-1332.774) -- 0:03:19
246500 -- (-1339.747) [-1330.979] (-1345.703) (-1336.879) * [-1338.658] (-1339.394) (-1350.974) (-1364.192) -- 0:03:18
247000 -- (-1332.096) (-1335.793) [-1337.285] (-1343.705) * (-1334.828) [-1338.308] (-1333.241) (-1332.943) -- 0:03:18
247500 -- (-1342.108) [-1333.135] (-1337.576) (-1345.144) * (-1331.669) (-1337.308) (-1334.775) [-1333.037] -- 0:03:20
248000 -- (-1343.379) (-1335.448) (-1347.095) [-1345.549] * [-1335.348] (-1336.437) (-1328.687) (-1339.844) -- 0:03:20
248500 -- (-1347.049) (-1339.965) [-1334.166] (-1341.267) * (-1345.987) (-1343.450) [-1339.890] (-1334.960) -- 0:03:19
249000 -- [-1334.045] (-1330.509) (-1336.461) (-1343.029) * (-1337.431) (-1341.220) (-1337.542) [-1341.286] -- 0:03:19
249500 -- (-1335.641) (-1330.713) [-1339.032] (-1341.010) * (-1338.366) [-1353.376] (-1332.255) (-1342.741) -- 0:03:18
250000 -- (-1337.284) [-1336.756] (-1345.061) (-1339.682) * [-1330.209] (-1338.288) (-1332.917) (-1340.492) -- 0:03:18
Average standard deviation of split frequencies: 0.014627
250500 -- (-1342.342) (-1332.054) (-1345.565) [-1345.946] * [-1337.226] (-1336.823) (-1339.653) (-1335.037) -- 0:03:17
251000 -- [-1338.983] (-1354.462) (-1335.511) (-1359.244) * (-1340.267) (-1354.439) [-1333.915] (-1340.388) -- 0:03:16
251500 -- (-1337.097) (-1343.436) [-1336.666] (-1346.380) * (-1341.474) (-1340.528) (-1353.817) [-1334.566] -- 0:03:19
252000 -- (-1344.413) (-1350.024) (-1340.436) [-1339.451] * [-1336.282] (-1344.805) (-1343.769) (-1332.741) -- 0:03:18
252500 -- (-1344.764) (-1339.519) (-1336.217) [-1333.431] * [-1338.463] (-1345.242) (-1336.477) (-1334.394) -- 0:03:18
253000 -- [-1336.694] (-1344.436) (-1340.199) (-1325.444) * (-1343.716) (-1340.020) (-1341.475) [-1340.161] -- 0:03:17
253500 -- (-1334.926) [-1338.243] (-1334.750) (-1335.411) * (-1349.518) (-1339.391) [-1339.430] (-1344.337) -- 0:03:17
254000 -- (-1342.160) (-1333.582) [-1341.671] (-1345.936) * (-1339.519) [-1337.547] (-1340.917) (-1334.222) -- 0:03:16
254500 -- (-1345.525) (-1339.195) [-1340.445] (-1336.623) * (-1344.960) (-1330.748) (-1341.048) [-1329.969] -- 0:03:16
255000 -- [-1336.591] (-1339.184) (-1336.643) (-1342.787) * (-1337.647) (-1333.752) [-1341.169] (-1348.163) -- 0:03:18
Average standard deviation of split frequencies: 0.014150
255500 -- [-1338.155] (-1333.894) (-1338.275) (-1341.388) * (-1339.726) (-1348.026) [-1338.595] (-1344.682) -- 0:03:18
256000 -- [-1338.511] (-1333.649) (-1340.418) (-1347.587) * (-1332.402) (-1336.912) [-1340.234] (-1341.125) -- 0:03:17
256500 -- [-1337.451] (-1335.529) (-1340.688) (-1335.870) * (-1339.712) (-1335.088) [-1335.202] (-1341.893) -- 0:03:17
257000 -- (-1332.730) (-1342.439) (-1346.837) [-1331.257] * (-1331.969) (-1337.405) (-1339.006) [-1339.561] -- 0:03:16
257500 -- [-1337.497] (-1337.437) (-1343.109) (-1333.021) * (-1338.415) (-1336.136) (-1334.663) [-1338.428] -- 0:03:16
258000 -- (-1330.348) [-1340.899] (-1345.099) (-1331.794) * (-1340.470) (-1348.526) [-1337.532] (-1354.847) -- 0:03:15
258500 -- (-1339.943) (-1345.603) (-1348.175) [-1331.445] * (-1334.592) (-1333.860) [-1332.895] (-1355.472) -- 0:03:15
259000 -- (-1336.637) [-1336.189] (-1337.752) (-1338.040) * (-1337.256) (-1342.992) (-1331.168) [-1339.174] -- 0:03:17
259500 -- (-1337.573) (-1337.379) [-1332.831] (-1345.245) * (-1345.206) (-1344.096) (-1334.057) [-1335.940] -- 0:03:16
260000 -- (-1331.861) (-1336.115) [-1333.313] (-1332.065) * (-1344.200) (-1343.945) (-1341.861) [-1333.049] -- 0:03:16
Average standard deviation of split frequencies: 0.013764
260500 -- (-1343.561) [-1343.011] (-1346.041) (-1337.780) * (-1348.260) (-1345.961) (-1334.078) [-1328.042] -- 0:03:15
261000 -- (-1335.984) (-1335.952) [-1331.456] (-1344.686) * (-1355.300) (-1353.299) [-1329.805] (-1338.168) -- 0:03:15
261500 -- (-1329.672) (-1339.912) (-1347.898) [-1332.714] * (-1356.498) [-1336.050] (-1338.872) (-1340.120) -- 0:03:14
262000 -- [-1338.493] (-1335.581) (-1332.240) (-1346.591) * (-1357.697) (-1338.162) [-1331.114] (-1342.811) -- 0:03:14
262500 -- (-1335.527) (-1336.171) (-1336.920) [-1345.797] * (-1346.591) [-1339.591] (-1333.028) (-1337.668) -- 0:03:16
263000 -- (-1343.656) (-1347.175) (-1343.219) [-1339.967] * (-1348.390) [-1338.655] (-1337.629) (-1336.773) -- 0:03:16
263500 -- (-1333.262) (-1336.962) [-1337.024] (-1338.715) * (-1347.758) [-1334.242] (-1336.642) (-1335.727) -- 0:03:15
264000 -- (-1336.083) (-1340.070) (-1347.982) [-1337.789] * (-1345.085) [-1335.761] (-1337.830) (-1341.707) -- 0:03:15
264500 -- (-1334.412) [-1336.255] (-1336.232) (-1340.216) * (-1330.399) [-1338.849] (-1348.273) (-1328.970) -- 0:03:14
265000 -- [-1336.327] (-1328.310) (-1341.242) (-1331.608) * [-1334.772] (-1338.654) (-1338.678) (-1341.476) -- 0:03:14
Average standard deviation of split frequencies: 0.012872
265500 -- [-1336.386] (-1332.702) (-1336.498) (-1334.784) * [-1337.826] (-1335.054) (-1333.781) (-1341.047) -- 0:03:13
266000 -- (-1333.213) (-1336.718) [-1335.718] (-1335.404) * (-1334.078) (-1350.193) [-1338.619] (-1332.227) -- 0:03:13
266500 -- [-1339.851] (-1346.895) (-1334.221) (-1342.713) * (-1335.252) [-1335.100] (-1336.962) (-1337.358) -- 0:03:15
267000 -- (-1345.057) (-1344.866) (-1347.678) [-1340.727] * [-1332.420] (-1334.630) (-1339.307) (-1339.120) -- 0:03:14
267500 -- (-1338.789) (-1339.976) (-1345.861) [-1337.811] * (-1336.737) (-1345.061) [-1332.343] (-1339.460) -- 0:03:14
268000 -- [-1340.285] (-1335.645) (-1341.650) (-1335.630) * (-1341.290) (-1340.937) (-1343.741) [-1341.697] -- 0:03:13
268500 -- (-1339.406) [-1335.814] (-1336.942) (-1332.565) * (-1338.380) [-1345.198] (-1343.104) (-1343.070) -- 0:03:13
269000 -- [-1344.808] (-1339.811) (-1337.274) (-1332.628) * [-1336.445] (-1337.856) (-1339.625) (-1348.659) -- 0:03:12
269500 -- [-1336.686] (-1338.970) (-1331.613) (-1347.010) * (-1335.907) (-1341.981) (-1348.336) [-1339.521] -- 0:03:12
270000 -- (-1336.708) [-1336.716] (-1338.193) (-1341.738) * (-1337.396) [-1332.472] (-1343.975) (-1337.958) -- 0:03:11
Average standard deviation of split frequencies: 0.014610
270500 -- (-1338.356) (-1335.658) (-1338.744) [-1338.430] * (-1337.861) [-1344.303] (-1341.377) (-1352.663) -- 0:03:14
271000 -- (-1330.944) (-1338.953) [-1329.800] (-1336.561) * (-1339.543) (-1335.013) [-1329.025] (-1340.643) -- 0:03:13
271500 -- (-1330.968) (-1338.626) (-1334.537) [-1341.426] * [-1336.571] (-1334.653) (-1350.135) (-1342.053) -- 0:03:13
272000 -- [-1330.132] (-1343.424) (-1341.287) (-1342.896) * (-1337.828) (-1344.140) (-1334.263) [-1335.262] -- 0:03:12
272500 -- (-1338.662) [-1342.168] (-1333.346) (-1339.076) * (-1338.606) [-1344.112] (-1332.082) (-1346.012) -- 0:03:12
273000 -- [-1329.389] (-1348.033) (-1330.250) (-1332.544) * [-1332.934] (-1337.748) (-1337.087) (-1338.497) -- 0:03:11
273500 -- (-1337.929) [-1344.573] (-1341.129) (-1345.317) * [-1330.157] (-1340.168) (-1332.451) (-1340.029) -- 0:03:11
274000 -- (-1340.097) (-1349.544) (-1332.073) [-1336.753] * (-1346.077) (-1346.372) [-1339.327] (-1334.058) -- 0:03:13
274500 -- (-1345.157) (-1337.102) [-1336.150] (-1342.530) * [-1336.642] (-1340.011) (-1343.191) (-1341.291) -- 0:03:12
275000 -- (-1337.580) [-1329.743] (-1355.045) (-1344.194) * (-1340.676) (-1339.660) [-1332.585] (-1345.387) -- 0:03:12
Average standard deviation of split frequencies: 0.013949
275500 -- [-1336.667] (-1345.361) (-1340.672) (-1335.110) * [-1331.980] (-1339.594) (-1341.442) (-1341.212) -- 0:03:11
276000 -- (-1345.498) (-1338.284) (-1336.719) [-1328.343] * (-1336.702) (-1343.244) (-1340.714) [-1342.053] -- 0:03:11
276500 -- (-1337.629) [-1332.883] (-1328.715) (-1347.727) * (-1343.272) (-1345.178) (-1343.460) [-1338.684] -- 0:03:11
277000 -- (-1335.983) (-1335.043) [-1338.108] (-1334.811) * (-1331.848) (-1343.055) (-1339.230) [-1341.327] -- 0:03:10
277500 -- (-1338.517) (-1332.654) (-1347.175) [-1344.575] * [-1333.801] (-1340.350) (-1338.126) (-1349.932) -- 0:03:10
278000 -- (-1340.449) (-1330.183) [-1332.918] (-1344.162) * (-1336.353) (-1337.108) [-1330.738] (-1358.549) -- 0:03:12
278500 -- [-1335.694] (-1343.473) (-1341.941) (-1334.034) * (-1337.968) (-1344.640) [-1338.333] (-1348.448) -- 0:03:11
279000 -- (-1345.372) (-1334.681) [-1335.982] (-1332.186) * [-1335.594] (-1356.824) (-1338.933) (-1352.333) -- 0:03:11
279500 -- (-1336.726) (-1341.382) [-1333.963] (-1329.043) * (-1345.182) [-1334.858] (-1343.899) (-1347.641) -- 0:03:10
280000 -- (-1344.755) (-1337.169) (-1344.441) [-1338.921] * (-1345.399) (-1331.606) [-1336.836] (-1353.332) -- 0:03:10
Average standard deviation of split frequencies: 0.013343
280500 -- (-1341.179) [-1332.730] (-1342.991) (-1348.658) * (-1346.641) [-1328.992] (-1331.951) (-1342.203) -- 0:03:09
281000 -- (-1343.611) [-1336.446] (-1335.583) (-1335.611) * (-1348.142) (-1339.104) (-1332.008) [-1341.968] -- 0:03:09
281500 -- (-1340.100) [-1330.040] (-1339.652) (-1347.665) * (-1342.006) [-1334.558] (-1326.102) (-1346.554) -- 0:03:11
282000 -- [-1332.279] (-1333.648) (-1349.919) (-1341.260) * (-1341.532) (-1335.946) [-1333.812] (-1346.055) -- 0:03:10
282500 -- [-1337.333] (-1334.497) (-1339.899) (-1340.023) * [-1333.583] (-1346.317) (-1342.974) (-1349.522) -- 0:03:10
283000 -- [-1332.976] (-1339.538) (-1344.063) (-1339.970) * (-1354.218) [-1338.556] (-1345.481) (-1354.495) -- 0:03:10
283500 -- (-1341.472) [-1341.514] (-1342.183) (-1337.822) * (-1346.888) (-1340.989) [-1333.993] (-1344.662) -- 0:03:09
284000 -- (-1342.303) (-1348.644) [-1337.808] (-1345.767) * [-1330.923] (-1341.678) (-1345.938) (-1352.700) -- 0:03:09
284500 -- (-1342.915) [-1341.534] (-1337.174) (-1337.601) * (-1343.688) (-1341.943) [-1336.567] (-1347.363) -- 0:03:08
285000 -- (-1338.474) (-1336.915) (-1333.367) [-1327.829] * (-1338.997) (-1347.468) [-1335.200] (-1339.179) -- 0:03:08
Average standard deviation of split frequencies: 0.012728
285500 -- (-1339.863) (-1336.427) [-1341.814] (-1330.424) * (-1344.034) (-1340.738) [-1338.222] (-1336.707) -- 0:03:10
286000 -- (-1337.244) (-1343.513) (-1326.595) [-1331.014] * (-1353.399) (-1345.506) [-1345.187] (-1343.261) -- 0:03:09
286500 -- (-1341.757) (-1342.424) [-1329.306] (-1348.571) * [-1339.294] (-1351.562) (-1334.955) (-1338.681) -- 0:03:09
287000 -- (-1342.946) [-1337.271] (-1338.473) (-1347.574) * (-1333.836) (-1337.315) (-1337.199) [-1342.995] -- 0:03:08
287500 -- [-1337.657] (-1346.795) (-1336.841) (-1339.120) * [-1339.546] (-1350.863) (-1342.435) (-1340.513) -- 0:03:08
288000 -- (-1342.526) (-1335.034) (-1331.057) [-1336.997] * (-1342.846) (-1346.257) [-1337.250] (-1340.093) -- 0:03:07
288500 -- [-1334.346] (-1338.951) (-1333.309) (-1335.381) * (-1341.075) (-1342.602) (-1332.099) [-1338.375] -- 0:03:07
289000 -- (-1340.964) [-1341.741] (-1336.764) (-1338.065) * [-1336.714] (-1346.377) (-1340.519) (-1347.620) -- 0:03:06
289500 -- [-1331.734] (-1340.960) (-1340.402) (-1341.303) * [-1334.212] (-1352.767) (-1339.063) (-1337.223) -- 0:03:08
290000 -- [-1337.233] (-1333.354) (-1345.200) (-1350.253) * (-1337.986) [-1335.686] (-1341.536) (-1335.098) -- 0:03:08
Average standard deviation of split frequencies: 0.012614
290500 -- [-1332.097] (-1332.127) (-1337.053) (-1341.081) * [-1328.554] (-1333.280) (-1358.126) (-1343.182) -- 0:03:08
291000 -- (-1343.164) [-1338.917] (-1340.591) (-1353.286) * [-1341.185] (-1335.579) (-1350.441) (-1331.861) -- 0:03:07
291500 -- (-1343.413) (-1336.535) (-1341.189) [-1325.096] * (-1349.217) (-1341.006) (-1337.629) [-1334.235] -- 0:03:07
292000 -- [-1337.369] (-1336.745) (-1339.743) (-1332.550) * (-1340.919) [-1334.339] (-1338.920) (-1331.493) -- 0:03:06
292500 -- (-1342.634) [-1336.716] (-1338.076) (-1333.812) * (-1338.737) (-1339.711) [-1338.977] (-1340.374) -- 0:03:06
293000 -- (-1346.772) [-1330.283] (-1337.788) (-1344.248) * (-1347.323) (-1338.495) (-1341.170) [-1336.966] -- 0:03:08
293500 -- (-1338.402) (-1344.613) (-1340.728) [-1332.551] * [-1337.631] (-1341.760) (-1338.618) (-1348.674) -- 0:03:07
294000 -- (-1334.893) [-1331.969] (-1341.901) (-1331.277) * (-1336.537) (-1335.610) [-1335.620] (-1350.557) -- 0:03:07
294500 -- (-1335.868) [-1331.062] (-1340.112) (-1343.842) * (-1341.307) (-1339.284) (-1338.716) [-1338.438] -- 0:03:06
295000 -- [-1337.331] (-1332.440) (-1338.068) (-1336.867) * (-1339.846) (-1329.916) (-1338.275) [-1331.628] -- 0:03:06
Average standard deviation of split frequencies: 0.013830
295500 -- (-1340.147) (-1351.086) (-1336.079) [-1338.907] * (-1347.966) (-1341.094) [-1335.143] (-1343.312) -- 0:03:05
296000 -- (-1336.839) [-1329.739] (-1335.422) (-1344.467) * [-1335.940] (-1341.646) (-1333.972) (-1341.480) -- 0:03:05
296500 -- (-1349.493) [-1334.384] (-1341.142) (-1344.219) * [-1341.293] (-1341.369) (-1337.665) (-1333.961) -- 0:03:05
297000 -- (-1340.307) (-1342.423) (-1338.013) [-1337.779] * (-1342.950) (-1340.765) (-1341.786) [-1338.281] -- 0:03:06
297500 -- [-1337.101] (-1334.937) (-1343.025) (-1350.235) * (-1349.342) (-1344.144) [-1337.960] (-1332.075) -- 0:03:06
298000 -- [-1331.369] (-1345.579) (-1345.547) (-1335.539) * (-1334.670) [-1341.627] (-1339.352) (-1336.634) -- 0:03:06
298500 -- (-1338.318) (-1338.478) [-1332.465] (-1337.491) * (-1349.821) (-1344.746) (-1337.497) [-1335.828] -- 0:03:05
299000 -- [-1335.343] (-1348.596) (-1336.969) (-1346.544) * (-1344.680) (-1347.711) (-1340.789) [-1337.369] -- 0:03:05
299500 -- [-1336.489] (-1344.881) (-1336.670) (-1337.724) * (-1352.111) (-1337.211) (-1338.771) [-1338.835] -- 0:03:04
300000 -- [-1343.356] (-1343.772) (-1343.876) (-1344.440) * (-1349.782) (-1338.100) [-1335.508] (-1345.257) -- 0:03:04
Average standard deviation of split frequencies: 0.013327
300500 -- (-1336.815) (-1341.994) (-1332.371) [-1342.022] * (-1341.334) (-1341.403) (-1346.476) [-1332.341] -- 0:03:06
301000 -- (-1341.808) (-1336.686) [-1341.878] (-1338.830) * (-1352.023) (-1346.881) (-1342.030) [-1330.801] -- 0:03:05
301500 -- (-1350.524) (-1334.702) [-1334.394] (-1341.492) * (-1354.842) (-1342.409) (-1347.114) [-1333.089] -- 0:03:05
302000 -- (-1349.013) [-1336.593] (-1340.183) (-1340.369) * (-1351.449) (-1346.973) (-1343.373) [-1335.442] -- 0:03:04
302500 -- (-1345.891) (-1333.177) [-1336.178] (-1348.125) * (-1337.113) (-1341.788) (-1333.775) [-1330.721] -- 0:03:04
303000 -- [-1333.732] (-1338.300) (-1339.142) (-1333.444) * (-1338.386) (-1336.294) (-1335.176) [-1331.380] -- 0:03:04
303500 -- [-1321.610] (-1337.218) (-1339.117) (-1331.844) * (-1335.315) (-1339.213) (-1338.591) [-1329.431] -- 0:03:03
304000 -- (-1345.726) (-1343.591) (-1334.708) [-1329.972] * (-1342.809) [-1336.902] (-1341.836) (-1334.090) -- 0:03:03
304500 -- (-1343.717) (-1346.787) (-1334.963) [-1333.589] * (-1334.944) [-1334.975] (-1345.941) (-1348.381) -- 0:03:05
305000 -- (-1344.982) (-1335.895) [-1333.581] (-1331.496) * (-1350.083) [-1332.500] (-1343.010) (-1344.318) -- 0:03:04
Average standard deviation of split frequencies: 0.013437
305500 -- (-1335.476) [-1332.464] (-1337.186) (-1332.674) * [-1342.385] (-1356.716) (-1335.575) (-1338.990) -- 0:03:04
306000 -- (-1346.814) (-1333.368) (-1335.692) [-1330.272] * (-1341.714) (-1339.806) (-1335.981) [-1332.277] -- 0:03:03
306500 -- (-1347.294) (-1340.921) [-1340.737] (-1334.473) * [-1338.147] (-1344.684) (-1332.487) (-1338.082) -- 0:03:03
307000 -- (-1341.220) [-1333.892] (-1337.049) (-1345.272) * (-1346.416) [-1341.805] (-1333.228) (-1331.019) -- 0:03:02
307500 -- (-1334.026) (-1337.705) (-1337.524) [-1339.030] * [-1325.006] (-1351.299) (-1334.254) (-1336.650) -- 0:03:02
308000 -- (-1342.135) (-1341.807) (-1343.825) [-1343.081] * [-1341.815] (-1347.560) (-1330.043) (-1338.950) -- 0:03:01
308500 -- (-1336.291) [-1337.672] (-1344.898) (-1345.325) * (-1336.073) (-1340.692) (-1345.846) [-1336.509] -- 0:03:03
309000 -- (-1340.858) [-1328.713] (-1336.457) (-1337.938) * [-1333.526] (-1336.341) (-1333.775) (-1338.152) -- 0:03:03
309500 -- [-1346.735] (-1343.844) (-1345.206) (-1337.845) * (-1344.427) (-1338.766) [-1334.443] (-1337.960) -- 0:03:02
310000 -- (-1334.206) (-1348.507) [-1340.892] (-1350.554) * (-1337.512) [-1337.983] (-1339.876) (-1327.792) -- 0:03:02
Average standard deviation of split frequencies: 0.012618
310500 -- (-1342.758) [-1330.820] (-1347.458) (-1348.911) * (-1337.616) (-1336.659) (-1343.510) [-1327.011] -- 0:03:02
311000 -- (-1340.012) [-1334.505] (-1334.607) (-1347.754) * (-1336.635) (-1336.859) (-1345.593) [-1332.050] -- 0:03:01
311500 -- [-1334.695] (-1344.016) (-1338.520) (-1350.585) * (-1336.892) (-1350.876) (-1345.430) [-1336.342] -- 0:03:01
312000 -- (-1348.456) (-1338.401) [-1334.914] (-1338.354) * (-1345.082) [-1340.155] (-1346.139) (-1332.666) -- 0:03:03
312500 -- (-1351.977) [-1346.973] (-1330.633) (-1349.428) * (-1344.260) (-1336.715) (-1343.489) [-1326.664] -- 0:03:02
313000 -- [-1334.325] (-1343.730) (-1343.629) (-1339.508) * (-1327.765) (-1342.943) (-1350.524) [-1330.975] -- 0:03:02
313500 -- (-1330.424) (-1348.769) [-1333.111] (-1343.558) * (-1355.064) (-1341.291) (-1339.813) [-1341.101] -- 0:03:01
314000 -- (-1335.981) (-1339.763) (-1350.132) [-1339.421] * (-1344.050) [-1344.439] (-1342.709) (-1334.253) -- 0:03:01
314500 -- (-1334.595) (-1328.246) (-1344.830) [-1335.705] * (-1336.944) [-1334.008] (-1341.923) (-1340.822) -- 0:03:00
315000 -- [-1330.823] (-1343.675) (-1347.434) (-1340.000) * [-1338.937] (-1339.919) (-1342.092) (-1346.683) -- 0:03:00
Average standard deviation of split frequencies: 0.012484
315500 -- (-1334.289) (-1351.231) [-1341.892] (-1339.171) * (-1340.311) [-1339.222] (-1344.623) (-1343.786) -- 0:03:00
316000 -- (-1333.934) [-1342.778] (-1346.057) (-1338.723) * (-1340.499) [-1338.597] (-1348.359) (-1342.098) -- 0:03:01
316500 -- (-1343.914) [-1330.214] (-1342.215) (-1344.809) * (-1350.227) [-1340.625] (-1331.725) (-1354.965) -- 0:03:01
317000 -- (-1345.866) [-1337.578] (-1332.979) (-1339.970) * (-1340.379) (-1333.733) (-1342.756) [-1341.595] -- 0:03:00
317500 -- (-1339.559) (-1336.024) [-1338.809] (-1341.973) * (-1335.155) (-1346.006) [-1339.548] (-1341.973) -- 0:03:00
318000 -- (-1338.395) (-1346.628) (-1345.873) [-1330.097] * (-1328.342) (-1347.632) (-1333.957) [-1335.981] -- 0:03:00
318500 -- (-1335.609) (-1338.806) (-1342.825) [-1332.873] * [-1338.373] (-1337.730) (-1344.717) (-1341.307) -- 0:02:59
319000 -- (-1336.403) (-1336.170) (-1344.528) [-1330.446] * (-1356.406) [-1340.520] (-1343.535) (-1344.618) -- 0:02:59
319500 -- (-1349.714) [-1331.595] (-1341.819) (-1338.630) * (-1337.928) [-1334.975] (-1340.624) (-1349.677) -- 0:02:58
320000 -- (-1340.703) (-1333.069) (-1341.196) [-1333.807] * [-1334.012] (-1341.904) (-1333.958) (-1350.633) -- 0:03:00
Average standard deviation of split frequencies: 0.013772
320500 -- (-1343.685) [-1330.058] (-1337.076) (-1338.712) * (-1349.300) (-1340.108) (-1341.169) [-1347.334] -- 0:03:00
321000 -- (-1338.316) [-1330.326] (-1343.099) (-1334.987) * (-1346.452) (-1331.566) (-1340.476) [-1335.665] -- 0:02:59
321500 -- (-1341.324) [-1342.221] (-1334.941) (-1343.043) * (-1346.938) [-1338.983] (-1338.415) (-1336.084) -- 0:02:59
322000 -- (-1341.257) [-1338.319] (-1337.865) (-1338.073) * [-1334.692] (-1347.642) (-1338.315) (-1328.646) -- 0:02:58
322500 -- (-1335.950) (-1325.454) [-1336.149] (-1346.972) * (-1335.633) [-1336.687] (-1339.396) (-1336.643) -- 0:02:58
323000 -- (-1336.967) (-1331.432) (-1353.093) [-1332.145] * (-1339.469) [-1331.693] (-1333.461) (-1341.945) -- 0:02:58
323500 -- (-1342.512) (-1347.088) [-1329.833] (-1335.173) * (-1340.738) (-1340.105) (-1339.370) [-1338.590] -- 0:02:59
324000 -- (-1338.433) (-1343.200) (-1339.578) [-1343.161] * (-1344.087) (-1356.948) (-1339.610) [-1338.687] -- 0:02:59
324500 -- [-1340.620] (-1331.336) (-1344.806) (-1333.737) * (-1340.246) (-1346.240) [-1335.250] (-1341.917) -- 0:02:59
325000 -- (-1336.878) [-1337.411] (-1350.363) (-1340.211) * [-1330.242] (-1349.199) (-1328.343) (-1327.956) -- 0:02:58
Average standard deviation of split frequencies: 0.013090
325500 -- (-1350.376) [-1334.570] (-1333.750) (-1338.596) * (-1332.721) (-1346.807) [-1340.328] (-1342.365) -- 0:02:58
326000 -- (-1350.096) [-1334.816] (-1348.764) (-1338.342) * (-1335.240) (-1338.558) (-1339.825) [-1337.824] -- 0:02:57
326500 -- (-1341.850) (-1349.005) [-1335.971] (-1336.509) * (-1332.634) (-1338.178) (-1344.308) [-1336.308] -- 0:02:57
327000 -- (-1354.471) [-1350.777] (-1336.358) (-1340.219) * [-1330.872] (-1339.028) (-1346.197) (-1334.570) -- 0:02:56
327500 -- (-1338.599) (-1340.219) (-1353.880) [-1337.829] * [-1330.448] (-1337.738) (-1350.512) (-1343.730) -- 0:02:58
328000 -- (-1340.521) (-1350.854) (-1336.225) [-1339.387] * [-1328.743] (-1327.746) (-1340.776) (-1339.932) -- 0:02:58
328500 -- (-1341.598) [-1337.141] (-1339.496) (-1336.986) * (-1334.074) (-1341.672) [-1331.311] (-1347.937) -- 0:02:57
329000 -- (-1338.366) (-1341.189) [-1336.869] (-1347.868) * [-1343.007] (-1340.320) (-1334.035) (-1336.017) -- 0:02:57
329500 -- (-1337.234) (-1338.980) [-1338.540] (-1339.807) * (-1333.573) [-1332.543] (-1343.384) (-1335.479) -- 0:02:57
330000 -- (-1330.798) (-1344.749) [-1335.571] (-1337.219) * (-1335.573) (-1341.972) (-1332.809) [-1332.240] -- 0:02:56
Average standard deviation of split frequencies: 0.012605
330500 -- (-1329.480) [-1334.708] (-1343.751) (-1346.826) * [-1327.877] (-1336.408) (-1336.478) (-1338.772) -- 0:02:56
331000 -- (-1337.609) [-1332.135] (-1338.990) (-1349.210) * (-1337.206) [-1338.173] (-1352.613) (-1335.786) -- 0:02:55
331500 -- (-1335.146) [-1328.016] (-1333.149) (-1351.967) * (-1329.363) [-1333.146] (-1340.005) (-1333.102) -- 0:02:57
332000 -- [-1327.544] (-1330.616) (-1345.846) (-1347.498) * (-1335.782) (-1339.371) (-1346.569) [-1339.245] -- 0:02:57
332500 -- (-1335.697) [-1334.444] (-1349.592) (-1347.371) * (-1333.182) (-1338.890) (-1345.768) [-1343.489] -- 0:02:56
333000 -- (-1330.654) (-1337.042) [-1339.981] (-1350.189) * (-1338.384) (-1346.032) [-1340.835] (-1333.486) -- 0:02:56
333500 -- [-1342.677] (-1343.380) (-1336.774) (-1347.805) * (-1340.144) (-1342.777) (-1340.219) [-1336.881] -- 0:02:55
334000 -- (-1336.269) (-1343.498) (-1342.500) [-1340.288] * (-1337.799) (-1348.965) (-1334.131) [-1333.957] -- 0:02:55
334500 -- (-1346.735) (-1338.604) [-1327.938] (-1342.408) * [-1336.832] (-1333.354) (-1345.520) (-1338.009) -- 0:02:55
335000 -- (-1345.345) (-1340.458) [-1327.941] (-1330.471) * (-1327.658) (-1347.849) [-1335.049] (-1342.300) -- 0:02:56
Average standard deviation of split frequencies: 0.011962
335500 -- [-1342.977] (-1340.949) (-1335.234) (-1333.169) * (-1333.771) (-1346.461) [-1330.956] (-1343.940) -- 0:02:56
336000 -- (-1344.778) (-1345.007) [-1336.290] (-1329.015) * (-1338.939) [-1338.662] (-1328.927) (-1333.609) -- 0:02:55
336500 -- (-1343.395) (-1338.803) [-1337.585] (-1337.360) * (-1347.032) (-1341.348) [-1332.051] (-1335.619) -- 0:02:55
337000 -- (-1338.156) (-1344.963) (-1336.777) [-1338.387] * (-1341.384) (-1347.511) (-1344.810) [-1337.057] -- 0:02:55
337500 -- (-1340.534) (-1339.255) [-1337.582] (-1341.747) * (-1350.550) (-1339.155) [-1333.558] (-1350.892) -- 0:02:54
338000 -- (-1339.531) (-1349.838) (-1339.543) [-1337.594] * [-1335.692] (-1336.286) (-1336.023) (-1339.692) -- 0:02:54
338500 -- (-1339.763) (-1347.180) [-1342.124] (-1334.392) * (-1341.186) (-1353.890) (-1338.865) [-1338.982] -- 0:02:53
339000 -- [-1338.730] (-1341.221) (-1340.690) (-1338.909) * (-1348.117) (-1338.524) (-1331.725) [-1339.498] -- 0:02:55
339500 -- (-1334.131) (-1337.259) [-1334.822] (-1347.692) * (-1333.206) (-1344.771) (-1340.394) [-1337.772] -- 0:02:55
340000 -- (-1342.238) (-1339.209) (-1336.675) [-1326.259] * (-1335.262) [-1344.230] (-1332.969) (-1341.631) -- 0:02:54
Average standard deviation of split frequencies: 0.011434
340500 -- (-1337.853) [-1333.800] (-1336.779) (-1334.799) * (-1350.847) [-1328.959] (-1337.784) (-1340.601) -- 0:02:54
341000 -- (-1333.463) (-1334.377) (-1340.518) [-1336.400] * (-1329.042) [-1331.092] (-1331.001) (-1335.124) -- 0:02:53
341500 -- [-1327.630] (-1342.270) (-1334.582) (-1337.712) * (-1335.500) (-1338.011) [-1333.108] (-1344.483) -- 0:02:53
342000 -- [-1337.758] (-1341.230) (-1336.854) (-1333.850) * (-1337.947) [-1332.721] (-1340.398) (-1339.848) -- 0:02:53
342500 -- (-1343.262) (-1333.914) (-1344.280) [-1336.689] * (-1335.376) (-1339.074) (-1346.626) [-1337.291] -- 0:02:54
343000 -- (-1344.410) (-1334.671) (-1343.527) [-1335.705] * [-1335.556] (-1333.187) (-1338.712) (-1336.985) -- 0:02:54
343500 -- (-1342.823) (-1337.175) [-1339.134] (-1343.682) * (-1342.868) [-1332.175] (-1353.418) (-1343.151) -- 0:02:53
344000 -- (-1346.443) (-1331.222) [-1333.925] (-1341.992) * (-1342.043) (-1333.057) [-1337.402] (-1344.517) -- 0:02:53
344500 -- [-1332.005] (-1331.000) (-1343.568) (-1343.522) * (-1343.215) (-1339.261) [-1342.497] (-1351.340) -- 0:02:53
345000 -- (-1334.561) (-1346.042) [-1333.975] (-1343.181) * [-1337.425] (-1336.285) (-1344.561) (-1344.439) -- 0:02:52
Average standard deviation of split frequencies: 0.011258
345500 -- [-1334.860] (-1343.022) (-1347.235) (-1339.651) * [-1340.301] (-1333.056) (-1345.270) (-1334.775) -- 0:02:52
346000 -- (-1339.083) [-1334.268] (-1346.157) (-1339.109) * (-1340.057) [-1335.732] (-1343.483) (-1337.922) -- 0:02:52
346500 -- (-1338.182) [-1341.932] (-1334.779) (-1342.338) * (-1338.512) (-1336.319) (-1334.858) [-1342.677] -- 0:02:53
347000 -- [-1339.346] (-1339.475) (-1357.906) (-1340.217) * (-1344.180) [-1332.224] (-1340.899) (-1346.225) -- 0:02:53
347500 -- (-1337.809) [-1329.562] (-1334.519) (-1340.684) * (-1350.844) (-1333.102) (-1349.989) [-1331.702] -- 0:02:52
348000 -- (-1355.895) (-1336.661) (-1351.159) [-1335.081] * (-1338.581) [-1332.266] (-1345.828) (-1344.999) -- 0:02:52
348500 -- (-1351.395) (-1339.562) (-1351.568) [-1336.772] * [-1335.337] (-1336.454) (-1335.609) (-1332.240) -- 0:02:51
349000 -- (-1346.289) (-1340.981) [-1342.434] (-1335.250) * (-1340.685) [-1333.030] (-1335.093) (-1326.725) -- 0:02:51
349500 -- (-1342.102) (-1341.660) [-1339.981] (-1339.985) * [-1337.808] (-1344.182) (-1337.029) (-1338.141) -- 0:02:51
350000 -- (-1346.269) (-1339.525) [-1334.315] (-1344.236) * (-1352.382) [-1334.049] (-1336.089) (-1335.429) -- 0:02:50
Average standard deviation of split frequencies: 0.011745
350500 -- (-1344.330) (-1333.540) [-1330.897] (-1336.779) * [-1343.013] (-1344.270) (-1348.550) (-1338.467) -- 0:02:52
351000 -- (-1340.237) (-1343.195) [-1333.929] (-1349.526) * (-1347.727) [-1336.419] (-1338.987) (-1342.133) -- 0:02:51
351500 -- (-1338.262) [-1341.619] (-1340.659) (-1342.278) * [-1339.255] (-1335.318) (-1338.718) (-1339.006) -- 0:02:51
352000 -- (-1345.148) (-1334.487) [-1337.449] (-1336.271) * (-1335.812) (-1338.154) (-1341.264) [-1340.441] -- 0:02:51
352500 -- (-1336.465) [-1338.320] (-1340.691) (-1343.061) * [-1347.711] (-1338.135) (-1344.252) (-1340.195) -- 0:02:50
353000 -- (-1344.001) [-1335.508] (-1337.340) (-1345.608) * [-1332.042] (-1338.617) (-1345.695) (-1347.374) -- 0:02:50
353500 -- (-1352.908) (-1336.859) (-1334.899) [-1336.618] * (-1333.415) (-1337.396) (-1337.498) [-1335.970] -- 0:02:50
354000 -- (-1339.195) [-1339.252] (-1331.591) (-1338.423) * (-1347.862) (-1340.467) [-1346.491] (-1334.443) -- 0:02:49
354500 -- (-1334.766) (-1332.736) [-1334.984] (-1340.290) * (-1346.617) [-1336.207] (-1347.259) (-1330.396) -- 0:02:51
355000 -- (-1338.523) (-1332.187) [-1336.527] (-1345.888) * (-1345.297) (-1338.782) (-1335.319) [-1343.550] -- 0:02:50
Average standard deviation of split frequencies: 0.011569
355500 -- (-1344.434) [-1336.648] (-1337.557) (-1338.718) * [-1337.316] (-1332.652) (-1345.357) (-1342.451) -- 0:02:50
356000 -- (-1344.065) (-1355.763) [-1333.227] (-1340.695) * (-1335.769) (-1337.703) (-1346.281) [-1329.102] -- 0:02:50
356500 -- (-1342.502) (-1342.340) [-1332.728] (-1337.026) * (-1340.674) [-1332.505] (-1342.468) (-1333.146) -- 0:02:49
357000 -- (-1344.815) (-1328.091) [-1330.414] (-1336.664) * [-1333.488] (-1338.453) (-1350.795) (-1335.058) -- 0:02:49
357500 -- (-1337.933) (-1336.086) (-1336.437) [-1336.312] * [-1333.113] (-1340.141) (-1338.601) (-1346.662) -- 0:02:48
358000 -- (-1350.870) [-1337.777] (-1334.527) (-1337.366) * (-1342.028) (-1346.952) [-1335.818] (-1345.634) -- 0:02:50
358500 -- (-1332.154) (-1345.857) (-1346.821) [-1334.440] * (-1332.135) (-1342.764) (-1331.030) [-1334.283] -- 0:02:49
359000 -- (-1339.991) (-1349.062) (-1336.881) [-1334.418] * (-1336.849) (-1354.959) [-1334.403] (-1345.545) -- 0:02:49
359500 -- (-1335.748) [-1333.543] (-1343.768) (-1352.133) * (-1337.222) (-1349.114) [-1348.500] (-1332.176) -- 0:02:49
360000 -- [-1336.655] (-1342.813) (-1342.177) (-1344.160) * [-1332.954] (-1342.495) (-1335.926) (-1343.501) -- 0:02:48
Average standard deviation of split frequencies: 0.011901
360500 -- [-1341.739] (-1362.357) (-1332.761) (-1338.197) * (-1331.697) (-1347.671) (-1340.873) [-1339.926] -- 0:02:48
361000 -- (-1342.194) (-1337.069) (-1337.709) [-1338.552] * (-1339.145) (-1339.325) (-1340.774) [-1337.634] -- 0:02:48
361500 -- (-1340.258) (-1338.893) [-1334.853] (-1347.867) * (-1346.914) [-1341.732] (-1344.674) (-1344.564) -- 0:02:47
362000 -- (-1344.668) (-1354.634) [-1336.914] (-1339.938) * (-1334.520) [-1335.139] (-1339.253) (-1331.922) -- 0:02:49
362500 -- (-1346.934) (-1341.211) (-1343.116) [-1336.471] * [-1342.011] (-1342.587) (-1334.256) (-1335.432) -- 0:02:48
363000 -- (-1345.907) [-1331.804] (-1344.889) (-1357.766) * (-1346.385) (-1342.875) (-1342.527) [-1334.406] -- 0:02:48
363500 -- [-1337.566] (-1337.739) (-1335.340) (-1339.529) * (-1351.505) [-1339.881] (-1342.497) (-1346.870) -- 0:02:48
364000 -- (-1348.007) [-1334.953] (-1330.973) (-1338.680) * (-1352.517) [-1341.371] (-1342.131) (-1341.703) -- 0:02:47
364500 -- [-1334.835] (-1335.568) (-1336.522) (-1347.772) * (-1347.240) [-1339.353] (-1339.459) (-1347.454) -- 0:02:47
365000 -- [-1329.465] (-1341.308) (-1339.505) (-1337.197) * (-1332.462) (-1344.540) (-1329.489) [-1335.331] -- 0:02:47
Average standard deviation of split frequencies: 0.012338
365500 -- (-1338.293) (-1342.727) (-1344.770) [-1340.002] * [-1332.195] (-1337.888) (-1338.813) (-1333.032) -- 0:02:48
366000 -- (-1338.005) (-1340.709) [-1339.895] (-1345.209) * [-1334.554] (-1333.273) (-1339.130) (-1336.351) -- 0:02:48
366500 -- [-1343.994] (-1332.966) (-1342.784) (-1335.289) * [-1348.646] (-1343.837) (-1335.192) (-1346.554) -- 0:02:47
367000 -- [-1331.571] (-1336.463) (-1335.367) (-1339.802) * (-1340.085) [-1337.898] (-1341.613) (-1341.008) -- 0:02:47
367500 -- (-1329.311) [-1342.868] (-1342.069) (-1341.965) * [-1333.143] (-1336.688) (-1345.642) (-1339.364) -- 0:02:46
368000 -- (-1345.630) (-1330.304) (-1348.530) [-1339.332] * [-1332.923] (-1327.816) (-1339.890) (-1335.696) -- 0:02:46
368500 -- (-1336.937) (-1339.005) (-1350.678) [-1336.278] * [-1328.487] (-1332.452) (-1335.219) (-1341.451) -- 0:02:46
369000 -- (-1330.008) (-1339.993) (-1339.614) [-1328.554] * (-1337.107) [-1341.770] (-1338.280) (-1334.157) -- 0:02:45
369500 -- (-1344.812) (-1343.968) [-1338.793] (-1334.518) * (-1355.406) (-1342.539) (-1340.039) [-1334.652] -- 0:02:47
370000 -- (-1338.075) (-1338.650) (-1347.043) [-1334.746] * (-1342.189) (-1355.973) (-1341.039) [-1336.035] -- 0:02:46
Average standard deviation of split frequencies: 0.012048
370500 -- (-1333.235) (-1333.874) (-1345.851) [-1335.871] * [-1339.716] (-1352.279) (-1340.244) (-1338.285) -- 0:02:46
371000 -- (-1344.657) [-1332.549] (-1342.700) (-1332.051) * (-1330.708) [-1334.061] (-1350.357) (-1348.724) -- 0:02:46
371500 -- (-1335.600) (-1332.931) (-1338.696) [-1333.998] * (-1342.342) (-1345.600) (-1351.224) [-1333.646] -- 0:02:45
372000 -- (-1341.408) (-1336.961) (-1345.771) [-1337.856] * (-1342.658) (-1342.589) (-1335.130) [-1329.848] -- 0:02:45
372500 -- (-1343.181) (-1339.985) [-1339.835] (-1343.737) * (-1348.260) [-1338.096] (-1336.353) (-1334.316) -- 0:02:45
373000 -- (-1342.041) [-1337.627] (-1341.209) (-1334.659) * [-1332.917] (-1341.039) (-1331.518) (-1341.918) -- 0:02:44
373500 -- (-1357.451) [-1333.781] (-1336.718) (-1338.377) * (-1329.723) (-1330.484) (-1344.550) [-1336.555] -- 0:02:46
374000 -- (-1341.282) (-1342.767) (-1334.314) [-1339.468] * (-1339.152) [-1332.240] (-1339.706) (-1345.820) -- 0:02:45
374500 -- [-1335.444] (-1350.749) (-1341.344) (-1336.876) * (-1344.339) [-1336.903] (-1338.439) (-1341.862) -- 0:02:45
375000 -- [-1339.000] (-1337.885) (-1340.260) (-1351.456) * (-1339.028) (-1337.905) (-1331.766) [-1339.730] -- 0:02:45
Average standard deviation of split frequencies: 0.011416
375500 -- (-1358.707) (-1333.436) [-1345.257] (-1337.728) * (-1329.876) (-1341.133) (-1344.514) [-1339.039] -- 0:02:44
376000 -- (-1355.492) (-1336.441) (-1354.756) [-1332.547] * (-1346.779) (-1332.485) [-1331.602] (-1339.657) -- 0:02:44
376500 -- [-1334.011] (-1331.383) (-1339.387) (-1337.302) * (-1339.107) (-1344.585) [-1333.777] (-1342.786) -- 0:02:43
377000 -- (-1339.297) [-1335.298] (-1346.681) (-1342.412) * (-1339.175) [-1333.204] (-1342.795) (-1347.139) -- 0:02:45
377500 -- (-1348.912) (-1339.025) (-1336.722) [-1338.080] * (-1346.315) [-1333.317] (-1353.521) (-1341.354) -- 0:02:44
378000 -- [-1338.142] (-1332.475) (-1343.495) (-1335.714) * (-1349.318) [-1332.523] (-1352.388) (-1329.617) -- 0:02:44
378500 -- (-1347.407) (-1337.416) [-1336.639] (-1343.257) * (-1335.555) [-1339.560] (-1332.592) (-1336.641) -- 0:02:44
379000 -- (-1339.616) (-1340.292) (-1339.625) [-1339.674] * (-1334.451) (-1335.082) [-1326.982] (-1336.879) -- 0:02:43
379500 -- (-1352.330) (-1334.250) (-1330.640) [-1341.535] * (-1343.566) [-1333.886] (-1337.552) (-1342.385) -- 0:02:43
380000 -- (-1331.719) (-1341.275) [-1338.566] (-1347.926) * [-1340.026] (-1339.111) (-1344.016) (-1344.167) -- 0:02:43
Average standard deviation of split frequencies: 0.011015
380500 -- (-1342.587) [-1336.298] (-1346.021) (-1343.997) * (-1330.645) [-1345.493] (-1341.974) (-1339.120) -- 0:02:42
381000 -- [-1336.219] (-1331.777) (-1338.464) (-1344.723) * (-1346.508) (-1342.946) (-1346.309) [-1337.126] -- 0:02:44
381500 -- (-1342.157) (-1350.720) (-1346.437) [-1336.319] * [-1332.308] (-1342.912) (-1341.887) (-1334.828) -- 0:02:43
382000 -- (-1345.514) (-1340.414) (-1340.070) [-1333.918] * (-1335.691) (-1342.004) [-1336.982] (-1345.073) -- 0:02:43
382500 -- (-1345.141) [-1328.850] (-1344.871) (-1334.626) * (-1333.532) (-1340.639) [-1333.128] (-1334.533) -- 0:02:43
383000 -- (-1333.407) (-1339.416) (-1345.622) [-1332.225] * (-1336.565) (-1337.367) [-1326.951] (-1334.324) -- 0:02:42
383500 -- (-1341.626) [-1335.831] (-1340.094) (-1337.102) * [-1343.792] (-1344.318) (-1338.920) (-1345.651) -- 0:02:42
384000 -- (-1332.478) (-1350.255) (-1344.716) [-1332.281] * (-1350.272) (-1337.302) [-1337.252] (-1338.181) -- 0:02:42
384500 -- [-1333.126] (-1337.925) (-1338.278) (-1330.955) * (-1337.075) [-1340.616] (-1337.352) (-1346.869) -- 0:02:41
385000 -- [-1336.447] (-1335.069) (-1330.079) (-1336.178) * [-1336.478] (-1335.117) (-1340.428) (-1340.576) -- 0:02:42
Average standard deviation of split frequencies: 0.010991
385500 -- (-1336.813) [-1335.178] (-1339.814) (-1341.593) * [-1340.407] (-1331.942) (-1339.836) (-1341.881) -- 0:02:42
386000 -- (-1337.070) (-1340.964) [-1330.492] (-1332.465) * (-1336.528) (-1341.360) [-1346.635] (-1332.854) -- 0:02:42
386500 -- (-1340.733) (-1342.579) (-1332.024) [-1340.627] * (-1336.046) (-1338.137) (-1332.737) [-1335.425] -- 0:02:41
387000 -- [-1340.180] (-1337.543) (-1345.886) (-1331.983) * [-1336.488] (-1344.349) (-1341.699) (-1337.257) -- 0:02:41
387500 -- (-1345.682) (-1338.030) [-1333.105] (-1344.380) * (-1334.323) (-1340.718) [-1332.323] (-1347.356) -- 0:02:41
388000 -- (-1342.190) (-1335.561) (-1344.519) [-1334.961] * (-1344.359) (-1339.480) [-1337.090] (-1342.006) -- 0:02:40
388500 -- (-1334.045) (-1345.373) [-1337.420] (-1337.077) * [-1329.002] (-1341.279) (-1345.075) (-1341.225) -- 0:02:42
389000 -- (-1334.934) (-1340.675) [-1334.599] (-1336.189) * (-1344.870) [-1335.280] (-1335.970) (-1340.202) -- 0:02:41
389500 -- (-1341.744) (-1349.449) (-1340.773) [-1337.241] * [-1333.746] (-1339.387) (-1343.957) (-1359.961) -- 0:02:41
390000 -- (-1338.732) (-1340.981) (-1351.291) [-1335.193] * [-1334.299] (-1331.382) (-1334.076) (-1356.119) -- 0:02:41
Average standard deviation of split frequencies: 0.011495
390500 -- (-1337.289) [-1330.383] (-1336.809) (-1337.998) * (-1343.482) (-1341.014) (-1337.792) [-1340.880] -- 0:02:40
391000 -- (-1339.726) (-1327.880) (-1339.356) [-1335.021] * (-1348.084) (-1342.201) [-1338.512] (-1344.692) -- 0:02:40
391500 -- (-1337.771) [-1336.512] (-1344.069) (-1332.359) * (-1341.592) [-1332.028] (-1327.707) (-1335.868) -- 0:02:40
392000 -- (-1332.789) (-1340.540) (-1346.250) [-1330.034] * (-1344.347) (-1333.899) (-1342.732) [-1340.115] -- 0:02:39
392500 -- (-1338.097) (-1342.466) [-1333.422] (-1334.654) * (-1339.254) [-1328.106] (-1339.643) (-1338.377) -- 0:02:40
393000 -- (-1340.710) (-1334.372) [-1331.664] (-1344.716) * (-1338.338) [-1335.136] (-1342.719) (-1344.994) -- 0:02:40
393500 -- (-1346.822) [-1326.973] (-1334.962) (-1337.443) * (-1341.278) (-1350.180) [-1330.950] (-1336.633) -- 0:02:40
394000 -- (-1347.398) (-1339.177) [-1330.033] (-1348.392) * (-1344.553) (-1344.068) [-1339.343] (-1339.461) -- 0:02:39
394500 -- (-1335.382) (-1358.865) (-1334.922) [-1332.214] * [-1338.802] (-1348.917) (-1340.340) (-1343.308) -- 0:02:39
395000 -- (-1334.917) [-1347.272] (-1334.360) (-1336.663) * (-1343.528) (-1338.907) (-1335.330) [-1337.109] -- 0:02:39
Average standard deviation of split frequencies: 0.010651
395500 -- (-1357.640) (-1345.460) [-1336.735] (-1337.491) * (-1342.600) (-1345.434) (-1338.429) [-1334.980] -- 0:02:38
396000 -- (-1344.817) (-1337.296) [-1330.553] (-1343.337) * [-1337.665] (-1351.856) (-1348.458) (-1344.729) -- 0:02:38
396500 -- (-1329.796) [-1335.258] (-1339.105) (-1338.408) * (-1339.661) (-1343.590) (-1344.967) [-1329.555] -- 0:02:39
397000 -- (-1335.791) (-1356.362) [-1342.483] (-1340.037) * [-1345.679] (-1336.899) (-1345.830) (-1337.654) -- 0:02:39
397500 -- [-1328.342] (-1353.964) (-1347.643) (-1336.756) * (-1346.519) (-1336.324) [-1331.972] (-1341.281) -- 0:02:39
398000 -- (-1333.993) (-1339.068) (-1337.414) [-1344.491] * (-1334.596) [-1337.638] (-1336.604) (-1343.963) -- 0:02:38
398500 -- (-1332.401) (-1342.083) [-1334.558] (-1344.182) * (-1342.433) [-1339.571] (-1347.783) (-1336.121) -- 0:02:38
399000 -- [-1338.729] (-1352.316) (-1332.074) (-1346.870) * (-1342.629) (-1342.534) [-1332.993] (-1336.446) -- 0:02:38
399500 -- (-1344.828) (-1342.118) [-1334.691] (-1345.115) * (-1334.945) (-1333.631) (-1337.105) [-1340.266] -- 0:02:37
400000 -- (-1351.430) (-1345.875) [-1341.466] (-1341.554) * [-1335.691] (-1344.120) (-1335.265) (-1339.992) -- 0:02:39
Average standard deviation of split frequencies: 0.010527
400500 -- (-1342.580) [-1344.062] (-1342.519) (-1354.422) * (-1339.768) (-1341.393) [-1338.306] (-1339.104) -- 0:02:38
401000 -- (-1344.020) (-1339.488) (-1341.111) [-1337.888] * (-1345.267) [-1345.048] (-1333.346) (-1334.587) -- 0:02:38
401500 -- (-1352.976) (-1340.299) [-1331.907] (-1339.123) * (-1343.675) (-1338.641) [-1349.091] (-1336.971) -- 0:02:38
402000 -- (-1342.091) [-1343.056] (-1336.173) (-1340.584) * (-1341.548) [-1336.537] (-1341.656) (-1354.690) -- 0:02:37
402500 -- (-1346.624) (-1340.270) [-1341.688] (-1350.615) * (-1336.175) (-1343.857) (-1345.128) [-1331.050] -- 0:02:37
403000 -- (-1334.236) (-1333.144) [-1339.794] (-1347.596) * [-1339.453] (-1342.255) (-1345.581) (-1341.614) -- 0:02:37
403500 -- [-1336.441] (-1336.920) (-1345.961) (-1354.638) * (-1350.679) (-1342.263) (-1337.862) [-1340.877] -- 0:02:36
404000 -- (-1329.543) (-1330.977) [-1331.574] (-1344.649) * (-1335.481) (-1339.013) [-1339.398] (-1345.516) -- 0:02:37
404500 -- (-1333.612) [-1328.441] (-1331.602) (-1341.638) * [-1335.105] (-1344.013) (-1351.044) (-1350.582) -- 0:02:37
405000 -- [-1336.963] (-1340.772) (-1347.323) (-1337.026) * [-1336.576] (-1350.174) (-1356.332) (-1348.064) -- 0:02:37
Average standard deviation of split frequencies: 0.010798
405500 -- [-1331.978] (-1332.591) (-1341.725) (-1349.973) * (-1352.015) (-1345.854) (-1328.569) [-1335.603] -- 0:02:36
406000 -- (-1345.606) (-1338.750) [-1332.679] (-1344.019) * [-1335.807] (-1349.671) (-1350.910) (-1338.764) -- 0:02:36
406500 -- (-1337.404) (-1342.359) [-1339.820] (-1339.582) * (-1350.216) (-1344.511) [-1336.773] (-1336.535) -- 0:02:36
407000 -- (-1346.428) (-1337.037) (-1351.850) [-1331.915] * (-1346.156) [-1341.003] (-1351.085) (-1341.714) -- 0:02:35
407500 -- (-1336.394) (-1344.973) [-1339.415] (-1344.288) * (-1337.146) [-1344.341] (-1335.848) (-1334.755) -- 0:02:37
408000 -- (-1333.757) (-1347.968) (-1338.837) [-1333.117] * (-1340.846) (-1340.795) (-1336.551) [-1334.831] -- 0:02:36
408500 -- (-1341.784) (-1341.330) (-1337.590) [-1335.281] * (-1337.258) (-1332.841) [-1336.273] (-1339.443) -- 0:02:36
409000 -- (-1342.027) (-1337.950) (-1338.771) [-1336.589] * [-1334.406] (-1336.483) (-1339.646) (-1331.308) -- 0:02:36
409500 -- (-1339.990) (-1339.471) [-1346.855] (-1333.848) * (-1347.500) [-1338.542] (-1340.287) (-1339.265) -- 0:02:35
410000 -- [-1332.635] (-1336.943) (-1344.196) (-1346.421) * (-1339.088) [-1341.258] (-1337.947) (-1331.404) -- 0:02:35
Average standard deviation of split frequencies: 0.011192
410500 -- (-1351.689) (-1335.757) (-1335.848) [-1337.939] * (-1339.328) [-1344.134] (-1339.912) (-1341.848) -- 0:02:35
411000 -- (-1341.216) [-1335.895] (-1347.374) (-1337.605) * [-1338.986] (-1336.842) (-1348.100) (-1344.482) -- 0:02:34
411500 -- [-1340.714] (-1330.869) (-1341.368) (-1339.866) * (-1346.785) (-1330.999) [-1329.703] (-1330.699) -- 0:02:35
412000 -- [-1332.729] (-1336.354) (-1341.647) (-1351.695) * (-1338.951) [-1341.044] (-1348.612) (-1333.525) -- 0:02:35
412500 -- (-1332.819) [-1333.240] (-1341.031) (-1341.426) * [-1331.222] (-1343.543) (-1345.063) (-1341.780) -- 0:02:35
413000 -- (-1342.459) (-1340.658) (-1345.372) [-1332.138] * [-1340.038] (-1335.810) (-1341.231) (-1339.272) -- 0:02:34
413500 -- (-1342.479) (-1335.102) [-1341.184] (-1330.051) * (-1337.138) (-1343.579) (-1342.071) [-1332.327] -- 0:02:34
414000 -- (-1339.643) (-1336.825) [-1335.030] (-1344.901) * (-1336.695) [-1338.380] (-1333.751) (-1334.399) -- 0:02:34
414500 -- [-1334.164] (-1334.567) (-1337.724) (-1339.979) * [-1332.346] (-1342.287) (-1351.421) (-1337.576) -- 0:02:33
415000 -- (-1336.295) (-1343.987) [-1344.130] (-1348.338) * (-1333.195) (-1350.497) (-1330.521) [-1336.735] -- 0:02:33
Average standard deviation of split frequencies: 0.011332
415500 -- [-1335.620] (-1338.765) (-1340.840) (-1334.023) * [-1327.010] (-1347.053) (-1335.105) (-1332.763) -- 0:02:34
416000 -- (-1329.701) (-1341.920) [-1332.457] (-1334.279) * [-1330.740] (-1336.009) (-1343.849) (-1335.091) -- 0:02:34
416500 -- (-1348.148) (-1333.948) (-1330.379) [-1338.298] * [-1327.534] (-1352.354) (-1340.536) (-1334.885) -- 0:02:34
417000 -- [-1333.567] (-1346.884) (-1338.487) (-1340.432) * [-1339.874] (-1347.320) (-1338.390) (-1337.930) -- 0:02:33
417500 -- (-1345.064) [-1331.689] (-1340.216) (-1340.342) * (-1335.033) (-1342.529) [-1335.146] (-1334.977) -- 0:02:33
418000 -- (-1332.424) [-1338.076] (-1350.526) (-1343.672) * (-1342.026) [-1341.219] (-1340.190) (-1336.482) -- 0:02:33
418500 -- (-1345.300) [-1336.746] (-1342.938) (-1334.648) * [-1333.249] (-1342.091) (-1342.002) (-1343.723) -- 0:02:32
419000 -- (-1333.915) (-1344.005) (-1347.479) [-1350.689] * (-1344.324) (-1346.912) [-1343.117] (-1342.520) -- 0:02:33
419500 -- [-1335.754] (-1342.714) (-1346.881) (-1338.992) * (-1342.034) [-1335.356] (-1345.401) (-1342.313) -- 0:02:33
420000 -- (-1339.695) [-1334.097] (-1343.504) (-1349.370) * (-1337.878) [-1348.016] (-1354.547) (-1334.557) -- 0:02:33
Average standard deviation of split frequencies: 0.011486
420500 -- (-1334.821) (-1334.491) (-1346.607) [-1333.894] * (-1343.904) (-1336.800) (-1343.746) [-1335.530] -- 0:02:32
421000 -- [-1340.073] (-1344.254) (-1338.136) (-1335.504) * (-1347.621) (-1342.757) (-1335.062) [-1339.191] -- 0:02:32
421500 -- [-1340.557] (-1349.571) (-1339.957) (-1336.718) * (-1353.018) (-1341.303) (-1345.760) [-1334.834] -- 0:02:32
422000 -- [-1348.506] (-1357.531) (-1337.010) (-1344.586) * (-1340.678) (-1338.763) (-1351.639) [-1330.088] -- 0:02:32
422500 -- (-1344.987) [-1337.276] (-1332.995) (-1350.214) * [-1337.194] (-1341.739) (-1336.746) (-1343.074) -- 0:02:31
423000 -- [-1337.711] (-1332.990) (-1336.744) (-1353.886) * (-1336.842) (-1344.625) (-1331.031) [-1335.432] -- 0:02:32
423500 -- [-1344.986] (-1338.484) (-1333.441) (-1348.304) * (-1338.218) (-1349.437) [-1334.010] (-1346.068) -- 0:02:32
424000 -- (-1337.714) (-1347.828) [-1334.332] (-1346.879) * [-1337.973] (-1334.132) (-1351.706) (-1343.672) -- 0:02:32
424500 -- [-1335.775] (-1348.039) (-1340.090) (-1341.668) * [-1347.574] (-1339.363) (-1339.870) (-1338.221) -- 0:02:31
425000 -- [-1340.856] (-1341.631) (-1333.888) (-1338.282) * (-1349.099) (-1340.537) [-1331.264] (-1336.708) -- 0:02:31
Average standard deviation of split frequencies: 0.011508
425500 -- (-1335.503) (-1344.665) [-1336.424] (-1341.350) * (-1341.647) (-1344.355) [-1339.279] (-1342.425) -- 0:02:31
426000 -- (-1348.258) [-1337.248] (-1332.304) (-1342.269) * (-1347.119) (-1340.525) [-1334.577] (-1347.778) -- 0:02:30
426500 -- (-1341.239) (-1339.665) [-1326.449] (-1333.675) * (-1343.944) [-1341.327] (-1342.009) (-1348.020) -- 0:02:30
427000 -- (-1336.100) (-1350.281) (-1337.874) [-1335.948] * (-1347.258) [-1334.003] (-1347.186) (-1345.189) -- 0:02:31
427500 -- (-1336.102) (-1339.436) [-1333.610] (-1334.358) * [-1337.462] (-1335.807) (-1334.256) (-1341.805) -- 0:02:31
428000 -- (-1342.970) [-1334.682] (-1338.939) (-1332.940) * (-1341.868) (-1333.379) (-1348.288) [-1331.771] -- 0:02:31
428500 -- (-1347.063) [-1336.619] (-1340.574) (-1335.930) * (-1337.045) (-1330.096) (-1334.301) [-1336.345] -- 0:02:30
429000 -- [-1334.490] (-1334.799) (-1336.367) (-1339.638) * (-1347.611) (-1335.891) (-1337.960) [-1333.242] -- 0:02:30
429500 -- (-1350.021) [-1332.335] (-1336.751) (-1336.147) * (-1332.688) [-1333.618] (-1344.358) (-1334.243) -- 0:02:30
430000 -- (-1340.451) (-1334.548) [-1337.678] (-1345.711) * (-1340.357) (-1339.133) [-1331.092] (-1350.650) -- 0:02:29
Average standard deviation of split frequencies: 0.010216
430500 -- (-1344.577) [-1335.115] (-1339.418) (-1340.329) * (-1343.138) [-1336.350] (-1341.917) (-1353.872) -- 0:02:30
431000 -- (-1349.264) [-1339.134] (-1337.932) (-1337.638) * (-1351.014) [-1339.099] (-1334.264) (-1334.243) -- 0:02:30
431500 -- (-1339.080) (-1332.755) (-1350.440) [-1337.594] * (-1333.315) [-1329.086] (-1334.543) (-1342.649) -- 0:02:30
432000 -- (-1336.146) (-1342.122) (-1345.109) [-1335.912] * (-1344.549) (-1338.546) (-1341.187) [-1328.490] -- 0:02:29
432500 -- (-1337.422) (-1341.449) [-1336.105] (-1347.198) * (-1345.661) [-1352.655] (-1334.902) (-1337.056) -- 0:02:29
433000 -- [-1333.990] (-1331.933) (-1334.668) (-1330.102) * (-1352.856) (-1337.213) (-1341.347) [-1333.979] -- 0:02:29
433500 -- [-1343.925] (-1338.029) (-1342.066) (-1341.930) * (-1340.800) [-1336.838] (-1339.178) (-1342.581) -- 0:02:28
434000 -- (-1348.440) (-1329.560) (-1341.117) [-1332.201] * [-1331.278] (-1338.636) (-1343.984) (-1352.577) -- 0:02:28
434500 -- (-1344.734) [-1344.246] (-1338.410) (-1333.047) * (-1334.997) (-1335.381) [-1340.759] (-1334.538) -- 0:02:29
435000 -- (-1341.526) (-1340.376) (-1336.362) [-1341.877] * [-1327.128] (-1334.050) (-1333.948) (-1329.513) -- 0:02:29
Average standard deviation of split frequencies: 0.009911
435500 -- [-1334.235] (-1334.089) (-1342.285) (-1335.540) * (-1334.642) (-1337.638) (-1346.994) [-1331.862] -- 0:02:29
436000 -- (-1338.447) (-1340.645) [-1332.293] (-1330.211) * (-1346.266) (-1335.834) (-1345.582) [-1335.428] -- 0:02:28
436500 -- (-1332.593) [-1341.550] (-1340.108) (-1334.776) * (-1334.458) (-1336.555) [-1335.695] (-1339.989) -- 0:02:28
437000 -- (-1353.490) [-1338.795] (-1337.062) (-1347.589) * (-1339.874) [-1339.964] (-1335.486) (-1343.629) -- 0:02:28
437500 -- (-1355.163) (-1332.404) [-1337.460] (-1344.584) * (-1340.113) (-1342.082) (-1337.419) [-1333.902] -- 0:02:27
438000 -- [-1339.303] (-1348.894) (-1346.656) (-1340.071) * (-1339.224) (-1343.611) (-1339.967) [-1338.012] -- 0:02:27
438500 -- [-1340.442] (-1347.516) (-1348.679) (-1341.105) * (-1345.159) (-1341.840) (-1339.528) [-1331.032] -- 0:02:28
439000 -- (-1336.793) (-1353.849) [-1331.726] (-1331.739) * (-1342.409) (-1335.720) (-1337.058) [-1340.608] -- 0:02:28
439500 -- (-1343.848) (-1348.605) (-1334.762) [-1335.023] * (-1340.287) (-1340.159) (-1335.396) [-1338.393] -- 0:02:27
440000 -- [-1338.251] (-1340.445) (-1346.521) (-1337.487) * [-1335.237] (-1350.720) (-1331.281) (-1326.673) -- 0:02:27
Average standard deviation of split frequencies: 0.009925
440500 -- (-1343.053) (-1343.999) [-1339.388] (-1339.893) * (-1342.565) [-1334.578] (-1339.197) (-1336.146) -- 0:02:27
441000 -- (-1333.642) (-1334.527) [-1331.571] (-1338.957) * (-1333.576) (-1343.172) [-1341.726] (-1336.195) -- 0:02:27
441500 -- (-1338.028) [-1329.600] (-1337.809) (-1339.625) * (-1343.271) [-1339.225] (-1337.161) (-1331.766) -- 0:02:26
442000 -- [-1334.695] (-1338.308) (-1350.808) (-1331.759) * (-1346.637) (-1339.125) (-1343.306) [-1331.358] -- 0:02:27
442500 -- [-1328.940] (-1336.739) (-1336.263) (-1344.017) * [-1330.432] (-1337.179) (-1340.684) (-1348.919) -- 0:02:27
443000 -- (-1332.918) [-1348.199] (-1335.476) (-1343.331) * (-1333.119) [-1327.639] (-1347.033) (-1340.125) -- 0:02:27
443500 -- (-1334.704) [-1339.257] (-1340.128) (-1328.781) * (-1344.055) [-1332.588] (-1343.731) (-1339.425) -- 0:02:26
444000 -- [-1333.711] (-1347.798) (-1340.025) (-1329.144) * (-1342.349) [-1342.088] (-1343.228) (-1341.986) -- 0:02:26
444500 -- [-1328.945] (-1335.750) (-1346.665) (-1336.748) * (-1335.271) [-1338.984] (-1357.759) (-1340.017) -- 0:02:26
445000 -- (-1334.755) (-1334.094) [-1331.854] (-1342.415) * (-1332.697) [-1338.350] (-1347.289) (-1343.269) -- 0:02:25
Average standard deviation of split frequencies: 0.010959
445500 -- (-1337.238) (-1332.875) (-1336.864) [-1340.487] * (-1336.486) (-1332.115) (-1341.450) [-1336.574] -- 0:02:25
446000 -- (-1337.262) (-1351.477) (-1342.055) [-1330.344] * (-1340.712) (-1331.408) [-1338.844] (-1341.378) -- 0:02:26
446500 -- [-1334.477] (-1340.628) (-1342.361) (-1338.669) * (-1338.787) (-1340.922) (-1357.495) [-1337.112] -- 0:02:26
447000 -- (-1336.505) (-1341.263) [-1335.998] (-1337.250) * [-1333.779] (-1337.018) (-1335.770) (-1355.525) -- 0:02:25
447500 -- (-1341.552) (-1335.271) [-1333.771] (-1342.526) * [-1342.527] (-1333.075) (-1343.298) (-1339.276) -- 0:02:25
448000 -- (-1343.830) (-1334.307) [-1336.024] (-1339.732) * (-1344.159) [-1329.966] (-1345.677) (-1329.210) -- 0:02:25
448500 -- (-1337.487) (-1350.327) [-1336.319] (-1338.349) * (-1332.571) [-1329.815] (-1348.501) (-1341.494) -- 0:02:25
449000 -- [-1336.675] (-1336.900) (-1341.306) (-1340.039) * (-1331.836) (-1338.702) (-1349.182) [-1337.697] -- 0:02:24
449500 -- (-1339.260) (-1342.303) [-1337.348] (-1333.753) * (-1332.639) (-1338.845) [-1335.181] (-1335.580) -- 0:02:24
450000 -- (-1345.858) (-1335.198) (-1345.258) [-1329.055] * (-1338.926) (-1330.728) (-1340.758) [-1330.510] -- 0:02:25
Average standard deviation of split frequencies: 0.010053
450500 -- (-1347.227) (-1328.639) [-1342.040] (-1345.991) * (-1333.494) (-1341.062) (-1345.720) [-1334.824] -- 0:02:25
451000 -- (-1334.473) [-1337.561] (-1336.920) (-1346.845) * (-1346.610) [-1332.911] (-1344.147) (-1342.411) -- 0:02:24
451500 -- (-1343.932) (-1339.439) [-1335.415] (-1334.894) * (-1339.216) [-1336.594] (-1348.842) (-1343.499) -- 0:02:24
452000 -- [-1334.678] (-1339.962) (-1336.701) (-1329.850) * (-1339.146) (-1336.338) [-1349.061] (-1345.967) -- 0:02:24
452500 -- [-1336.317] (-1332.936) (-1333.788) (-1334.581) * (-1340.299) [-1329.938] (-1337.276) (-1334.145) -- 0:02:23
453000 -- (-1334.174) (-1338.756) (-1341.406) [-1327.149] * (-1333.183) (-1336.141) (-1343.043) [-1333.938] -- 0:02:23
453500 -- (-1335.687) [-1339.285] (-1338.460) (-1340.750) * (-1340.638) (-1343.219) (-1328.387) [-1343.096] -- 0:02:24
454000 -- (-1336.205) (-1339.796) (-1346.789) [-1334.243] * (-1342.109) (-1345.360) (-1344.096) [-1336.741] -- 0:02:24
454500 -- (-1344.016) (-1353.147) (-1346.326) [-1339.203] * [-1337.292] (-1348.634) (-1345.368) (-1335.691) -- 0:02:24
455000 -- (-1347.883) [-1337.689] (-1339.329) (-1338.625) * (-1331.749) (-1348.918) [-1337.821] (-1337.411) -- 0:02:23
Average standard deviation of split frequencies: 0.010682
455500 -- (-1348.290) [-1338.219] (-1343.180) (-1337.129) * (-1341.915) [-1336.484] (-1340.188) (-1343.886) -- 0:02:23
456000 -- (-1334.299) (-1339.163) (-1340.497) [-1332.089] * (-1333.367) (-1334.212) [-1332.629] (-1335.085) -- 0:02:23
456500 -- (-1340.507) (-1338.266) (-1344.432) [-1331.291] * (-1340.691) (-1337.546) (-1328.980) [-1331.354] -- 0:02:22
457000 -- (-1349.519) (-1328.113) (-1346.071) [-1338.922] * (-1332.623) (-1331.270) [-1336.720] (-1342.720) -- 0:02:22
457500 -- (-1346.062) (-1333.568) (-1341.824) [-1329.538] * [-1334.476] (-1338.494) (-1338.161) (-1342.587) -- 0:02:23
458000 -- [-1335.236] (-1334.321) (-1337.171) (-1340.797) * (-1342.482) (-1345.145) [-1334.962] (-1345.816) -- 0:02:23
458500 -- (-1349.022) (-1335.330) [-1335.623] (-1330.788) * (-1349.136) (-1338.113) (-1340.568) [-1336.145] -- 0:02:22
459000 -- (-1333.570) (-1343.731) (-1347.945) [-1332.983] * (-1342.161) (-1343.879) [-1338.533] (-1341.708) -- 0:02:22
459500 -- (-1334.983) (-1341.830) (-1347.750) [-1337.103] * (-1346.879) [-1348.414] (-1335.927) (-1344.114) -- 0:02:22
460000 -- (-1333.434) (-1348.228) (-1330.134) [-1337.616] * (-1346.779) (-1340.606) [-1335.845] (-1330.720) -- 0:02:22
Average standard deviation of split frequencies: 0.011313
460500 -- (-1331.765) (-1341.829) (-1342.495) [-1331.586] * (-1345.492) (-1338.949) [-1336.420] (-1337.267) -- 0:02:21
461000 -- (-1349.836) [-1340.219] (-1339.833) (-1341.814) * (-1350.790) [-1344.238] (-1345.505) (-1344.929) -- 0:02:22
461500 -- [-1335.684] (-1339.198) (-1352.276) (-1339.214) * (-1345.145) (-1342.669) (-1334.262) [-1339.408] -- 0:02:22
462000 -- [-1347.707] (-1340.400) (-1340.040) (-1335.373) * [-1328.405] (-1340.931) (-1338.826) (-1345.283) -- 0:02:22
462500 -- (-1345.334) [-1338.587] (-1341.704) (-1342.140) * (-1338.990) [-1337.201] (-1336.882) (-1342.854) -- 0:02:21
463000 -- [-1337.624] (-1345.394) (-1333.968) (-1348.483) * (-1352.990) (-1341.480) [-1338.659] (-1337.728) -- 0:02:21
463500 -- (-1339.665) (-1348.532) [-1330.970] (-1348.197) * (-1337.127) (-1331.337) (-1342.691) [-1336.006] -- 0:02:21
464000 -- [-1338.317] (-1345.009) (-1338.350) (-1343.854) * [-1342.310] (-1342.350) (-1344.280) (-1332.368) -- 0:02:20
464500 -- [-1337.817] (-1337.040) (-1340.881) (-1350.073) * (-1336.822) (-1344.751) (-1342.297) [-1331.611] -- 0:02:20
465000 -- (-1334.994) (-1334.327) (-1337.068) [-1348.010] * (-1329.138) (-1340.091) (-1339.193) [-1330.809] -- 0:02:21
Average standard deviation of split frequencies: 0.010903
465500 -- [-1333.977] (-1331.956) (-1338.515) (-1336.043) * (-1338.345) (-1340.232) (-1349.138) [-1332.175] -- 0:02:21
466000 -- (-1332.222) (-1356.484) [-1336.228] (-1352.412) * (-1339.265) (-1338.467) (-1345.370) [-1331.668] -- 0:02:20
466500 -- (-1339.623) [-1333.483] (-1352.656) (-1347.993) * [-1335.316] (-1336.388) (-1372.928) (-1337.460) -- 0:02:20
467000 -- [-1334.489] (-1340.967) (-1340.764) (-1343.348) * (-1343.592) [-1335.643] (-1335.304) (-1342.840) -- 0:02:20
467500 -- (-1332.845) (-1346.279) [-1332.784] (-1342.559) * (-1337.988) (-1348.763) [-1333.937] (-1342.631) -- 0:02:20
468000 -- (-1335.672) [-1336.120] (-1332.637) (-1346.678) * [-1341.773] (-1341.922) (-1348.594) (-1333.959) -- 0:02:19
468500 -- (-1334.095) (-1345.138) [-1338.720] (-1342.627) * (-1347.096) (-1334.164) [-1333.156] (-1335.653) -- 0:02:19
469000 -- (-1341.936) (-1336.231) [-1344.965] (-1334.168) * (-1337.471) (-1342.376) [-1335.861] (-1330.577) -- 0:02:20
469500 -- [-1338.222] (-1346.310) (-1340.584) (-1341.332) * [-1334.233] (-1345.052) (-1329.710) (-1345.908) -- 0:02:20
470000 -- [-1337.951] (-1350.480) (-1353.601) (-1344.289) * (-1336.927) [-1333.053] (-1342.383) (-1341.280) -- 0:02:19
Average standard deviation of split frequencies: 0.010572
470500 -- (-1336.563) (-1350.601) (-1340.233) [-1337.622] * (-1336.817) [-1333.590] (-1341.314) (-1351.348) -- 0:02:19
471000 -- (-1336.717) (-1349.388) [-1330.816] (-1337.423) * (-1334.461) (-1350.568) [-1340.864] (-1348.997) -- 0:02:19
471500 -- (-1335.196) (-1350.000) [-1337.966] (-1343.155) * (-1336.557) (-1335.495) [-1336.307] (-1342.177) -- 0:02:18
472000 -- (-1326.969) (-1351.064) (-1338.211) [-1345.140] * [-1336.141] (-1350.251) (-1341.686) (-1343.216) -- 0:02:18
472500 -- (-1333.224) (-1341.342) [-1334.997] (-1340.122) * (-1344.459) (-1349.983) [-1338.302] (-1337.912) -- 0:02:19
473000 -- (-1346.254) (-1343.971) [-1339.976] (-1346.081) * (-1336.856) (-1340.716) (-1337.596) [-1332.445] -- 0:02:19
473500 -- (-1340.666) [-1341.126] (-1343.440) (-1342.401) * (-1347.406) (-1334.181) (-1339.804) [-1334.280] -- 0:02:18
474000 -- (-1332.679) [-1327.760] (-1340.686) (-1341.015) * [-1342.846] (-1344.345) (-1341.962) (-1339.304) -- 0:02:18
474500 -- [-1340.382] (-1333.299) (-1352.750) (-1335.540) * (-1347.673) [-1335.528] (-1337.203) (-1340.737) -- 0:02:18
475000 -- (-1343.738) [-1335.526] (-1336.072) (-1349.407) * (-1341.194) (-1346.558) (-1345.211) [-1340.795] -- 0:02:18
Average standard deviation of split frequencies: 0.010289
475500 -- [-1329.580] (-1334.640) (-1342.283) (-1346.685) * [-1336.111] (-1341.133) (-1344.701) (-1334.369) -- 0:02:17
476000 -- (-1342.345) (-1331.925) [-1340.998] (-1352.965) * [-1332.266] (-1347.709) (-1344.821) (-1339.131) -- 0:02:17
476500 -- [-1343.380] (-1353.356) (-1332.553) (-1342.316) * [-1329.932] (-1343.411) (-1336.053) (-1339.708) -- 0:02:18
477000 -- (-1343.312) (-1340.843) (-1334.145) [-1343.328] * (-1341.121) (-1334.783) [-1339.417] (-1334.806) -- 0:02:18
477500 -- (-1348.634) (-1333.529) [-1336.777] (-1342.117) * (-1345.203) [-1335.157] (-1343.581) (-1335.671) -- 0:02:17
478000 -- (-1335.123) (-1344.548) [-1334.863] (-1340.971) * (-1340.949) [-1340.051] (-1340.219) (-1333.585) -- 0:02:17
478500 -- (-1329.788) (-1340.037) [-1338.445] (-1354.390) * (-1348.125) [-1327.649] (-1339.251) (-1339.478) -- 0:02:17
479000 -- (-1335.664) (-1343.422) (-1346.293) [-1334.273] * [-1343.671] (-1339.277) (-1345.743) (-1343.299) -- 0:02:17
479500 -- (-1339.540) (-1344.506) (-1342.777) [-1331.531] * (-1349.262) (-1342.135) [-1335.373] (-1335.238) -- 0:02:16
480000 -- [-1339.555] (-1337.044) (-1345.026) (-1344.165) * (-1345.360) [-1342.815] (-1334.539) (-1345.035) -- 0:02:16
Average standard deviation of split frequencies: 0.010625
480500 -- [-1342.606] (-1345.637) (-1339.164) (-1346.262) * (-1338.095) [-1337.611] (-1333.813) (-1344.093) -- 0:02:17
481000 -- [-1330.792] (-1334.273) (-1339.263) (-1332.250) * (-1349.709) [-1332.965] (-1339.194) (-1342.247) -- 0:02:17
481500 -- (-1346.097) [-1332.542] (-1341.745) (-1339.246) * (-1354.901) (-1345.459) [-1335.804] (-1334.349) -- 0:02:16
482000 -- (-1342.019) (-1347.251) [-1339.737] (-1341.598) * (-1344.103) [-1334.831] (-1339.057) (-1338.918) -- 0:02:16
482500 -- (-1338.478) [-1343.257] (-1332.085) (-1337.168) * (-1350.766) (-1341.420) [-1333.184] (-1332.825) -- 0:02:16
483000 -- (-1338.994) [-1342.185] (-1336.238) (-1356.718) * (-1348.644) (-1334.852) (-1324.781) [-1332.085] -- 0:02:15
483500 -- (-1343.114) [-1340.221] (-1339.611) (-1330.755) * (-1349.361) (-1338.718) [-1332.981] (-1332.074) -- 0:02:15
484000 -- (-1345.866) (-1337.611) [-1331.516] (-1344.297) * (-1342.580) (-1331.616) [-1335.515] (-1338.513) -- 0:02:16
484500 -- (-1339.181) (-1336.527) [-1337.506] (-1337.260) * [-1343.213] (-1351.382) (-1333.734) (-1336.770) -- 0:02:16
485000 -- (-1345.204) (-1345.831) (-1337.024) [-1332.106] * (-1338.006) (-1334.191) (-1340.409) [-1334.044] -- 0:02:15
Average standard deviation of split frequencies: 0.010670
485500 -- (-1340.412) (-1344.705) (-1340.078) [-1342.068] * (-1348.656) (-1332.697) [-1330.788] (-1342.409) -- 0:02:15
486000 -- [-1331.485] (-1339.268) (-1340.321) (-1339.047) * (-1342.952) (-1347.159) (-1347.396) [-1337.797] -- 0:02:15
486500 -- [-1335.928] (-1339.303) (-1341.120) (-1332.384) * (-1341.472) [-1338.115] (-1338.191) (-1335.596) -- 0:02:15
487000 -- [-1336.656] (-1337.466) (-1330.712) (-1342.016) * (-1353.573) (-1340.291) [-1330.760] (-1336.172) -- 0:02:14
487500 -- (-1334.233) [-1342.229] (-1330.276) (-1339.624) * (-1344.242) (-1335.353) [-1328.750] (-1333.588) -- 0:02:14
488000 -- (-1353.636) [-1336.686] (-1353.642) (-1347.145) * [-1337.374] (-1343.236) (-1337.855) (-1338.840) -- 0:02:15
488500 -- [-1336.760] (-1343.580) (-1349.182) (-1339.408) * (-1336.980) [-1329.834] (-1340.977) (-1345.752) -- 0:02:15
489000 -- (-1338.408) (-1350.835) (-1347.451) [-1335.635] * (-1333.387) [-1339.148] (-1343.895) (-1344.880) -- 0:02:14
489500 -- (-1336.096) [-1338.953] (-1337.360) (-1330.349) * (-1340.386) (-1341.470) (-1358.292) [-1335.167] -- 0:02:14
490000 -- (-1335.148) [-1342.201] (-1350.093) (-1336.352) * (-1336.961) [-1326.353] (-1345.451) (-1335.901) -- 0:02:14
Average standard deviation of split frequencies: 0.010835
490500 -- (-1350.830) [-1344.088] (-1340.462) (-1334.323) * (-1330.504) (-1335.177) (-1348.746) [-1331.452] -- 0:02:13
491000 -- (-1342.257) (-1343.233) (-1339.270) [-1335.642] * (-1334.781) [-1330.556] (-1347.922) (-1341.644) -- 0:02:13
491500 -- [-1334.026] (-1345.491) (-1340.213) (-1338.311) * (-1340.614) (-1335.082) (-1357.417) [-1338.811] -- 0:02:14
492000 -- (-1331.621) (-1351.339) [-1331.386] (-1347.101) * (-1335.152) (-1339.554) (-1352.527) [-1335.839] -- 0:02:14
492500 -- (-1337.778) (-1335.358) [-1344.974] (-1335.892) * [-1339.411] (-1338.206) (-1348.046) (-1334.901) -- 0:02:13
493000 -- (-1341.704) (-1339.291) (-1335.051) [-1330.272] * [-1333.271] (-1335.588) (-1346.415) (-1335.537) -- 0:02:13
493500 -- (-1335.011) [-1338.508] (-1337.051) (-1336.005) * (-1340.459) [-1333.499] (-1342.967) (-1347.505) -- 0:02:13
494000 -- (-1345.761) [-1338.562] (-1342.837) (-1346.612) * (-1337.177) [-1333.250] (-1342.571) (-1341.129) -- 0:02:13
494500 -- (-1342.365) (-1350.137) (-1329.407) [-1337.716] * [-1336.250] (-1340.940) (-1342.016) (-1349.864) -- 0:02:12
495000 -- (-1342.944) (-1343.588) (-1329.405) [-1336.004] * [-1333.581] (-1338.793) (-1353.921) (-1357.573) -- 0:02:12
Average standard deviation of split frequencies: 0.011088
495500 -- (-1340.545) (-1329.403) (-1331.468) [-1338.218] * (-1332.797) (-1337.162) [-1333.230] (-1348.058) -- 0:02:13
496000 -- (-1341.408) (-1340.418) [-1347.885] (-1335.660) * [-1333.661] (-1344.473) (-1333.288) (-1341.793) -- 0:02:13
496500 -- (-1331.000) (-1341.025) [-1328.510] (-1332.094) * (-1335.661) [-1334.625] (-1333.665) (-1342.703) -- 0:02:12
497000 -- (-1344.102) (-1336.459) [-1329.659] (-1348.098) * [-1341.683] (-1336.462) (-1347.429) (-1336.136) -- 0:02:12
497500 -- (-1344.825) (-1333.188) (-1339.213) [-1332.357] * (-1332.894) (-1337.223) (-1341.239) [-1339.680] -- 0:02:12
498000 -- (-1341.469) (-1338.319) (-1345.985) [-1339.718] * (-1351.777) [-1333.554] (-1343.080) (-1339.215) -- 0:02:12
498500 -- (-1342.722) (-1339.466) (-1337.453) [-1333.746] * (-1341.484) [-1333.085] (-1334.004) (-1333.341) -- 0:02:11
499000 -- (-1354.125) [-1339.679] (-1335.786) (-1335.073) * (-1343.366) [-1330.427] (-1336.020) (-1340.090) -- 0:02:11
499500 -- [-1346.917] (-1332.717) (-1355.798) (-1333.067) * [-1338.059] (-1337.378) (-1348.112) (-1347.016) -- 0:02:12
500000 -- (-1346.427) [-1335.644] (-1343.559) (-1340.858) * (-1343.426) [-1343.669] (-1351.106) (-1348.527) -- 0:02:12
Average standard deviation of split frequencies: 0.011822
500500 -- (-1354.115) [-1341.246] (-1334.939) (-1341.047) * (-1339.320) (-1342.856) [-1340.144] (-1349.455) -- 0:02:11
501000 -- (-1341.966) (-1348.122) (-1336.698) [-1332.374] * (-1342.324) (-1339.413) (-1346.210) [-1333.542] -- 0:02:11
501500 -- (-1337.639) [-1331.185] (-1335.408) (-1334.028) * [-1347.944] (-1338.740) (-1344.647) (-1336.385) -- 0:02:11
502000 -- (-1349.880) (-1341.727) [-1335.763] (-1338.488) * (-1349.801) [-1330.385] (-1340.527) (-1341.852) -- 0:02:10
502500 -- (-1332.158) [-1341.800] (-1341.600) (-1341.982) * (-1339.376) (-1334.127) (-1336.551) [-1339.532] -- 0:02:10
503000 -- (-1339.616) [-1334.919] (-1355.109) (-1333.100) * (-1346.645) [-1333.451] (-1342.865) (-1334.994) -- 0:02:11
503500 -- (-1343.201) (-1337.807) [-1338.469] (-1332.740) * (-1338.261) [-1338.577] (-1341.045) (-1334.959) -- 0:02:11
504000 -- [-1341.791] (-1331.911) (-1333.135) (-1336.219) * (-1342.697) (-1339.006) [-1337.314] (-1332.984) -- 0:02:10
504500 -- (-1352.534) (-1334.209) [-1335.647] (-1348.608) * (-1338.745) (-1337.630) [-1335.963] (-1336.811) -- 0:02:10
505000 -- (-1341.789) (-1342.368) (-1339.023) [-1338.305] * (-1348.209) (-1344.792) (-1346.948) [-1338.209] -- 0:02:10
Average standard deviation of split frequencies: 0.011490
505500 -- [-1346.269] (-1339.806) (-1327.678) (-1339.107) * [-1342.868] (-1339.261) (-1338.637) (-1331.750) -- 0:02:10
506000 -- (-1343.959) (-1344.027) [-1334.329] (-1346.115) * (-1341.527) [-1329.318] (-1357.510) (-1341.801) -- 0:02:09
506500 -- (-1338.892) (-1339.739) (-1337.671) [-1337.749] * (-1350.062) [-1336.081] (-1335.933) (-1336.594) -- 0:02:09
507000 -- (-1334.536) (-1337.255) (-1333.628) [-1344.780] * (-1334.156) (-1332.199) [-1338.544] (-1341.599) -- 0:02:10
507500 -- [-1338.970] (-1341.833) (-1343.912) (-1335.028) * (-1340.065) (-1336.120) (-1340.183) [-1341.138] -- 0:02:10
508000 -- (-1349.473) (-1337.639) (-1332.897) [-1333.827] * (-1345.781) (-1338.113) [-1335.704] (-1346.312) -- 0:02:09
508500 -- (-1330.880) (-1347.223) [-1328.996] (-1339.632) * (-1330.389) [-1332.936] (-1353.688) (-1334.546) -- 0:02:09
509000 -- (-1339.719) (-1339.478) [-1333.030] (-1342.529) * (-1343.110) (-1339.547) (-1340.365) [-1338.634] -- 0:02:09
509500 -- (-1349.052) (-1338.547) (-1341.848) [-1335.066] * (-1332.272) [-1333.875] (-1334.498) (-1338.885) -- 0:02:09
510000 -- (-1338.460) (-1342.753) (-1335.327) [-1342.449] * (-1354.677) (-1346.461) [-1339.337] (-1346.541) -- 0:02:08
Average standard deviation of split frequencies: 0.010462
510500 -- (-1341.354) [-1334.048] (-1339.224) (-1341.922) * (-1337.245) (-1334.734) (-1334.128) [-1342.915] -- 0:02:08
511000 -- (-1337.062) (-1342.234) (-1338.786) [-1340.891] * (-1340.119) (-1338.464) (-1331.966) [-1345.527] -- 0:02:09
511500 -- [-1339.354] (-1343.277) (-1337.657) (-1342.304) * [-1340.764] (-1338.828) (-1340.955) (-1337.992) -- 0:02:08
512000 -- (-1330.302) (-1344.814) (-1347.327) [-1340.451] * (-1359.993) (-1339.958) (-1337.152) [-1329.979] -- 0:02:08
512500 -- [-1335.576] (-1345.037) (-1342.498) (-1342.223) * (-1344.268) [-1329.925] (-1337.071) (-1345.080) -- 0:02:08
513000 -- (-1345.974) (-1346.231) [-1334.752] (-1344.472) * [-1346.817] (-1339.783) (-1345.642) (-1357.563) -- 0:02:08
513500 -- (-1336.990) [-1333.908] (-1335.498) (-1335.402) * (-1340.233) (-1350.523) [-1337.462] (-1332.297) -- 0:02:07
514000 -- [-1341.681] (-1343.884) (-1351.140) (-1339.225) * (-1346.021) [-1336.802] (-1331.222) (-1335.432) -- 0:02:07
514500 -- [-1340.034] (-1343.627) (-1343.314) (-1342.180) * (-1342.306) (-1335.737) (-1340.396) [-1328.887] -- 0:02:08
515000 -- (-1343.464) (-1338.288) [-1335.961] (-1343.129) * (-1346.514) (-1343.337) [-1338.678] (-1337.468) -- 0:02:08
Average standard deviation of split frequencies: 0.010506
515500 -- [-1341.042] (-1341.917) (-1339.958) (-1337.056) * (-1331.638) [-1335.154] (-1339.043) (-1339.058) -- 0:02:07
516000 -- (-1341.096) (-1346.694) [-1338.001] (-1332.813) * [-1330.663] (-1334.544) (-1334.283) (-1341.246) -- 0:02:07
516500 -- (-1344.720) (-1343.267) [-1333.953] (-1348.025) * (-1335.224) (-1341.824) [-1341.489] (-1337.920) -- 0:02:07
517000 -- (-1344.480) (-1353.031) [-1331.238] (-1347.095) * (-1342.217) (-1340.931) [-1343.336] (-1344.021) -- 0:02:07
517500 -- (-1343.444) (-1349.021) [-1336.558] (-1356.573) * (-1330.312) [-1336.565] (-1342.049) (-1343.147) -- 0:02:06
518000 -- (-1339.105) [-1336.377] (-1334.365) (-1341.357) * (-1340.791) (-1351.935) (-1345.750) [-1336.087] -- 0:02:06
518500 -- (-1341.392) (-1337.389) [-1334.657] (-1337.994) * (-1340.280) [-1333.672] (-1347.681) (-1331.605) -- 0:02:07
519000 -- (-1335.606) (-1347.723) [-1331.284] (-1345.433) * (-1338.012) (-1330.510) [-1341.539] (-1337.958) -- 0:02:06
519500 -- [-1332.273] (-1336.975) (-1339.777) (-1341.829) * (-1345.828) [-1334.658] (-1341.296) (-1334.805) -- 0:02:06
520000 -- (-1341.609) (-1334.884) (-1336.432) [-1332.581] * (-1341.644) [-1336.575] (-1337.608) (-1333.089) -- 0:02:06
Average standard deviation of split frequencies: 0.010462
520500 -- (-1348.882) [-1341.198] (-1337.168) (-1352.415) * (-1347.706) (-1346.774) (-1338.166) [-1328.492] -- 0:02:06
521000 -- [-1343.104] (-1353.520) (-1347.954) (-1340.738) * (-1341.975) [-1333.688] (-1344.848) (-1341.649) -- 0:02:05
521500 -- (-1346.436) [-1339.741] (-1343.097) (-1340.306) * (-1353.500) (-1341.549) (-1347.801) [-1340.373] -- 0:02:05
522000 -- (-1358.082) (-1350.754) [-1334.505] (-1345.996) * [-1337.056] (-1336.591) (-1332.946) (-1341.641) -- 0:02:06
522500 -- (-1348.000) (-1333.685) [-1336.391] (-1332.574) * (-1343.617) [-1338.849] (-1342.213) (-1340.706) -- 0:02:06
523000 -- (-1338.031) [-1341.605] (-1335.913) (-1332.484) * (-1353.574) [-1332.133] (-1340.690) (-1349.196) -- 0:02:05
523500 -- (-1342.441) (-1337.140) (-1331.767) [-1332.728] * (-1337.424) (-1336.598) (-1333.319) [-1332.374] -- 0:02:05
524000 -- (-1344.024) (-1337.222) (-1338.224) [-1336.689] * (-1343.257) [-1334.273] (-1342.977) (-1348.406) -- 0:02:05
524500 -- (-1337.838) (-1336.919) [-1338.520] (-1354.530) * (-1337.295) [-1333.206] (-1337.375) (-1342.103) -- 0:02:05
525000 -- (-1335.991) (-1342.785) [-1332.810] (-1349.192) * (-1333.215) (-1343.053) (-1341.255) [-1338.369] -- 0:02:04
Average standard deviation of split frequencies: 0.010555
525500 -- [-1335.389] (-1337.391) (-1338.193) (-1348.685) * [-1335.948] (-1335.532) (-1338.286) (-1352.745) -- 0:02:04
526000 -- [-1331.302] (-1340.623) (-1339.798) (-1356.050) * (-1341.649) (-1347.032) [-1334.822] (-1329.953) -- 0:02:05
526500 -- [-1333.394] (-1340.013) (-1345.428) (-1340.949) * (-1340.602) (-1339.414) [-1336.142] (-1335.248) -- 0:02:05
527000 -- [-1336.073] (-1335.072) (-1348.480) (-1344.188) * (-1342.076) (-1353.901) (-1338.679) [-1334.044] -- 0:02:04
527500 -- (-1344.459) (-1333.611) (-1338.262) [-1335.560] * (-1337.413) (-1333.132) [-1341.900] (-1343.931) -- 0:02:04
528000 -- [-1333.692] (-1350.154) (-1329.635) (-1342.860) * (-1340.937) (-1329.861) (-1341.933) [-1333.430] -- 0:02:04
528500 -- (-1339.798) [-1335.924] (-1333.974) (-1343.066) * (-1341.340) (-1341.525) (-1340.001) [-1334.437] -- 0:02:04
529000 -- [-1327.879] (-1339.692) (-1335.017) (-1339.832) * [-1335.651] (-1333.968) (-1339.902) (-1337.020) -- 0:02:03
529500 -- (-1343.982) (-1338.615) (-1348.895) [-1342.118] * (-1338.209) (-1338.379) (-1350.264) [-1334.166] -- 0:02:04
530000 -- [-1342.571] (-1339.652) (-1357.043) (-1341.512) * (-1338.214) (-1338.061) [-1333.373] (-1342.592) -- 0:02:04
Average standard deviation of split frequencies: 0.010800
530500 -- [-1333.618] (-1333.087) (-1349.641) (-1333.279) * [-1340.531] (-1339.536) (-1343.057) (-1338.517) -- 0:02:03
531000 -- (-1339.033) [-1333.790] (-1344.854) (-1340.241) * (-1354.179) [-1342.710] (-1342.648) (-1334.816) -- 0:02:03
531500 -- (-1355.758) (-1345.811) [-1338.922] (-1346.195) * (-1342.370) (-1342.473) (-1336.273) [-1332.550] -- 0:02:03
532000 -- (-1342.561) (-1336.138) [-1339.912] (-1342.568) * (-1343.064) [-1336.701] (-1353.682) (-1337.029) -- 0:02:03
532500 -- (-1342.404) (-1333.962) (-1345.794) [-1342.052] * (-1345.533) (-1348.347) (-1335.656) [-1336.700] -- 0:02:02
533000 -- (-1341.664) (-1340.491) (-1342.513) [-1337.974] * (-1352.787) (-1342.178) (-1331.320) [-1331.166] -- 0:02:02
533500 -- (-1339.705) (-1342.438) [-1335.029] (-1343.111) * (-1345.224) (-1333.988) (-1343.564) [-1334.074] -- 0:02:03
534000 -- (-1340.190) (-1345.478) (-1339.806) [-1338.946] * (-1346.318) (-1331.411) (-1338.856) [-1333.315] -- 0:02:03
534500 -- (-1337.145) (-1343.602) [-1334.177] (-1344.280) * (-1337.861) (-1346.195) (-1334.560) [-1334.389] -- 0:02:02
535000 -- [-1333.369] (-1347.087) (-1338.917) (-1344.733) * (-1333.689) (-1339.599) [-1328.399] (-1337.842) -- 0:02:02
Average standard deviation of split frequencies: 0.010924
535500 -- [-1337.936] (-1352.901) (-1337.807) (-1339.068) * [-1331.250] (-1344.308) (-1337.679) (-1335.613) -- 0:02:02
536000 -- [-1329.856] (-1342.198) (-1340.803) (-1336.103) * (-1333.745) (-1350.677) (-1347.341) [-1342.378] -- 0:02:02
536500 -- (-1338.004) (-1342.144) [-1344.383] (-1338.480) * (-1333.014) (-1334.996) (-1342.266) [-1333.257] -- 0:02:01
537000 -- [-1337.259] (-1342.780) (-1344.851) (-1336.210) * (-1332.026) [-1343.085] (-1336.256) (-1339.662) -- 0:02:02
537500 -- [-1337.955] (-1347.055) (-1342.262) (-1349.662) * (-1336.934) (-1341.475) (-1346.452) [-1327.993] -- 0:02:02
538000 -- (-1334.500) (-1347.706) (-1343.080) [-1332.173] * [-1335.061] (-1336.506) (-1342.155) (-1347.708) -- 0:02:01
538500 -- (-1346.473) (-1342.345) [-1340.017] (-1337.858) * (-1334.928) (-1331.746) [-1330.276] (-1335.173) -- 0:02:01
539000 -- (-1344.415) [-1337.296] (-1339.671) (-1342.095) * (-1341.033) (-1342.033) [-1331.860] (-1336.604) -- 0:02:01
539500 -- (-1355.848) [-1337.707] (-1334.055) (-1341.909) * (-1340.840) (-1332.851) [-1336.574] (-1339.381) -- 0:02:01
540000 -- (-1347.250) [-1336.339] (-1336.650) (-1339.194) * (-1337.362) [-1332.446] (-1344.146) (-1337.694) -- 0:02:00
Average standard deviation of split frequencies: 0.011243
540500 -- (-1337.480) (-1348.098) (-1345.561) [-1337.349] * (-1337.021) (-1346.313) (-1343.313) [-1335.468] -- 0:02:00
541000 -- (-1340.652) [-1333.943] (-1339.119) (-1334.424) * [-1338.769] (-1339.929) (-1341.919) (-1339.418) -- 0:02:01
541500 -- (-1337.179) (-1342.577) (-1343.477) [-1333.284] * (-1342.322) (-1335.604) (-1342.710) [-1343.080] -- 0:02:01
542000 -- [-1339.486] (-1344.062) (-1349.207) (-1333.224) * (-1333.017) [-1338.201] (-1347.012) (-1333.668) -- 0:02:00
542500 -- (-1334.573) (-1347.105) [-1333.456] (-1340.911) * [-1332.886] (-1342.682) (-1344.306) (-1346.069) -- 0:02:00
543000 -- (-1338.810) (-1337.368) (-1338.207) [-1331.009] * [-1335.381] (-1340.442) (-1359.552) (-1350.061) -- 0:02:00
543500 -- (-1342.994) [-1334.633] (-1344.759) (-1338.981) * (-1342.649) (-1339.774) [-1340.324] (-1332.367) -- 0:02:00
544000 -- [-1335.662] (-1338.517) (-1340.527) (-1338.295) * (-1335.239) [-1334.999] (-1335.870) (-1338.546) -- 0:01:59
544500 -- (-1342.939) (-1345.771) (-1338.498) [-1334.319] * [-1340.725] (-1344.349) (-1339.607) (-1343.558) -- 0:01:59
545000 -- (-1334.481) (-1338.341) (-1342.474) [-1336.117] * [-1335.423] (-1331.288) (-1342.095) (-1338.253) -- 0:02:00
Average standard deviation of split frequencies: 0.010409
545500 -- (-1331.139) (-1338.020) (-1335.667) [-1334.923] * (-1339.610) [-1342.049] (-1347.391) (-1347.628) -- 0:01:59
546000 -- (-1332.695) [-1337.459] (-1333.048) (-1344.988) * (-1339.970) [-1338.316] (-1330.479) (-1344.972) -- 0:01:59
546500 -- (-1348.731) (-1338.867) [-1329.073] (-1341.032) * [-1336.373] (-1337.256) (-1340.783) (-1344.661) -- 0:01:59
547000 -- [-1345.439] (-1344.621) (-1336.159) (-1343.749) * [-1332.943] (-1336.787) (-1339.439) (-1340.522) -- 0:01:59
547500 -- (-1336.377) [-1336.189] (-1343.441) (-1334.449) * (-1336.753) (-1340.589) (-1335.569) [-1335.221] -- 0:01:59
548000 -- [-1330.126] (-1338.587) (-1333.662) (-1332.781) * (-1339.855) (-1338.279) (-1342.075) [-1334.677] -- 0:01:58
548500 -- [-1337.565] (-1335.518) (-1336.269) (-1344.195) * [-1341.169] (-1339.029) (-1341.942) (-1345.503) -- 0:01:59
549000 -- (-1347.772) [-1338.737] (-1337.606) (-1342.130) * (-1332.072) (-1340.604) (-1337.499) [-1330.631] -- 0:01:59
549500 -- (-1345.954) (-1340.338) [-1340.229] (-1334.089) * (-1333.860) (-1342.272) [-1341.164] (-1340.299) -- 0:01:58
550000 -- (-1337.336) [-1338.385] (-1346.518) (-1343.194) * (-1341.395) (-1343.603) [-1339.216] (-1347.204) -- 0:01:58
Average standard deviation of split frequencies: 0.010463
550500 -- [-1340.784] (-1342.190) (-1330.093) (-1335.750) * (-1351.071) (-1340.186) (-1346.467) [-1337.172] -- 0:01:58
551000 -- (-1343.553) (-1341.689) [-1337.007] (-1348.276) * (-1339.728) (-1350.788) (-1348.003) [-1329.862] -- 0:01:58
551500 -- (-1336.411) (-1343.078) (-1336.116) [-1334.669] * (-1334.211) (-1344.178) [-1344.234] (-1330.233) -- 0:01:57
552000 -- [-1329.225] (-1343.630) (-1338.569) (-1336.200) * [-1334.277] (-1343.351) (-1344.748) (-1335.429) -- 0:01:57
552500 -- [-1337.581] (-1332.679) (-1339.964) (-1331.205) * (-1334.636) (-1343.397) [-1336.941] (-1333.000) -- 0:01:58
553000 -- (-1347.080) (-1334.671) [-1338.724] (-1333.301) * (-1337.976) (-1345.243) [-1337.183] (-1330.006) -- 0:01:58
553500 -- (-1341.797) [-1335.435] (-1350.165) (-1335.229) * (-1328.075) (-1340.938) (-1337.549) [-1329.634] -- 0:01:57
554000 -- (-1343.703) [-1334.173] (-1330.911) (-1347.625) * [-1328.441] (-1342.122) (-1335.489) (-1336.088) -- 0:01:57
554500 -- (-1348.261) [-1333.956] (-1335.328) (-1337.976) * (-1329.960) (-1338.268) [-1329.955] (-1341.284) -- 0:01:57
555000 -- (-1351.389) (-1336.679) (-1334.593) [-1335.384] * (-1336.299) (-1346.847) (-1338.401) [-1338.911] -- 0:01:57
Average standard deviation of split frequencies: 0.010739
555500 -- (-1336.442) (-1339.961) [-1335.536] (-1334.715) * (-1347.200) [-1332.261] (-1335.873) (-1331.551) -- 0:01:56
556000 -- (-1333.575) (-1342.553) (-1338.173) [-1338.828] * (-1337.039) (-1339.107) (-1348.310) [-1335.031] -- 0:01:56
556500 -- (-1335.182) (-1332.953) (-1345.566) [-1328.287] * [-1336.785] (-1342.621) (-1330.344) (-1347.313) -- 0:01:57
557000 -- (-1331.007) [-1335.072] (-1336.567) (-1336.052) * (-1336.405) [-1343.020] (-1340.282) (-1350.239) -- 0:01:56
557500 -- [-1327.025] (-1339.620) (-1350.819) (-1346.406) * [-1333.749] (-1338.484) (-1334.974) (-1334.870) -- 0:01:56
558000 -- (-1352.902) [-1337.322] (-1345.811) (-1333.712) * (-1341.948) (-1341.972) [-1335.581] (-1336.705) -- 0:01:56
558500 -- (-1343.525) (-1334.708) [-1333.690] (-1335.181) * (-1340.861) (-1336.793) [-1332.855] (-1341.121) -- 0:01:56
559000 -- (-1332.645) (-1334.986) [-1327.253] (-1340.834) * (-1359.369) [-1329.924] (-1341.361) (-1338.677) -- 0:01:55
559500 -- (-1337.308) (-1333.470) [-1330.161] (-1345.679) * [-1348.371] (-1335.330) (-1338.414) (-1349.575) -- 0:01:55
560000 -- (-1354.420) (-1343.203) [-1339.675] (-1337.961) * (-1338.687) [-1335.150] (-1350.264) (-1345.603) -- 0:01:56
Average standard deviation of split frequencies: 0.010697
560500 -- (-1353.474) (-1343.625) (-1337.250) [-1331.636] * (-1343.707) [-1335.327] (-1343.502) (-1332.597) -- 0:01:56
561000 -- (-1341.684) (-1334.714) [-1333.111] (-1332.375) * (-1350.966) [-1335.119] (-1340.437) (-1348.802) -- 0:01:55
561500 -- (-1356.743) [-1339.052] (-1332.720) (-1343.403) * [-1334.276] (-1335.157) (-1354.156) (-1350.808) -- 0:01:55
562000 -- (-1340.763) [-1340.146] (-1342.213) (-1331.652) * (-1334.831) (-1338.527) (-1346.407) [-1330.069] -- 0:01:55
562500 -- (-1350.277) (-1342.893) [-1338.100] (-1330.176) * (-1334.032) (-1348.060) (-1350.007) [-1343.701] -- 0:01:55
563000 -- (-1335.572) (-1340.682) [-1331.723] (-1340.860) * (-1343.974) (-1345.832) (-1344.886) [-1335.772] -- 0:01:54
563500 -- (-1341.121) (-1337.142) [-1335.561] (-1343.302) * [-1338.745] (-1338.807) (-1333.951) (-1329.582) -- 0:01:54
564000 -- (-1343.829) (-1328.052) [-1334.740] (-1346.180) * (-1335.733) [-1332.149] (-1340.712) (-1335.917) -- 0:01:55
564500 -- (-1332.677) [-1340.558] (-1340.127) (-1347.736) * (-1337.720) [-1331.397] (-1345.837) (-1333.524) -- 0:01:54
565000 -- (-1328.762) (-1341.988) (-1335.880) [-1341.199] * (-1335.978) (-1339.140) [-1332.125] (-1330.539) -- 0:01:54
Average standard deviation of split frequencies: 0.010365
565500 -- (-1331.410) (-1341.721) [-1325.962] (-1332.344) * [-1330.959] (-1343.921) (-1349.473) (-1338.411) -- 0:01:54
566000 -- (-1353.775) (-1346.208) [-1336.628] (-1342.314) * [-1324.541] (-1337.972) (-1335.046) (-1336.927) -- 0:01:54
566500 -- [-1336.196] (-1341.628) (-1360.428) (-1341.009) * [-1333.930] (-1341.053) (-1341.084) (-1342.283) -- 0:01:54
567000 -- [-1336.467] (-1352.298) (-1330.308) (-1336.984) * (-1330.260) [-1338.551] (-1339.377) (-1335.825) -- 0:01:53
567500 -- [-1330.543] (-1348.285) (-1343.617) (-1337.418) * (-1337.768) (-1339.881) [-1339.578] (-1343.106) -- 0:01:53
568000 -- (-1338.076) (-1345.683) (-1338.640) [-1336.014] * (-1342.911) [-1327.565] (-1338.246) (-1348.025) -- 0:01:54
568500 -- (-1334.643) (-1352.605) [-1335.618] (-1344.947) * (-1342.493) (-1332.371) (-1348.348) [-1334.624] -- 0:01:53
569000 -- (-1341.060) [-1332.266] (-1343.016) (-1334.307) * [-1333.226] (-1333.498) (-1348.867) (-1337.488) -- 0:01:53
569500 -- (-1340.607) (-1349.105) [-1338.075] (-1344.469) * (-1340.573) [-1333.603] (-1349.111) (-1339.818) -- 0:01:53
570000 -- [-1334.195] (-1344.096) (-1330.459) (-1345.765) * (-1335.728) (-1334.495) (-1339.686) [-1333.853] -- 0:01:53
Average standard deviation of split frequencies: 0.010739
570500 -- (-1336.995) (-1341.180) (-1328.348) [-1335.534] * (-1336.589) [-1333.141] (-1341.525) (-1344.048) -- 0:01:52
571000 -- (-1339.138) [-1342.457] (-1331.780) (-1342.744) * (-1335.885) [-1337.117] (-1349.612) (-1336.683) -- 0:01:52
571500 -- [-1339.918] (-1350.235) (-1346.212) (-1338.394) * [-1342.861] (-1349.654) (-1342.077) (-1345.510) -- 0:01:52
572000 -- (-1334.412) (-1335.900) [-1333.529] (-1346.266) * (-1347.985) (-1336.571) (-1351.081) [-1338.402] -- 0:01:52
572500 -- (-1344.023) (-1330.945) (-1331.336) [-1333.015] * (-1344.398) [-1339.481] (-1350.853) (-1342.136) -- 0:01:52
573000 -- [-1339.169] (-1340.475) (-1341.363) (-1340.084) * (-1332.032) [-1341.152] (-1336.566) (-1344.161) -- 0:01:52
573500 -- [-1336.965] (-1352.343) (-1339.540) (-1344.816) * (-1337.413) (-1349.084) (-1333.697) [-1338.696] -- 0:01:52
574000 -- (-1329.554) (-1335.435) (-1343.398) [-1335.705] * [-1332.869] (-1340.548) (-1346.121) (-1344.747) -- 0:01:52
574500 -- (-1338.847) [-1337.610] (-1345.247) (-1335.037) * (-1337.919) (-1339.695) [-1332.139] (-1341.449) -- 0:01:51
575000 -- (-1348.785) [-1333.291] (-1342.952) (-1340.573) * (-1340.295) (-1346.626) [-1336.221] (-1348.639) -- 0:01:51
Average standard deviation of split frequencies: 0.010776
575500 -- (-1338.430) (-1350.384) [-1334.318] (-1330.823) * (-1342.390) (-1347.528) [-1336.284] (-1349.453) -- 0:01:52
576000 -- [-1338.272] (-1338.196) (-1336.635) (-1343.739) * (-1351.743) [-1327.318] (-1335.826) (-1338.926) -- 0:01:51
576500 -- (-1352.711) [-1330.296] (-1340.555) (-1340.393) * (-1339.152) (-1337.295) (-1342.515) [-1341.807] -- 0:01:51
577000 -- (-1339.985) (-1343.669) (-1334.810) [-1342.078] * (-1342.371) (-1332.394) [-1343.997] (-1333.681) -- 0:01:51
577500 -- (-1343.039) (-1346.169) [-1346.521] (-1338.387) * (-1339.321) [-1333.927] (-1340.677) (-1341.620) -- 0:01:51
578000 -- (-1328.698) (-1340.262) (-1342.882) [-1334.608] * (-1345.903) (-1333.064) (-1344.095) [-1333.140] -- 0:01:50
578500 -- [-1335.814] (-1343.593) (-1338.967) (-1345.117) * (-1331.057) [-1343.071] (-1338.551) (-1349.426) -- 0:01:50
579000 -- (-1333.344) (-1335.210) [-1335.849] (-1340.627) * [-1338.750] (-1334.182) (-1348.637) (-1340.094) -- 0:01:50
579500 -- (-1335.231) [-1332.312] (-1351.052) (-1343.973) * (-1339.698) [-1333.145] (-1332.823) (-1346.191) -- 0:01:51
580000 -- (-1344.574) (-1339.367) [-1337.295] (-1342.025) * [-1336.699] (-1342.199) (-1334.343) (-1353.866) -- 0:01:50
Average standard deviation of split frequencies: 0.011275
580500 -- (-1340.256) [-1335.808] (-1349.276) (-1338.619) * (-1336.049) (-1334.129) [-1332.643] (-1330.785) -- 0:01:50
581000 -- [-1332.613] (-1344.860) (-1346.058) (-1335.248) * (-1347.232) (-1339.820) (-1334.281) [-1340.538] -- 0:01:50
581500 -- [-1337.465] (-1337.224) (-1348.430) (-1342.573) * [-1346.379] (-1348.602) (-1347.597) (-1333.574) -- 0:01:50
582000 -- (-1348.167) (-1333.884) (-1337.633) [-1331.816] * (-1335.681) (-1341.692) [-1342.330] (-1340.697) -- 0:01:49
582500 -- (-1342.915) [-1336.431] (-1341.166) (-1337.667) * [-1343.196] (-1346.861) (-1340.683) (-1335.977) -- 0:01:49
583000 -- (-1340.086) [-1338.395] (-1336.794) (-1334.382) * (-1335.923) [-1333.977] (-1337.477) (-1342.749) -- 0:01:49
583500 -- [-1342.657] (-1340.669) (-1339.435) (-1339.498) * (-1356.192) (-1340.802) [-1335.442] (-1330.298) -- 0:01:49
584000 -- (-1348.847) (-1336.539) (-1347.428) [-1331.841] * (-1355.210) (-1351.285) [-1338.333] (-1346.554) -- 0:01:49
584500 -- (-1334.516) (-1338.525) (-1352.743) [-1329.480] * (-1353.028) (-1350.238) [-1333.387] (-1343.334) -- 0:01:49
585000 -- (-1338.625) (-1341.005) [-1337.809] (-1336.045) * (-1340.582) (-1334.822) [-1331.383] (-1335.353) -- 0:01:49
Average standard deviation of split frequencies: 0.011039
585500 -- (-1340.317) [-1326.812] (-1337.841) (-1341.846) * (-1344.055) [-1338.168] (-1335.700) (-1345.440) -- 0:01:49
586000 -- [-1337.821] (-1339.676) (-1333.349) (-1341.416) * [-1332.764] (-1329.554) (-1333.077) (-1337.864) -- 0:01:48
586500 -- [-1342.234] (-1333.552) (-1336.595) (-1343.958) * [-1338.728] (-1341.684) (-1335.037) (-1342.542) -- 0:01:48
587000 -- [-1344.540] (-1335.848) (-1337.660) (-1343.822) * (-1342.135) (-1339.315) [-1340.600] (-1340.599) -- 0:01:49
587500 -- (-1338.030) [-1343.555] (-1346.132) (-1336.135) * (-1348.331) (-1335.194) (-1339.825) [-1335.499] -- 0:01:48
588000 -- (-1350.729) (-1353.609) (-1338.678) [-1328.793] * (-1346.163) (-1334.225) [-1337.985] (-1342.669) -- 0:01:48
588500 -- [-1336.123] (-1336.714) (-1352.861) (-1341.744) * (-1338.496) (-1337.824) [-1340.230] (-1341.555) -- 0:01:48
589000 -- (-1347.025) [-1330.780] (-1358.027) (-1338.196) * [-1332.725] (-1341.797) (-1341.309) (-1345.855) -- 0:01:48
589500 -- (-1342.843) (-1338.493) (-1352.613) [-1335.325] * (-1334.191) (-1344.030) [-1339.007] (-1335.350) -- 0:01:47
590000 -- [-1336.348] (-1336.816) (-1348.421) (-1339.496) * (-1334.001) (-1340.055) (-1343.054) [-1330.655] -- 0:01:47
Average standard deviation of split frequencies: 0.011218
590500 -- [-1327.345] (-1339.674) (-1348.004) (-1336.880) * (-1336.034) [-1330.876] (-1333.266) (-1341.883) -- 0:01:47
591000 -- [-1330.523] (-1341.577) (-1338.618) (-1337.152) * (-1331.368) [-1327.915] (-1335.464) (-1333.147) -- 0:01:47
591500 -- (-1340.956) (-1330.982) (-1340.899) [-1337.139] * (-1339.994) [-1345.142] (-1332.181) (-1331.984) -- 0:01:47
592000 -- (-1334.054) [-1330.742] (-1331.212) (-1335.860) * (-1334.629) (-1358.812) (-1335.818) [-1341.759] -- 0:01:47
592500 -- (-1329.314) (-1345.553) [-1342.429] (-1334.625) * (-1335.163) [-1345.183] (-1340.990) (-1344.747) -- 0:01:47
593000 -- [-1337.431] (-1331.451) (-1350.454) (-1339.419) * (-1346.901) (-1347.643) (-1330.446) [-1343.462] -- 0:01:47
593500 -- (-1339.692) (-1339.353) (-1340.402) [-1335.422] * (-1344.920) (-1335.166) [-1336.586] (-1330.769) -- 0:01:46
594000 -- [-1336.596] (-1337.164) (-1352.551) (-1333.556) * (-1335.179) [-1336.171] (-1345.271) (-1338.235) -- 0:01:46
594500 -- (-1332.330) (-1336.902) (-1336.400) [-1326.632] * [-1334.765] (-1337.964) (-1346.233) (-1341.045) -- 0:01:46
595000 -- [-1345.137] (-1336.765) (-1336.657) (-1342.092) * [-1335.255] (-1337.846) (-1337.096) (-1351.281) -- 0:01:46
Average standard deviation of split frequencies: 0.011117
595500 -- [-1346.848] (-1334.554) (-1341.762) (-1340.640) * (-1340.208) (-1326.997) (-1340.823) [-1338.240] -- 0:01:46
596000 -- (-1341.249) (-1341.576) [-1332.556] (-1341.329) * [-1328.090] (-1344.676) (-1332.845) (-1343.636) -- 0:01:46
596500 -- (-1344.013) [-1332.424] (-1334.407) (-1341.927) * [-1339.526] (-1333.484) (-1339.703) (-1338.565) -- 0:01:46
597000 -- (-1343.273) (-1329.799) (-1338.684) [-1337.266] * [-1329.231] (-1330.216) (-1333.478) (-1334.165) -- 0:01:45
597500 -- [-1336.179] (-1334.281) (-1339.210) (-1346.826) * [-1335.937] (-1336.720) (-1343.441) (-1331.190) -- 0:01:45
598000 -- [-1346.700] (-1332.791) (-1339.695) (-1348.339) * (-1336.033) (-1336.273) [-1336.084] (-1339.511) -- 0:01:45
598500 -- (-1347.880) (-1333.746) [-1337.632] (-1357.537) * (-1340.110) (-1343.945) [-1336.820] (-1337.735) -- 0:01:45
599000 -- (-1331.869) (-1330.369) (-1336.996) [-1337.160] * (-1340.652) (-1335.722) (-1353.721) [-1333.817] -- 0:01:45
599500 -- (-1343.878) (-1338.476) [-1331.859] (-1333.923) * [-1343.058] (-1337.722) (-1335.259) (-1346.227) -- 0:01:45
600000 -- (-1342.655) [-1328.044] (-1341.699) (-1340.587) * (-1345.980) [-1338.633] (-1340.603) (-1344.745) -- 0:01:45
Average standard deviation of split frequencies: 0.010944
600500 -- (-1332.436) (-1336.632) (-1329.710) [-1332.824] * (-1337.355) (-1341.120) [-1336.362] (-1331.497) -- 0:01:45
601000 -- [-1331.180] (-1340.740) (-1344.022) (-1335.739) * (-1340.519) [-1329.203] (-1341.120) (-1336.634) -- 0:01:44
601500 -- (-1345.613) (-1342.626) [-1350.764] (-1340.416) * (-1341.803) [-1333.332] (-1351.509) (-1335.512) -- 0:01:44
602000 -- (-1336.830) (-1344.171) (-1331.003) [-1335.689] * (-1345.384) [-1337.075] (-1340.689) (-1329.233) -- 0:01:44
602500 -- (-1332.935) (-1347.767) (-1339.598) [-1330.934] * (-1343.787) [-1334.132] (-1334.788) (-1332.429) -- 0:01:44
603000 -- (-1340.952) (-1343.907) [-1336.345] (-1337.984) * (-1333.767) (-1333.042) (-1337.451) [-1334.608] -- 0:01:44
603500 -- (-1346.798) (-1342.353) [-1326.757] (-1336.625) * (-1340.728) (-1341.945) [-1330.531] (-1333.840) -- 0:01:44
604000 -- (-1333.780) [-1342.084] (-1337.290) (-1352.951) * [-1345.881] (-1336.985) (-1335.240) (-1338.810) -- 0:01:44
604500 -- (-1339.053) (-1339.722) (-1332.307) [-1344.029] * (-1335.088) (-1344.883) (-1333.268) [-1335.409] -- 0:01:44
605000 -- (-1343.678) (-1357.800) [-1337.818] (-1332.901) * (-1337.351) (-1341.991) (-1346.626) [-1330.461] -- 0:01:43
Average standard deviation of split frequencies: 0.011279
605500 -- (-1339.304) (-1346.677) [-1333.466] (-1342.926) * (-1338.377) [-1342.224] (-1340.297) (-1336.998) -- 0:01:43
606000 -- [-1344.299] (-1349.272) (-1343.691) (-1340.586) * (-1350.267) (-1338.764) (-1342.993) [-1336.397] -- 0:01:44
606500 -- [-1330.855] (-1338.441) (-1341.173) (-1343.401) * (-1344.792) [-1336.115] (-1342.362) (-1342.048) -- 0:01:43
607000 -- (-1340.876) (-1333.631) [-1338.844] (-1341.177) * (-1337.767) [-1335.239] (-1342.268) (-1339.695) -- 0:01:43
607500 -- (-1344.670) (-1334.385) [-1334.061] (-1342.750) * (-1352.311) (-1341.941) (-1342.996) [-1339.247] -- 0:01:43
608000 -- [-1334.034] (-1335.146) (-1332.556) (-1336.002) * [-1338.443] (-1334.994) (-1338.392) (-1347.036) -- 0:01:43
608500 -- (-1345.158) [-1335.513] (-1346.055) (-1328.728) * (-1338.257) (-1336.359) (-1329.548) [-1342.944] -- 0:01:42
609000 -- (-1342.155) (-1341.848) [-1333.945] (-1346.417) * (-1332.640) (-1344.286) [-1334.894] (-1342.771) -- 0:01:42
609500 -- (-1342.613) [-1331.910] (-1332.830) (-1356.761) * [-1337.711] (-1345.047) (-1333.702) (-1343.154) -- 0:01:42
610000 -- (-1346.573) [-1341.558] (-1334.000) (-1331.212) * [-1339.413] (-1339.200) (-1347.167) (-1339.030) -- 0:01:42
Average standard deviation of split frequencies: 0.011451
610500 -- [-1333.495] (-1338.049) (-1334.777) (-1333.866) * [-1340.651] (-1340.892) (-1356.692) (-1338.891) -- 0:01:42
611000 -- (-1331.715) (-1344.767) [-1327.224] (-1331.622) * [-1336.236] (-1345.358) (-1345.364) (-1338.778) -- 0:01:42
611500 -- [-1332.351] (-1337.436) (-1335.409) (-1337.502) * (-1338.957) (-1345.725) [-1336.428] (-1339.643) -- 0:01:42
612000 -- (-1340.345) (-1342.430) (-1340.654) [-1337.493] * (-1354.443) [-1334.865] (-1337.085) (-1338.750) -- 0:01:42
612500 -- (-1343.219) (-1338.708) (-1351.051) [-1335.794] * (-1344.736) (-1343.251) (-1337.475) [-1343.198] -- 0:01:41
613000 -- (-1344.465) (-1329.147) (-1340.464) [-1331.089] * [-1337.659] (-1338.208) (-1334.539) (-1332.427) -- 0:01:41
613500 -- (-1346.466) [-1333.173] (-1344.014) (-1341.769) * (-1341.560) (-1334.499) (-1341.848) [-1331.379] -- 0:01:41
614000 -- (-1354.545) (-1337.166) (-1340.600) [-1337.371] * [-1339.019] (-1337.916) (-1349.069) (-1340.319) -- 0:01:41
614500 -- (-1337.997) [-1331.466] (-1348.361) (-1338.854) * (-1338.536) [-1340.128] (-1339.720) (-1351.506) -- 0:01:41
615000 -- (-1339.909) (-1337.155) [-1338.369] (-1336.008) * (-1332.633) (-1338.697) (-1343.081) [-1336.239] -- 0:01:41
Average standard deviation of split frequencies: 0.011607
615500 -- (-1335.512) (-1336.952) (-1332.463) [-1330.490] * (-1341.659) (-1339.177) (-1348.360) [-1340.486] -- 0:01:41
616000 -- (-1341.319) [-1334.008] (-1340.188) (-1337.593) * (-1342.500) [-1340.785] (-1349.157) (-1333.740) -- 0:01:40
616500 -- (-1351.073) (-1335.174) (-1337.010) [-1337.724] * [-1338.722] (-1333.686) (-1336.792) (-1347.405) -- 0:01:40
617000 -- (-1345.300) (-1330.873) [-1337.713] (-1335.464) * [-1332.574] (-1345.962) (-1340.160) (-1337.527) -- 0:01:40
617500 -- (-1349.915) (-1343.231) [-1334.267] (-1345.572) * [-1332.318] (-1342.073) (-1334.207) (-1341.811) -- 0:01:40
618000 -- (-1344.004) [-1332.559] (-1339.073) (-1351.175) * [-1336.406] (-1346.013) (-1329.300) (-1340.214) -- 0:01:40
618500 -- [-1339.920] (-1334.528) (-1338.927) (-1343.829) * [-1341.010] (-1335.947) (-1333.592) (-1347.817) -- 0:01:40
619000 -- [-1337.099] (-1351.857) (-1347.476) (-1344.198) * (-1346.343) (-1350.193) [-1337.856] (-1342.430) -- 0:01:40
619500 -- [-1340.816] (-1347.142) (-1351.470) (-1330.102) * [-1330.488] (-1347.364) (-1327.550) (-1342.925) -- 0:01:40
620000 -- [-1331.333] (-1338.827) (-1338.362) (-1337.753) * (-1340.234) (-1340.393) [-1330.843] (-1342.179) -- 0:01:39
Average standard deviation of split frequencies: 0.010886
620500 -- (-1336.863) [-1341.928] (-1346.169) (-1342.496) * (-1344.494) (-1337.747) (-1335.295) [-1333.975] -- 0:01:39
621000 -- (-1330.956) [-1336.345] (-1342.710) (-1340.782) * (-1343.430) (-1351.699) (-1336.126) [-1345.413] -- 0:01:39
621500 -- (-1349.888) (-1334.236) (-1343.660) [-1337.783] * [-1336.233] (-1346.039) (-1338.238) (-1336.530) -- 0:01:39
622000 -- (-1337.417) (-1329.739) (-1333.795) [-1333.686] * (-1337.330) (-1350.471) (-1341.763) [-1329.836] -- 0:01:39
622500 -- (-1349.874) (-1338.916) (-1341.628) [-1333.535] * [-1330.124] (-1343.530) (-1339.295) (-1331.525) -- 0:01:39
623000 -- (-1340.331) [-1329.996] (-1336.612) (-1331.023) * (-1344.413) [-1337.216] (-1333.809) (-1339.891) -- 0:01:39
623500 -- (-1348.625) (-1331.619) (-1343.412) [-1335.920] * (-1340.803) (-1329.953) [-1334.803] (-1347.383) -- 0:01:39
624000 -- (-1347.586) [-1331.707] (-1333.820) (-1331.994) * (-1337.475) [-1330.216] (-1333.596) (-1348.303) -- 0:01:38
624500 -- (-1349.878) (-1342.486) [-1334.032] (-1357.000) * (-1338.633) (-1330.959) (-1337.024) [-1331.602] -- 0:01:38
625000 -- [-1331.125] (-1338.597) (-1338.714) (-1353.991) * (-1341.282) (-1339.847) (-1347.266) [-1340.530] -- 0:01:38
Average standard deviation of split frequencies: 0.011254
625500 -- [-1333.853] (-1340.469) (-1349.812) (-1342.298) * [-1329.721] (-1336.877) (-1343.691) (-1344.017) -- 0:01:38
626000 -- (-1333.116) [-1344.511] (-1354.081) (-1338.658) * (-1357.745) [-1330.702] (-1339.425) (-1344.331) -- 0:01:38
626500 -- (-1344.058) [-1340.533] (-1333.469) (-1344.760) * (-1337.769) (-1324.485) [-1337.086] (-1334.976) -- 0:01:38
627000 -- (-1331.342) [-1330.792] (-1335.543) (-1344.301) * (-1345.965) (-1334.287) [-1338.150] (-1350.574) -- 0:01:38
627500 -- [-1334.338] (-1338.041) (-1348.652) (-1346.242) * (-1342.647) [-1342.936] (-1342.271) (-1331.699) -- 0:01:37
628000 -- (-1335.959) [-1337.996] (-1336.964) (-1347.943) * (-1344.546) [-1338.932] (-1329.178) (-1335.950) -- 0:01:37
628500 -- (-1343.024) (-1343.257) [-1342.347] (-1349.220) * (-1349.406) [-1330.742] (-1342.203) (-1346.042) -- 0:01:37
629000 -- (-1341.587) [-1341.902] (-1351.050) (-1340.740) * (-1348.108) [-1332.959] (-1344.322) (-1353.138) -- 0:01:37
629500 -- (-1339.687) [-1342.435] (-1342.095) (-1339.931) * (-1332.144) [-1333.224] (-1347.130) (-1339.840) -- 0:01:37
630000 -- (-1336.366) (-1336.579) (-1353.337) [-1342.210] * (-1344.032) (-1335.580) (-1343.359) [-1339.507] -- 0:01:37
Average standard deviation of split frequencies: 0.011793
630500 -- (-1347.451) (-1336.221) (-1339.479) [-1332.446] * (-1337.586) [-1340.967] (-1340.626) (-1349.411) -- 0:01:37
631000 -- (-1352.264) (-1335.557) (-1349.652) [-1337.467] * (-1352.736) (-1341.204) [-1342.233] (-1348.040) -- 0:01:37
631500 -- (-1339.445) (-1354.447) (-1340.110) [-1334.233] * (-1335.203) [-1331.064] (-1340.887) (-1339.018) -- 0:01:36
632000 -- [-1338.986] (-1333.061) (-1337.615) (-1328.891) * [-1341.984] (-1330.146) (-1336.385) (-1334.774) -- 0:01:36
632500 -- [-1336.782] (-1340.996) (-1351.637) (-1340.602) * (-1339.869) (-1339.647) [-1332.101] (-1339.338) -- 0:01:36
633000 -- (-1339.506) (-1350.226) (-1334.374) [-1339.419] * (-1340.907) (-1343.914) [-1333.982] (-1334.138) -- 0:01:36
633500 -- (-1339.218) (-1339.564) [-1330.905] (-1338.313) * (-1343.890) (-1341.236) [-1337.451] (-1333.413) -- 0:01:36
634000 -- [-1340.299] (-1334.929) (-1335.431) (-1338.651) * (-1331.345) [-1336.612] (-1353.116) (-1345.493) -- 0:01:36
634500 -- (-1346.273) (-1347.476) (-1333.274) [-1328.522] * [-1337.268] (-1332.584) (-1357.825) (-1339.149) -- 0:01:36
635000 -- [-1338.634] (-1339.964) (-1339.608) (-1346.467) * (-1337.295) [-1339.979] (-1344.155) (-1348.170) -- 0:01:35
Average standard deviation of split frequencies: 0.011324
635500 -- (-1343.511) [-1339.191] (-1341.659) (-1343.505) * (-1345.307) [-1332.468] (-1341.936) (-1342.353) -- 0:01:35
636000 -- (-1338.637) [-1334.878] (-1333.843) (-1340.865) * (-1349.752) (-1339.729) (-1344.795) [-1334.933] -- 0:01:35
636500 -- (-1336.529) (-1330.155) [-1329.893] (-1334.828) * [-1342.426] (-1338.252) (-1343.968) (-1339.373) -- 0:01:35
637000 -- (-1347.480) [-1333.473] (-1350.177) (-1345.308) * (-1334.005) [-1331.389] (-1336.985) (-1338.942) -- 0:01:35
637500 -- (-1334.500) [-1340.329] (-1334.664) (-1344.903) * [-1328.647] (-1339.612) (-1330.257) (-1339.746) -- 0:01:35
638000 -- (-1341.490) (-1327.195) (-1337.496) [-1338.583] * (-1342.003) (-1338.472) [-1331.307] (-1355.189) -- 0:01:35
638500 -- (-1329.251) (-1334.219) [-1331.822] (-1343.443) * (-1349.305) (-1344.932) (-1342.142) [-1332.748] -- 0:01:35
639000 -- (-1335.516) [-1335.663] (-1335.938) (-1333.507) * (-1344.845) (-1340.672) [-1337.150] (-1338.286) -- 0:01:34
639500 -- (-1358.383) [-1337.462] (-1339.293) (-1329.641) * (-1342.609) (-1343.030) (-1332.798) [-1345.038] -- 0:01:34
640000 -- (-1353.722) [-1344.502] (-1343.277) (-1341.525) * (-1348.596) (-1345.428) [-1340.529] (-1354.678) -- 0:01:34
Average standard deviation of split frequencies: 0.011773
640500 -- (-1345.832) (-1354.315) [-1335.180] (-1337.970) * (-1347.426) [-1328.593] (-1345.367) (-1356.194) -- 0:01:34
641000 -- (-1336.268) (-1345.689) (-1333.672) [-1341.193] * (-1333.669) (-1334.570) (-1339.679) [-1336.974] -- 0:01:34
641500 -- (-1335.472) (-1349.718) [-1335.208] (-1344.785) * (-1330.193) [-1327.216] (-1344.147) (-1336.213) -- 0:01:34
642000 -- (-1343.789) (-1344.396) (-1341.726) [-1335.862] * [-1326.608] (-1335.097) (-1339.591) (-1351.394) -- 0:01:34
642500 -- (-1356.132) (-1335.051) (-1351.316) [-1328.374] * [-1333.671] (-1339.051) (-1348.174) (-1345.155) -- 0:01:34
643000 -- (-1343.402) [-1339.563] (-1335.932) (-1349.396) * [-1334.895] (-1329.892) (-1352.563) (-1340.356) -- 0:01:33
643500 -- (-1341.276) (-1339.813) [-1327.856] (-1333.730) * (-1335.152) (-1338.684) (-1335.762) [-1338.975] -- 0:01:33
644000 -- (-1334.549) (-1336.545) [-1331.937] (-1343.724) * [-1338.513] (-1347.232) (-1339.555) (-1340.750) -- 0:01:33
644500 -- [-1336.189] (-1343.900) (-1344.147) (-1342.720) * (-1339.539) (-1334.754) (-1340.682) [-1334.242] -- 0:01:33
645000 -- [-1337.977] (-1339.456) (-1346.684) (-1344.111) * (-1343.961) [-1340.084] (-1338.820) (-1353.948) -- 0:01:33
Average standard deviation of split frequencies: 0.011351
645500 -- (-1337.934) (-1331.202) (-1338.834) [-1344.411] * (-1346.437) (-1339.486) (-1340.692) [-1334.402] -- 0:01:33
646000 -- [-1341.989] (-1346.213) (-1342.438) (-1337.829) * (-1347.331) (-1339.574) (-1341.398) [-1334.921] -- 0:01:33
646500 -- (-1335.346) (-1351.343) [-1340.486] (-1339.452) * (-1340.167) [-1331.102] (-1352.665) (-1358.953) -- 0:01:32
647000 -- (-1340.073) (-1333.041) (-1338.013) [-1331.543] * [-1342.998] (-1343.002) (-1335.238) (-1337.649) -- 0:01:32
647500 -- [-1341.736] (-1335.077) (-1346.495) (-1332.626) * (-1350.215) [-1336.664] (-1339.150) (-1344.890) -- 0:01:32
648000 -- [-1341.151] (-1340.691) (-1341.781) (-1347.574) * [-1353.614] (-1347.781) (-1349.198) (-1338.915) -- 0:01:32
648500 -- (-1332.774) [-1334.883] (-1357.176) (-1341.259) * (-1339.344) (-1338.390) (-1339.238) [-1341.074] -- 0:01:32
649000 -- (-1339.473) (-1351.137) [-1345.550] (-1339.478) * (-1342.504) (-1335.839) [-1331.341] (-1343.121) -- 0:01:32
649500 -- (-1340.398) (-1338.906) [-1336.521] (-1340.599) * (-1341.470) (-1349.599) [-1332.506] (-1343.091) -- 0:01:32
650000 -- (-1338.934) (-1338.545) [-1337.851] (-1344.054) * (-1343.181) (-1335.699) [-1336.529] (-1335.173) -- 0:01:32
Average standard deviation of split frequencies: 0.010948
650500 -- [-1334.577] (-1338.760) (-1343.885) (-1336.435) * (-1340.800) (-1346.754) [-1330.934] (-1334.376) -- 0:01:31
651000 -- (-1334.553) (-1329.938) (-1336.888) [-1336.446] * (-1350.822) (-1349.155) (-1340.349) [-1334.216] -- 0:01:31
651500 -- (-1342.606) (-1346.384) [-1338.917] (-1346.275) * [-1331.056] (-1343.938) (-1337.562) (-1337.918) -- 0:01:31
652000 -- [-1332.146] (-1337.869) (-1328.635) (-1342.148) * (-1335.913) (-1339.336) (-1339.955) [-1332.814] -- 0:01:31
652500 -- [-1324.760] (-1339.216) (-1334.626) (-1343.873) * (-1335.654) (-1340.766) (-1349.024) [-1334.616] -- 0:01:31
653000 -- [-1340.141] (-1349.269) (-1336.486) (-1339.937) * (-1336.387) (-1342.705) (-1341.582) [-1335.087] -- 0:01:31
653500 -- (-1342.955) (-1329.167) (-1355.163) [-1337.910] * (-1347.408) [-1337.327] (-1342.665) (-1340.050) -- 0:01:31
654000 -- [-1340.965] (-1335.258) (-1342.362) (-1338.066) * (-1336.106) (-1346.640) [-1338.283] (-1354.361) -- 0:01:30
654500 -- (-1333.261) [-1336.293] (-1346.404) (-1338.986) * (-1338.339) (-1338.291) [-1336.438] (-1344.008) -- 0:01:30
655000 -- (-1355.125) [-1338.882] (-1347.288) (-1340.599) * (-1345.287) (-1337.562) [-1336.850] (-1344.407) -- 0:01:30
Average standard deviation of split frequencies: 0.010500
655500 -- [-1334.785] (-1356.374) (-1334.275) (-1336.344) * (-1339.638) [-1335.884] (-1335.061) (-1331.755) -- 0:01:30
656000 -- (-1335.407) (-1340.321) [-1333.967] (-1337.308) * (-1336.179) [-1333.981] (-1338.942) (-1343.536) -- 0:01:30
656500 -- (-1339.520) [-1336.734] (-1341.883) (-1338.738) * (-1331.175) [-1331.110] (-1346.527) (-1338.743) -- 0:01:30
657000 -- (-1337.515) (-1336.332) [-1335.249] (-1344.841) * (-1336.191) [-1333.362] (-1349.221) (-1349.819) -- 0:01:30
657500 -- (-1340.487) (-1345.907) (-1350.686) [-1337.374] * (-1335.793) (-1339.888) [-1343.258] (-1336.100) -- 0:01:30
658000 -- (-1342.369) [-1326.918] (-1335.432) (-1340.197) * (-1337.996) (-1345.466) [-1345.093] (-1344.451) -- 0:01:29
658500 -- [-1346.083] (-1350.859) (-1340.117) (-1341.957) * (-1335.451) [-1337.828] (-1344.440) (-1341.122) -- 0:01:29
659000 -- [-1337.212] (-1341.465) (-1340.067) (-1337.796) * [-1332.237] (-1336.023) (-1343.388) (-1331.325) -- 0:01:29
659500 -- (-1346.070) (-1352.341) (-1339.628) [-1340.678] * (-1341.475) [-1343.555] (-1337.741) (-1343.819) -- 0:01:29
660000 -- (-1335.015) (-1338.054) [-1332.247] (-1340.855) * (-1338.790) (-1346.928) [-1343.502] (-1343.933) -- 0:01:29
Average standard deviation of split frequencies: 0.010861
660500 -- (-1332.553) (-1333.625) [-1330.338] (-1348.989) * (-1350.171) (-1342.633) (-1338.555) [-1335.515] -- 0:01:29
661000 -- (-1337.110) [-1338.733] (-1338.689) (-1340.756) * (-1342.804) (-1336.455) [-1344.165] (-1326.937) -- 0:01:29
661500 -- (-1332.422) (-1339.971) (-1339.764) [-1335.551] * (-1341.734) (-1344.122) [-1337.229] (-1329.875) -- 0:01:29
662000 -- [-1338.082] (-1332.110) (-1332.416) (-1334.223) * [-1334.649] (-1337.973) (-1348.663) (-1340.343) -- 0:01:28
662500 -- (-1345.131) (-1333.964) [-1333.362] (-1336.324) * (-1343.164) (-1336.221) [-1337.521] (-1338.327) -- 0:01:28
663000 -- (-1342.375) [-1332.076] (-1339.286) (-1332.858) * (-1342.133) [-1344.468] (-1332.506) (-1332.392) -- 0:01:28
663500 -- (-1346.524) (-1340.058) [-1334.082] (-1329.168) * (-1337.996) (-1349.084) (-1339.248) [-1335.337] -- 0:01:28
664000 -- (-1352.724) (-1347.030) (-1340.357) [-1329.275] * (-1357.762) (-1358.221) [-1343.901] (-1333.456) -- 0:01:28
664500 -- (-1342.045) (-1343.679) [-1336.743] (-1333.648) * (-1340.107) [-1341.924] (-1336.488) (-1345.775) -- 0:01:28
665000 -- (-1338.233) (-1342.504) (-1353.780) [-1341.518] * (-1335.805) (-1339.724) (-1342.803) [-1332.833] -- 0:01:28
Average standard deviation of split frequencies: 0.010539
665500 -- (-1340.925) (-1355.886) (-1341.306) [-1339.927] * [-1328.657] (-1338.939) (-1340.762) (-1336.098) -- 0:01:27
666000 -- (-1331.303) (-1344.530) (-1339.372) [-1339.910] * (-1341.601) (-1343.096) (-1348.242) [-1330.340] -- 0:01:27
666500 -- (-1341.553) (-1346.097) [-1334.870] (-1332.252) * (-1337.340) (-1339.557) (-1335.162) [-1340.650] -- 0:01:27
667000 -- (-1344.590) [-1329.104] (-1343.255) (-1334.061) * (-1345.512) (-1334.370) (-1338.184) [-1329.299] -- 0:01:27
667500 -- (-1341.056) (-1341.127) (-1347.556) [-1339.755] * (-1326.834) [-1330.841] (-1338.020) (-1341.728) -- 0:01:27
668000 -- (-1341.650) (-1340.274) (-1337.747) [-1335.428] * [-1333.731] (-1330.877) (-1347.553) (-1337.174) -- 0:01:27
668500 -- (-1357.474) [-1339.816] (-1340.537) (-1332.975) * (-1338.326) (-1338.243) (-1338.727) [-1329.082] -- 0:01:27
669000 -- [-1342.722] (-1342.995) (-1341.744) (-1334.943) * (-1336.448) (-1334.875) [-1334.791] (-1339.380) -- 0:01:27
669500 -- (-1347.323) [-1340.135] (-1331.789) (-1328.246) * (-1337.860) [-1333.241] (-1343.319) (-1349.192) -- 0:01:26
670000 -- [-1332.239] (-1329.648) (-1334.963) (-1336.785) * (-1336.756) [-1324.991] (-1336.633) (-1350.747) -- 0:01:26
Average standard deviation of split frequencies: 0.010778
670500 -- [-1343.421] (-1352.818) (-1335.377) (-1341.314) * [-1338.000] (-1341.714) (-1351.620) (-1336.635) -- 0:01:26
671000 -- (-1350.335) (-1331.020) (-1342.994) [-1337.207] * [-1340.545] (-1336.968) (-1338.760) (-1335.227) -- 0:01:26
671500 -- (-1336.206) (-1342.868) (-1327.585) [-1333.961] * [-1344.596] (-1334.153) (-1352.448) (-1339.027) -- 0:01:26
672000 -- [-1340.437] (-1343.526) (-1337.849) (-1331.013) * (-1334.026) (-1346.297) (-1342.738) [-1344.665] -- 0:01:26
672500 -- (-1340.742) (-1334.541) [-1337.324] (-1339.780) * (-1351.615) (-1343.323) [-1332.601] (-1347.105) -- 0:01:26
673000 -- (-1339.680) [-1334.623] (-1332.965) (-1351.525) * (-1352.785) [-1342.696] (-1343.010) (-1350.914) -- 0:01:26
673500 -- (-1345.047) (-1338.603) [-1335.357] (-1343.083) * (-1341.366) [-1331.784] (-1340.348) (-1342.199) -- 0:01:25
674000 -- (-1340.840) (-1340.668) [-1333.909] (-1337.855) * [-1338.007] (-1344.626) (-1344.734) (-1338.025) -- 0:01:25
674500 -- (-1345.360) (-1352.067) (-1342.537) [-1335.720] * (-1338.468) (-1342.093) (-1342.238) [-1337.001] -- 0:01:25
675000 -- (-1333.635) (-1333.617) [-1339.150] (-1344.993) * (-1334.304) (-1340.187) [-1343.460] (-1334.697) -- 0:01:25
Average standard deviation of split frequencies: 0.010421
675500 -- (-1361.998) [-1332.104] (-1340.895) (-1343.689) * [-1333.032] (-1343.822) (-1337.271) (-1333.640) -- 0:01:25
676000 -- (-1353.493) [-1329.177] (-1332.619) (-1335.325) * (-1332.847) (-1336.182) [-1328.381] (-1339.744) -- 0:01:25
676500 -- (-1342.312) (-1341.495) (-1334.477) [-1336.721] * (-1355.340) (-1343.219) (-1343.909) [-1335.691] -- 0:01:25
677000 -- (-1336.351) [-1334.590] (-1342.038) (-1333.617) * (-1341.072) (-1342.617) [-1335.574] (-1348.232) -- 0:01:24
677500 -- [-1335.707] (-1334.395) (-1339.859) (-1347.665) * (-1347.526) [-1330.312] (-1342.967) (-1335.245) -- 0:01:24
678000 -- [-1341.016] (-1340.019) (-1340.977) (-1336.941) * (-1347.830) (-1328.159) (-1343.367) [-1331.189] -- 0:01:24
678500 -- (-1335.621) [-1333.082] (-1339.371) (-1346.087) * [-1335.834] (-1347.087) (-1341.416) (-1334.401) -- 0:01:24
679000 -- [-1334.114] (-1348.588) (-1339.559) (-1343.908) * (-1337.719) (-1333.166) (-1337.025) [-1336.054] -- 0:01:24
679500 -- (-1343.513) [-1335.977] (-1342.869) (-1342.213) * (-1338.635) [-1342.050] (-1341.058) (-1334.892) -- 0:01:24
680000 -- [-1339.544] (-1336.490) (-1340.714) (-1336.298) * [-1333.580] (-1339.805) (-1342.035) (-1333.163) -- 0:01:24
Average standard deviation of split frequencies: 0.010350
680500 -- (-1355.475) (-1337.074) (-1339.275) [-1338.566] * (-1348.120) [-1336.868] (-1342.915) (-1340.779) -- 0:01:24
681000 -- (-1337.427) (-1342.957) (-1340.254) [-1334.697] * (-1339.228) [-1336.578] (-1339.770) (-1339.469) -- 0:01:23
681500 -- (-1340.825) [-1343.069] (-1346.977) (-1334.454) * (-1335.004) [-1336.283] (-1345.678) (-1347.507) -- 0:01:23
682000 -- (-1343.383) (-1345.216) [-1329.967] (-1340.031) * (-1344.346) (-1343.271) (-1354.045) [-1339.783] -- 0:01:23
682500 -- (-1339.865) (-1343.494) [-1331.434] (-1341.923) * (-1349.664) [-1337.698] (-1342.775) (-1340.919) -- 0:01:23
683000 -- (-1345.275) (-1335.272) [-1341.126] (-1340.272) * (-1344.760) (-1331.543) (-1341.624) [-1346.635] -- 0:01:23
683500 -- (-1341.829) (-1343.445) [-1335.326] (-1345.577) * (-1335.321) [-1330.454] (-1338.134) (-1339.397) -- 0:01:23
684000 -- [-1338.076] (-1335.409) (-1336.188) (-1335.525) * [-1338.955] (-1339.542) (-1341.878) (-1347.376) -- 0:01:23
684500 -- (-1342.671) (-1341.472) (-1332.853) [-1334.633] * [-1343.049] (-1351.423) (-1332.318) (-1335.217) -- 0:01:22
685000 -- (-1346.475) (-1332.737) (-1338.615) [-1330.542] * (-1354.795) [-1340.937] (-1333.703) (-1335.903) -- 0:01:22
Average standard deviation of split frequencies: 0.010613
685500 -- [-1338.268] (-1337.690) (-1329.568) (-1342.523) * (-1349.986) (-1337.034) (-1346.867) [-1331.399] -- 0:01:22
686000 -- (-1347.382) (-1342.108) [-1330.964] (-1340.483) * (-1340.135) (-1335.448) [-1336.724] (-1340.285) -- 0:01:22
686500 -- (-1350.485) (-1333.402) [-1334.492] (-1337.942) * (-1336.973) (-1342.364) (-1335.766) [-1329.302] -- 0:01:22
687000 -- (-1345.156) (-1336.996) [-1338.529] (-1337.622) * [-1336.511] (-1339.679) (-1340.385) (-1333.987) -- 0:01:22
687500 -- (-1352.548) [-1346.835] (-1335.265) (-1347.010) * (-1341.212) (-1343.681) [-1344.833] (-1335.271) -- 0:01:22
688000 -- [-1334.810] (-1338.165) (-1340.268) (-1349.335) * (-1340.837) (-1338.477) (-1332.411) [-1334.947] -- 0:01:22
688500 -- (-1335.519) (-1335.456) [-1344.041] (-1356.337) * (-1341.559) [-1334.558] (-1337.274) (-1336.413) -- 0:01:21
689000 -- (-1331.807) (-1338.269) [-1339.682] (-1346.596) * (-1346.040) (-1336.822) (-1345.780) [-1337.760] -- 0:01:21
689500 -- (-1336.319) (-1349.309) [-1337.936] (-1344.928) * (-1345.986) [-1337.137] (-1340.565) (-1327.701) -- 0:01:21
690000 -- (-1336.645) [-1338.681] (-1332.622) (-1362.882) * (-1344.408) (-1343.652) [-1346.282] (-1341.057) -- 0:01:21
Average standard deviation of split frequencies: 0.011072
690500 -- (-1332.482) [-1335.213] (-1333.441) (-1353.582) * [-1345.947] (-1345.217) (-1333.540) (-1333.872) -- 0:01:21
691000 -- [-1333.954] (-1340.520) (-1335.961) (-1337.542) * (-1343.387) (-1336.450) [-1330.198] (-1340.377) -- 0:01:21
691500 -- [-1339.512] (-1340.677) (-1340.490) (-1336.598) * [-1337.325] (-1337.819) (-1338.854) (-1347.216) -- 0:01:21
692000 -- [-1340.039] (-1338.456) (-1341.287) (-1333.499) * (-1346.990) (-1339.712) (-1337.885) [-1334.778] -- 0:01:21
692500 -- (-1332.435) (-1341.828) [-1332.605] (-1355.895) * (-1342.644) [-1340.993] (-1337.261) (-1337.348) -- 0:01:20
693000 -- (-1341.184) [-1341.885] (-1338.278) (-1336.832) * (-1345.474) [-1334.372] (-1339.795) (-1330.501) -- 0:01:20
693500 -- (-1334.231) [-1331.218] (-1347.570) (-1337.178) * (-1340.713) [-1331.068] (-1337.580) (-1339.858) -- 0:01:20
694000 -- (-1344.908) [-1334.808] (-1345.256) (-1336.765) * [-1344.617] (-1341.342) (-1346.590) (-1334.360) -- 0:01:20
694500 -- (-1341.562) [-1335.704] (-1345.176) (-1345.723) * (-1340.931) [-1336.213] (-1337.692) (-1333.863) -- 0:01:20
695000 -- [-1347.505] (-1344.034) (-1332.652) (-1341.094) * (-1341.569) (-1334.995) [-1335.935] (-1337.682) -- 0:01:20
Average standard deviation of split frequencies: 0.010611
695500 -- [-1338.816] (-1336.427) (-1343.325) (-1353.212) * (-1340.326) (-1334.161) (-1339.811) [-1342.564] -- 0:01:20
696000 -- (-1338.953) [-1338.556] (-1330.943) (-1343.362) * [-1331.623] (-1330.747) (-1332.713) (-1339.303) -- 0:01:19
696500 -- (-1340.981) (-1344.626) [-1335.812] (-1333.094) * [-1334.690] (-1336.791) (-1341.145) (-1349.921) -- 0:01:19
697000 -- [-1342.333] (-1340.142) (-1334.533) (-1333.088) * [-1338.007] (-1343.158) (-1350.749) (-1332.819) -- 0:01:19
697500 -- (-1334.051) [-1336.715] (-1330.315) (-1335.312) * (-1342.790) (-1343.109) (-1342.635) [-1332.422] -- 0:01:19
698000 -- (-1346.669) (-1339.895) (-1345.436) [-1339.999] * [-1337.955] (-1342.906) (-1341.669) (-1354.083) -- 0:01:19
698500 -- (-1341.099) (-1340.325) (-1335.557) [-1332.303] * [-1335.234] (-1347.591) (-1353.963) (-1345.279) -- 0:01:19
699000 -- (-1331.066) (-1334.611) (-1341.359) [-1330.543] * (-1343.529) [-1329.628] (-1341.374) (-1344.908) -- 0:01:19
699500 -- (-1341.463) (-1349.101) [-1334.593] (-1336.380) * [-1331.871] (-1343.701) (-1338.451) (-1344.929) -- 0:01:19
700000 -- (-1346.346) [-1338.432] (-1338.462) (-1338.843) * (-1334.218) [-1335.792] (-1333.802) (-1345.764) -- 0:01:18
Average standard deviation of split frequencies: 0.010316
700500 -- [-1329.352] (-1339.714) (-1333.733) (-1339.652) * (-1334.395) (-1351.717) (-1345.354) [-1335.661] -- 0:01:18
701000 -- (-1341.732) [-1337.519] (-1340.384) (-1337.272) * (-1343.358) (-1354.966) (-1346.160) [-1338.388] -- 0:01:18
701500 -- (-1340.406) (-1348.332) (-1335.070) [-1333.995] * (-1343.452) [-1342.284] (-1339.726) (-1338.619) -- 0:01:18
702000 -- (-1339.858) (-1342.368) (-1339.112) [-1327.022] * (-1334.849) [-1341.708] (-1334.507) (-1342.652) -- 0:01:18
702500 -- (-1345.418) [-1342.988] (-1334.594) (-1348.957) * (-1347.561) (-1337.075) (-1340.072) [-1339.655] -- 0:01:18
703000 -- (-1343.310) (-1347.764) [-1334.878] (-1344.896) * (-1337.028) (-1336.550) [-1333.308] (-1338.945) -- 0:01:18
703500 -- (-1342.718) (-1340.266) [-1337.056] (-1342.919) * [-1332.864] (-1337.755) (-1343.608) (-1348.876) -- 0:01:17
704000 -- (-1336.876) (-1338.201) [-1333.886] (-1342.762) * (-1336.165) [-1330.738] (-1351.192) (-1337.397) -- 0:01:17
704500 -- (-1334.380) [-1336.930] (-1331.864) (-1353.798) * [-1336.975] (-1331.400) (-1341.967) (-1347.070) -- 0:01:17
705000 -- (-1338.176) (-1336.233) [-1340.542] (-1360.749) * [-1336.800] (-1338.289) (-1341.283) (-1342.090) -- 0:01:17
Average standard deviation of split frequencies: 0.010461
705500 -- (-1341.312) [-1337.652] (-1332.022) (-1336.701) * [-1340.272] (-1341.122) (-1333.017) (-1333.191) -- 0:01:17
706000 -- (-1344.415) (-1337.507) [-1335.817] (-1346.032) * (-1338.407) [-1339.495] (-1340.409) (-1333.323) -- 0:01:17
706500 -- (-1337.324) (-1334.885) (-1334.178) [-1343.487] * (-1335.176) (-1345.216) (-1350.051) [-1339.042] -- 0:01:17
707000 -- (-1340.775) (-1343.101) (-1345.950) [-1331.666] * (-1343.057) [-1335.356] (-1334.961) (-1337.046) -- 0:01:17
707500 -- [-1343.948] (-1344.525) (-1348.904) (-1330.939) * (-1336.861) [-1328.836] (-1335.670) (-1333.559) -- 0:01:16
708000 -- (-1350.850) (-1341.465) (-1344.014) [-1338.017] * (-1340.180) (-1337.578) (-1341.210) [-1333.743] -- 0:01:16
708500 -- (-1350.290) (-1345.879) [-1336.359] (-1341.193) * (-1341.250) [-1333.503] (-1338.077) (-1342.684) -- 0:01:16
709000 -- (-1334.115) (-1351.183) (-1337.213) [-1334.144] * [-1333.085] (-1335.024) (-1339.015) (-1336.798) -- 0:01:16
709500 -- [-1327.335] (-1348.482) (-1336.571) (-1337.154) * (-1349.834) [-1328.868] (-1340.279) (-1336.518) -- 0:01:16
710000 -- (-1337.471) (-1344.439) [-1337.044] (-1337.963) * [-1343.247] (-1347.532) (-1339.414) (-1342.539) -- 0:01:16
Average standard deviation of split frequencies: 0.010797
710500 -- [-1334.617] (-1342.423) (-1345.076) (-1337.411) * (-1336.828) (-1345.474) (-1353.156) [-1331.247] -- 0:01:16
711000 -- (-1337.254) (-1333.940) [-1338.125] (-1338.863) * (-1344.092) (-1328.901) [-1336.214] (-1346.727) -- 0:01:16
711500 -- [-1337.207] (-1345.199) (-1337.727) (-1341.039) * (-1351.378) (-1330.705) (-1335.850) [-1335.579] -- 0:01:15
712000 -- [-1339.354] (-1345.703) (-1342.150) (-1349.663) * (-1355.245) [-1334.706] (-1335.094) (-1345.959) -- 0:01:15
712500 -- [-1338.452] (-1335.559) (-1335.914) (-1338.222) * (-1347.381) (-1338.872) (-1332.979) [-1338.525] -- 0:01:15
713000 -- (-1334.419) [-1336.913] (-1336.673) (-1337.864) * (-1340.104) (-1345.734) (-1344.487) [-1342.261] -- 0:01:15
713500 -- (-1339.892) (-1344.122) [-1337.092] (-1343.267) * (-1346.322) (-1335.918) (-1346.821) [-1333.210] -- 0:01:15
714000 -- (-1338.802) (-1335.433) [-1343.674] (-1349.899) * (-1337.306) (-1358.943) (-1344.892) [-1332.496] -- 0:01:15
714500 -- (-1340.069) (-1334.466) (-1332.581) [-1336.294] * [-1333.852] (-1338.439) (-1332.739) (-1336.388) -- 0:01:15
715000 -- (-1346.873) (-1337.272) [-1336.422] (-1340.961) * [-1347.682] (-1340.847) (-1347.362) (-1334.450) -- 0:01:14
Average standard deviation of split frequencies: 0.011339
715500 -- (-1343.249) (-1335.807) [-1342.564] (-1338.287) * (-1342.593) (-1345.221) [-1343.035] (-1337.631) -- 0:01:15
716000 -- (-1338.781) (-1352.030) (-1333.553) [-1339.196] * [-1341.218] (-1348.707) (-1338.995) (-1346.892) -- 0:01:14
716500 -- [-1332.232] (-1336.128) (-1336.989) (-1336.434) * [-1333.168] (-1340.682) (-1337.139) (-1331.774) -- 0:01:14
717000 -- (-1333.861) [-1341.715] (-1341.504) (-1340.519) * (-1345.102) (-1357.653) (-1342.791) [-1337.251] -- 0:01:14
717500 -- (-1334.656) [-1331.896] (-1338.303) (-1342.099) * (-1342.431) (-1344.408) [-1331.552] (-1337.272) -- 0:01:14
718000 -- [-1337.902] (-1345.673) (-1336.391) (-1349.002) * (-1336.785) (-1348.513) (-1340.582) [-1343.142] -- 0:01:14
718500 -- [-1335.826] (-1344.060) (-1344.053) (-1351.907) * [-1330.329] (-1342.621) (-1330.172) (-1332.013) -- 0:01:14
719000 -- [-1329.245] (-1339.445) (-1337.234) (-1335.252) * [-1337.664] (-1333.673) (-1342.368) (-1336.947) -- 0:01:13
719500 -- (-1344.903) (-1343.562) [-1335.931] (-1337.300) * (-1340.216) (-1348.906) [-1335.465] (-1353.331) -- 0:01:14
720000 -- (-1349.582) [-1331.335] (-1343.070) (-1339.163) * [-1336.407] (-1351.828) (-1342.770) (-1345.106) -- 0:01:13
Average standard deviation of split frequencies: 0.011520
720500 -- (-1351.812) (-1338.882) [-1337.030] (-1336.585) * (-1348.255) (-1344.490) [-1337.944] (-1351.275) -- 0:01:13
721000 -- (-1341.929) (-1336.747) (-1347.017) [-1333.006] * (-1336.251) (-1340.300) [-1339.891] (-1339.406) -- 0:01:13
721500 -- [-1341.410] (-1350.104) (-1347.617) (-1332.138) * (-1348.203) [-1331.943] (-1340.914) (-1332.941) -- 0:01:13
722000 -- (-1343.694) (-1337.886) [-1336.634] (-1338.445) * (-1333.435) [-1332.056] (-1360.031) (-1333.443) -- 0:01:13
722500 -- (-1338.979) [-1341.921] (-1339.670) (-1338.666) * (-1343.736) (-1334.171) [-1330.614] (-1338.291) -- 0:01:13
723000 -- (-1343.926) [-1332.182] (-1341.617) (-1339.093) * (-1356.100) (-1341.404) [-1328.965] (-1339.459) -- 0:01:13
723500 -- (-1344.657) [-1331.790] (-1342.203) (-1346.549) * (-1346.169) (-1339.072) (-1339.345) [-1333.238] -- 0:01:12
724000 -- (-1335.824) [-1333.830] (-1339.160) (-1341.435) * (-1340.021) [-1330.802] (-1341.595) (-1331.187) -- 0:01:12
724500 -- [-1328.747] (-1335.450) (-1344.369) (-1348.931) * (-1337.016) [-1339.350] (-1349.176) (-1349.080) -- 0:01:12
725000 -- [-1335.452] (-1339.918) (-1339.657) (-1350.396) * (-1340.469) [-1335.313] (-1342.590) (-1336.788) -- 0:01:12
Average standard deviation of split frequencies: 0.011976
725500 -- (-1339.905) [-1336.009] (-1345.902) (-1360.705) * (-1341.656) (-1338.434) (-1337.417) [-1338.717] -- 0:01:12
726000 -- (-1334.419) (-1335.630) [-1337.739] (-1331.219) * (-1345.361) (-1352.866) [-1339.480] (-1335.768) -- 0:01:12
726500 -- (-1343.834) [-1336.773] (-1341.065) (-1344.427) * [-1337.207] (-1346.565) (-1334.429) (-1345.077) -- 0:01:12
727000 -- [-1339.249] (-1347.566) (-1339.061) (-1342.316) * (-1343.177) (-1336.642) [-1336.841] (-1344.832) -- 0:01:12
727500 -- (-1339.179) (-1343.888) (-1345.077) [-1330.344] * [-1337.721] (-1340.805) (-1341.282) (-1342.535) -- 0:01:11
728000 -- (-1348.618) (-1346.127) [-1334.867] (-1347.617) * (-1337.915) (-1342.710) (-1335.146) [-1330.564] -- 0:01:11
728500 -- (-1335.644) (-1340.969) [-1336.486] (-1331.795) * (-1339.915) [-1341.023] (-1348.107) (-1335.620) -- 0:01:11
729000 -- (-1336.039) (-1338.515) [-1332.777] (-1339.048) * (-1334.513) (-1339.499) [-1335.805] (-1341.937) -- 0:01:11
729500 -- [-1338.519] (-1339.933) (-1335.772) (-1340.488) * [-1338.306] (-1332.748) (-1334.179) (-1339.637) -- 0:01:11
730000 -- [-1335.277] (-1344.014) (-1344.721) (-1367.146) * (-1357.432) (-1343.558) [-1331.706] (-1336.093) -- 0:01:11
Average standard deviation of split frequencies: 0.012079
730500 -- (-1353.463) [-1334.186] (-1336.862) (-1337.758) * (-1345.711) (-1334.327) (-1344.587) [-1332.474] -- 0:01:11
731000 -- (-1342.873) [-1334.664] (-1338.575) (-1343.421) * (-1340.983) (-1338.373) (-1339.426) [-1332.323] -- 0:01:11
731500 -- (-1342.461) (-1339.888) [-1329.643] (-1335.909) * (-1335.059) [-1337.931] (-1341.818) (-1338.249) -- 0:01:10
732000 -- (-1351.983) (-1338.616) (-1348.521) [-1334.790] * (-1336.299) [-1335.436] (-1338.792) (-1335.034) -- 0:01:10
732500 -- (-1329.668) (-1344.434) [-1336.791] (-1340.370) * [-1335.670] (-1341.696) (-1335.965) (-1328.432) -- 0:01:10
733000 -- [-1337.080] (-1341.146) (-1345.744) (-1342.280) * [-1331.473] (-1335.070) (-1337.795) (-1334.736) -- 0:01:10
733500 -- (-1342.448) [-1341.324] (-1338.394) (-1338.111) * [-1338.432] (-1342.271) (-1341.398) (-1335.380) -- 0:01:10
734000 -- (-1334.863) (-1339.473) (-1340.812) [-1330.206] * (-1339.640) [-1340.273] (-1342.356) (-1353.201) -- 0:01:10
734500 -- (-1338.210) (-1350.062) (-1341.938) [-1340.867] * (-1345.548) [-1334.903] (-1343.310) (-1335.076) -- 0:01:10
735000 -- (-1331.405) (-1338.758) (-1337.927) [-1333.226] * (-1330.105) (-1327.386) [-1336.327] (-1336.657) -- 0:01:09
Average standard deviation of split frequencies: 0.011920
735500 -- (-1340.994) (-1345.271) (-1338.367) [-1331.003] * [-1341.129] (-1338.712) (-1339.989) (-1329.935) -- 0:01:09
736000 -- [-1335.242] (-1337.684) (-1335.151) (-1336.575) * (-1348.562) [-1329.196] (-1333.607) (-1349.048) -- 0:01:09
736500 -- [-1334.152] (-1348.809) (-1336.096) (-1342.535) * [-1336.718] (-1351.708) (-1336.320) (-1347.101) -- 0:01:09
737000 -- (-1348.901) (-1341.140) [-1327.618] (-1340.545) * (-1345.061) [-1342.214] (-1338.021) (-1339.450) -- 0:01:09
737500 -- [-1335.583] (-1336.722) (-1337.095) (-1338.393) * [-1333.375] (-1339.044) (-1343.675) (-1339.748) -- 0:01:09
738000 -- (-1345.295) [-1333.099] (-1335.136) (-1347.765) * (-1353.660) (-1338.760) [-1331.761] (-1343.744) -- 0:01:09
738500 -- (-1329.776) [-1336.518] (-1335.487) (-1339.982) * (-1349.113) (-1343.978) (-1331.940) [-1335.893] -- 0:01:09
739000 -- [-1338.796] (-1342.923) (-1330.352) (-1346.072) * [-1337.614] (-1341.164) (-1346.718) (-1340.225) -- 0:01:08
739500 -- (-1334.562) [-1336.386] (-1351.406) (-1335.406) * [-1337.320] (-1352.631) (-1338.779) (-1351.977) -- 0:01:08
740000 -- [-1345.739] (-1337.239) (-1339.050) (-1339.767) * [-1331.634] (-1344.341) (-1339.264) (-1352.468) -- 0:01:08
Average standard deviation of split frequencies: 0.012022
740500 -- (-1346.160) (-1331.889) [-1335.057] (-1334.290) * (-1330.529) (-1343.925) [-1334.439] (-1349.079) -- 0:01:08
741000 -- (-1349.519) (-1337.706) (-1348.243) [-1333.343] * [-1333.482] (-1340.254) (-1345.926) (-1334.755) -- 0:01:08
741500 -- (-1337.634) (-1344.287) (-1345.161) [-1334.296] * [-1337.972] (-1332.992) (-1346.636) (-1339.777) -- 0:01:08
742000 -- (-1342.192) [-1334.338] (-1333.373) (-1338.820) * (-1344.197) (-1347.491) (-1354.544) [-1336.105] -- 0:01:08
742500 -- (-1336.903) (-1333.899) (-1340.084) [-1331.711] * (-1341.848) (-1349.675) [-1337.812] (-1333.734) -- 0:01:07
743000 -- (-1342.242) [-1342.114] (-1347.255) (-1342.467) * [-1336.304] (-1345.801) (-1347.074) (-1341.409) -- 0:01:07
743500 -- [-1334.057] (-1344.382) (-1344.057) (-1343.072) * (-1336.969) (-1334.761) (-1342.528) [-1336.627] -- 0:01:07
744000 -- [-1340.068] (-1341.114) (-1343.536) (-1347.005) * (-1336.630) (-1352.261) [-1345.144] (-1342.034) -- 0:01:07
744500 -- (-1339.432) [-1335.361] (-1333.277) (-1334.670) * (-1343.798) [-1338.541] (-1334.923) (-1341.906) -- 0:01:07
745000 -- (-1339.608) (-1344.651) (-1339.562) [-1337.164] * [-1335.972] (-1337.026) (-1349.864) (-1343.074) -- 0:01:07
Average standard deviation of split frequencies: 0.012147
745500 -- (-1339.862) (-1338.462) (-1343.870) [-1337.869] * (-1342.979) (-1343.538) (-1331.499) [-1336.980] -- 0:01:07
746000 -- (-1340.457) (-1338.760) (-1337.219) [-1333.146] * [-1332.383] (-1338.563) (-1347.444) (-1345.469) -- 0:01:07
746500 -- (-1342.464) [-1344.043] (-1341.273) (-1345.786) * (-1339.650) (-1340.956) [-1336.937] (-1343.546) -- 0:01:06
747000 -- (-1330.388) (-1344.926) [-1333.796] (-1331.789) * (-1333.670) [-1347.890] (-1338.950) (-1336.886) -- 0:01:06
747500 -- [-1330.740] (-1343.564) (-1350.928) (-1335.915) * [-1331.269] (-1341.501) (-1331.562) (-1338.090) -- 0:01:06
748000 -- [-1339.076] (-1337.681) (-1335.977) (-1332.552) * [-1328.971] (-1335.810) (-1337.089) (-1335.780) -- 0:01:06
748500 -- (-1342.144) (-1345.887) (-1336.272) [-1339.213] * (-1332.125) (-1351.694) [-1325.091] (-1332.122) -- 0:01:06
749000 -- (-1345.661) (-1342.106) (-1336.513) [-1339.072] * (-1341.298) (-1339.729) [-1332.909] (-1345.971) -- 0:01:06
749500 -- (-1357.478) (-1337.940) [-1333.260] (-1334.104) * (-1333.704) [-1334.011] (-1348.904) (-1331.789) -- 0:01:06
750000 -- (-1340.433) (-1339.592) (-1343.587) [-1334.398] * (-1346.083) (-1334.413) (-1348.719) [-1333.543] -- 0:01:06
Average standard deviation of split frequencies: 0.011862
750500 -- [-1332.760] (-1334.423) (-1342.763) (-1341.552) * (-1347.416) (-1342.259) (-1336.342) [-1334.357] -- 0:01:05
751000 -- [-1333.406] (-1349.760) (-1352.233) (-1335.535) * [-1329.096] (-1342.132) (-1335.478) (-1343.436) -- 0:01:05
751500 -- (-1341.463) (-1335.279) (-1344.249) [-1340.195] * (-1336.680) (-1353.416) (-1337.206) [-1339.854] -- 0:01:05
752000 -- (-1341.581) [-1335.490] (-1336.743) (-1336.177) * [-1334.871] (-1341.682) (-1333.986) (-1335.256) -- 0:01:05
752500 -- [-1340.379] (-1332.342) (-1336.618) (-1338.354) * (-1338.900) (-1351.136) (-1330.787) [-1336.583] -- 0:01:05
753000 -- [-1340.609] (-1328.270) (-1336.130) (-1345.948) * (-1338.172) (-1344.028) (-1339.152) [-1338.171] -- 0:01:05
753500 -- (-1346.288) [-1341.659] (-1343.783) (-1338.290) * (-1354.599) (-1341.622) (-1333.255) [-1335.402] -- 0:01:05
754000 -- (-1343.836) [-1336.951] (-1341.080) (-1341.499) * (-1338.972) (-1335.607) [-1330.684] (-1345.569) -- 0:01:04
754500 -- (-1348.461) (-1338.766) [-1338.504] (-1338.410) * (-1329.862) (-1338.251) [-1334.037] (-1346.976) -- 0:01:04
755000 -- [-1342.526] (-1337.804) (-1338.293) (-1333.304) * (-1337.761) (-1336.227) (-1340.366) [-1341.121] -- 0:01:04
Average standard deviation of split frequencies: 0.011640
755500 -- (-1335.813) [-1336.278] (-1340.880) (-1333.723) * (-1342.510) [-1340.285] (-1332.861) (-1341.159) -- 0:01:04
756000 -- (-1342.088) (-1337.276) (-1339.637) [-1337.553] * (-1342.363) (-1347.465) (-1340.939) [-1337.778] -- 0:01:04
756500 -- (-1338.278) (-1347.167) (-1341.998) [-1330.964] * (-1351.861) [-1344.632] (-1333.714) (-1337.368) -- 0:01:04
757000 -- (-1336.118) (-1339.844) (-1336.095) [-1331.988] * (-1340.706) (-1350.372) [-1328.286] (-1336.277) -- 0:01:04
757500 -- (-1337.934) (-1335.956) [-1342.018] (-1332.521) * (-1335.085) (-1344.009) (-1347.811) [-1339.609] -- 0:01:04
758000 -- (-1346.729) (-1347.747) (-1345.755) [-1332.925] * (-1343.462) [-1332.455] (-1341.653) (-1343.252) -- 0:01:03
758500 -- [-1342.430] (-1342.521) (-1338.176) (-1342.516) * (-1349.480) (-1336.509) [-1339.476] (-1344.310) -- 0:01:03
759000 -- (-1337.572) (-1341.962) (-1336.399) [-1347.551] * (-1348.682) (-1346.481) [-1330.795] (-1341.687) -- 0:01:03
759500 -- (-1337.219) (-1344.088) [-1325.916] (-1340.499) * (-1344.099) [-1338.091] (-1337.783) (-1341.792) -- 0:01:03
760000 -- (-1346.145) (-1347.609) [-1332.183] (-1337.612) * (-1339.578) [-1332.120] (-1338.682) (-1343.974) -- 0:01:03
Average standard deviation of split frequencies: 0.011603
760500 -- [-1334.608] (-1347.824) (-1334.640) (-1325.468) * (-1352.001) (-1333.826) (-1337.519) [-1339.891] -- 0:01:03
761000 -- [-1335.617] (-1340.843) (-1340.955) (-1352.191) * [-1340.368] (-1336.609) (-1338.586) (-1349.279) -- 0:01:03
761500 -- (-1339.277) [-1335.474] (-1336.341) (-1343.291) * [-1336.981] (-1331.575) (-1340.263) (-1342.888) -- 0:01:02
762000 -- (-1353.062) [-1328.616] (-1346.002) (-1330.580) * (-1338.618) [-1331.315] (-1339.772) (-1339.720) -- 0:01:02
762500 -- (-1337.856) [-1334.710] (-1338.913) (-1329.676) * (-1334.423) [-1337.885] (-1339.329) (-1332.266) -- 0:01:02
763000 -- [-1341.281] (-1336.502) (-1334.655) (-1343.312) * [-1339.673] (-1331.611) (-1346.542) (-1338.491) -- 0:01:02
763500 -- (-1348.428) [-1334.954] (-1336.674) (-1347.703) * (-1350.627) (-1335.188) (-1339.000) [-1344.172] -- 0:01:02
764000 -- (-1334.241) (-1335.244) [-1334.308] (-1345.059) * (-1347.031) (-1337.218) (-1331.283) [-1342.033] -- 0:01:02
764500 -- [-1330.783] (-1344.549) (-1329.974) (-1346.033) * (-1331.430) (-1341.495) [-1335.760] (-1343.711) -- 0:01:02
765000 -- (-1332.945) (-1346.493) (-1339.861) [-1338.131] * (-1332.858) [-1330.146] (-1341.541) (-1342.465) -- 0:01:02
Average standard deviation of split frequencies: 0.011590
765500 -- (-1350.076) (-1342.813) [-1337.932] (-1333.736) * [-1341.103] (-1334.676) (-1348.698) (-1340.939) -- 0:01:01
766000 -- (-1340.804) (-1344.382) (-1340.778) [-1328.549] * (-1345.203) [-1335.235] (-1340.284) (-1339.199) -- 0:01:01
766500 -- [-1331.114] (-1338.241) (-1343.927) (-1334.207) * [-1339.677] (-1343.986) (-1345.802) (-1341.497) -- 0:01:01
767000 -- (-1338.925) [-1335.637] (-1344.026) (-1340.127) * (-1340.217) (-1338.472) (-1342.750) [-1334.688] -- 0:01:01
767500 -- (-1347.044) [-1326.324] (-1338.478) (-1333.126) * (-1337.552) (-1338.402) [-1336.480] (-1334.347) -- 0:01:01
768000 -- (-1343.976) (-1342.619) (-1344.895) [-1338.952] * (-1327.590) [-1329.791] (-1338.650) (-1336.976) -- 0:01:01
768500 -- (-1340.572) [-1332.697] (-1337.207) (-1336.381) * [-1332.466] (-1332.434) (-1338.685) (-1335.067) -- 0:01:01
769000 -- (-1338.561) (-1337.901) [-1333.437] (-1347.838) * (-1337.111) (-1339.304) (-1348.791) [-1337.649] -- 0:01:00
769500 -- (-1335.422) [-1340.306] (-1339.205) (-1340.687) * [-1338.489] (-1336.970) (-1340.737) (-1340.711) -- 0:01:00
770000 -- (-1344.650) (-1334.883) [-1331.857] (-1334.290) * [-1333.971] (-1336.734) (-1343.748) (-1342.391) -- 0:01:00
Average standard deviation of split frequencies: 0.010976
770500 -- (-1343.475) [-1346.850] (-1344.046) (-1335.310) * (-1337.378) (-1344.093) (-1338.914) [-1333.754] -- 0:01:00
771000 -- [-1338.345] (-1337.227) (-1342.428) (-1337.260) * (-1359.990) (-1339.663) (-1342.570) [-1338.411] -- 0:01:00
771500 -- [-1330.431] (-1348.340) (-1334.739) (-1341.028) * (-1333.866) (-1342.467) [-1334.025] (-1340.512) -- 0:01:00
772000 -- (-1347.569) (-1353.237) [-1329.391] (-1341.420) * [-1335.260] (-1340.266) (-1336.197) (-1338.693) -- 0:01:00
772500 -- (-1338.773) (-1344.097) [-1332.462] (-1347.276) * (-1336.701) [-1340.315] (-1335.019) (-1344.549) -- 0:01:00
773000 -- (-1348.566) (-1334.995) (-1338.505) [-1332.831] * (-1341.142) (-1348.113) (-1345.725) [-1331.977] -- 0:00:59
773500 -- (-1350.687) (-1342.319) (-1353.493) [-1343.293] * (-1338.947) (-1344.378) [-1337.838] (-1337.344) -- 0:00:59
774000 -- (-1341.657) [-1336.713] (-1346.706) (-1334.752) * (-1333.027) (-1343.759) (-1339.713) [-1333.292] -- 0:00:59
774500 -- [-1344.421] (-1342.471) (-1354.590) (-1345.557) * (-1329.552) (-1349.457) (-1343.102) [-1333.223] -- 0:00:59
775000 -- [-1340.266] (-1332.397) (-1350.986) (-1337.491) * (-1337.928) (-1345.588) [-1335.292] (-1332.273) -- 0:00:59
Average standard deviation of split frequencies: 0.011171
775500 -- [-1335.729] (-1351.461) (-1340.017) (-1337.123) * (-1349.575) (-1334.101) [-1338.469] (-1344.270) -- 0:00:59
776000 -- (-1349.425) (-1332.140) (-1357.864) [-1332.789] * [-1340.775] (-1345.292) (-1335.108) (-1351.556) -- 0:00:59
776500 -- [-1338.393] (-1337.217) (-1344.577) (-1336.114) * (-1345.989) (-1344.598) (-1347.751) [-1335.348] -- 0:00:59
777000 -- (-1341.109) (-1335.825) (-1342.423) [-1335.149] * (-1335.953) (-1342.884) [-1330.878] (-1342.465) -- 0:00:58
777500 -- (-1344.041) [-1334.248] (-1344.227) (-1337.929) * (-1336.468) [-1331.934] (-1335.087) (-1339.689) -- 0:00:58
778000 -- (-1337.214) (-1337.080) (-1340.660) [-1338.549] * (-1340.465) (-1338.090) (-1338.734) [-1340.144] -- 0:00:58
778500 -- (-1344.775) (-1338.754) (-1333.215) [-1329.591] * (-1345.421) (-1337.769) (-1337.494) [-1338.264] -- 0:00:58
779000 -- (-1341.892) [-1338.020] (-1343.125) (-1332.193) * (-1339.468) [-1337.554] (-1335.374) (-1349.944) -- 0:00:58
779500 -- (-1345.383) (-1332.934) [-1338.825] (-1350.234) * [-1337.247] (-1332.860) (-1337.261) (-1344.239) -- 0:00:58
780000 -- (-1337.573) (-1345.751) [-1338.276] (-1338.899) * (-1338.052) (-1341.048) [-1332.480] (-1348.215) -- 0:00:58
Average standard deviation of split frequencies: 0.011071
780500 -- (-1340.906) [-1333.083] (-1341.244) (-1338.064) * (-1344.370) (-1354.944) [-1342.610] (-1340.158) -- 0:00:57
781000 -- [-1345.395] (-1343.343) (-1358.049) (-1341.168) * (-1342.828) [-1335.624] (-1346.130) (-1331.310) -- 0:00:57
781500 -- (-1344.499) [-1333.212] (-1345.551) (-1348.303) * [-1334.416] (-1336.149) (-1337.681) (-1340.436) -- 0:00:57
782000 -- [-1339.192] (-1340.838) (-1335.787) (-1343.047) * (-1333.397) [-1335.456] (-1339.105) (-1335.160) -- 0:00:57
782500 -- [-1339.589] (-1340.260) (-1335.603) (-1341.954) * [-1329.771] (-1339.963) (-1338.387) (-1334.325) -- 0:00:57
783000 -- (-1351.295) (-1346.519) [-1332.875] (-1332.951) * (-1331.452) (-1344.382) (-1339.416) [-1337.786] -- 0:00:57
783500 -- [-1339.020] (-1352.158) (-1336.667) (-1342.808) * (-1335.003) (-1335.259) (-1336.377) [-1335.992] -- 0:00:57
784000 -- (-1332.088) (-1338.570) (-1345.143) [-1331.588] * [-1341.362] (-1347.890) (-1335.635) (-1336.822) -- 0:00:57
784500 -- (-1337.733) [-1335.732] (-1339.926) (-1344.717) * (-1333.645) (-1360.053) (-1338.194) [-1341.752] -- 0:00:56
785000 -- (-1334.786) (-1335.218) [-1330.812] (-1336.164) * (-1343.353) (-1341.391) (-1339.811) [-1332.159] -- 0:00:56
Average standard deviation of split frequencies: 0.011195
785500 -- [-1336.670] (-1342.114) (-1341.138) (-1340.824) * (-1342.101) (-1351.451) [-1337.444] (-1336.912) -- 0:00:56
786000 -- (-1343.543) (-1343.995) (-1343.326) [-1336.630] * (-1342.721) (-1344.405) [-1334.838] (-1348.174) -- 0:00:56
786500 -- [-1337.304] (-1336.748) (-1343.731) (-1337.001) * (-1335.427) [-1333.879] (-1342.747) (-1336.074) -- 0:00:56
787000 -- (-1338.542) [-1338.065] (-1340.619) (-1339.977) * (-1334.428) (-1339.988) (-1347.272) [-1338.520] -- 0:00:56
787500 -- (-1352.103) [-1330.750] (-1346.069) (-1334.249) * [-1334.142] (-1331.261) (-1347.668) (-1339.032) -- 0:00:56
788000 -- (-1332.958) [-1336.255] (-1348.352) (-1333.403) * (-1336.908) [-1331.076] (-1340.629) (-1338.241) -- 0:00:55
788500 -- [-1332.158] (-1343.567) (-1349.032) (-1341.155) * [-1333.443] (-1332.156) (-1336.486) (-1343.615) -- 0:00:55
789000 -- (-1338.742) [-1339.534] (-1333.205) (-1351.904) * (-1343.441) [-1336.348] (-1331.922) (-1344.433) -- 0:00:55
789500 -- [-1329.842] (-1338.107) (-1339.152) (-1337.239) * [-1336.024] (-1342.558) (-1339.331) (-1343.920) -- 0:00:55
790000 -- [-1345.309] (-1336.043) (-1343.025) (-1339.161) * (-1340.975) [-1337.075] (-1337.890) (-1357.879) -- 0:00:55
Average standard deviation of split frequencies: 0.010931
790500 -- (-1354.648) (-1334.096) [-1330.296] (-1335.077) * (-1340.539) [-1341.755] (-1342.511) (-1341.831) -- 0:00:55
791000 -- (-1349.894) (-1339.193) (-1349.922) [-1337.348] * (-1352.110) (-1339.051) (-1347.732) [-1337.446] -- 0:00:55
791500 -- (-1346.207) [-1340.771] (-1349.194) (-1337.103) * (-1349.133) (-1340.698) [-1340.481] (-1341.839) -- 0:00:55
792000 -- [-1335.356] (-1337.281) (-1339.749) (-1338.137) * (-1344.917) (-1342.417) (-1337.204) [-1331.415] -- 0:00:54
792500 -- (-1329.270) (-1343.145) (-1344.197) [-1337.500] * (-1347.073) (-1345.634) (-1338.207) [-1336.006] -- 0:00:54
793000 -- (-1333.568) [-1336.781] (-1347.247) (-1337.506) * [-1336.238] (-1331.317) (-1337.635) (-1342.392) -- 0:00:54
793500 -- (-1332.729) (-1342.047) [-1341.584] (-1332.675) * (-1334.152) (-1336.949) (-1343.002) [-1335.521] -- 0:00:54
794000 -- (-1339.824) (-1340.223) (-1338.247) [-1336.679] * (-1332.756) (-1344.571) [-1337.472] (-1337.504) -- 0:00:54
794500 -- (-1346.558) (-1337.545) [-1328.883] (-1341.996) * [-1337.309] (-1337.946) (-1343.370) (-1344.799) -- 0:00:54
795000 -- (-1343.613) (-1339.012) [-1336.118] (-1343.290) * [-1335.756] (-1347.006) (-1338.618) (-1338.794) -- 0:00:54
Average standard deviation of split frequencies: 0.011121
795500 -- [-1334.405] (-1329.199) (-1346.688) (-1346.319) * (-1331.812) [-1339.090] (-1340.870) (-1342.941) -- 0:00:53
796000 -- (-1343.351) (-1347.976) [-1338.112] (-1342.199) * (-1344.029) (-1335.690) [-1339.017] (-1346.692) -- 0:00:53
796500 -- (-1346.384) (-1341.676) [-1333.842] (-1341.145) * (-1345.979) (-1338.306) [-1340.168] (-1338.895) -- 0:00:53
797000 -- [-1334.115] (-1334.892) (-1345.702) (-1339.083) * (-1337.752) (-1335.094) [-1343.690] (-1338.287) -- 0:00:53
797500 -- (-1347.741) (-1338.154) (-1343.573) [-1334.087] * (-1343.714) [-1340.617] (-1343.757) (-1343.359) -- 0:00:53
798000 -- [-1328.242] (-1343.654) (-1353.875) (-1341.176) * [-1334.500] (-1342.582) (-1346.004) (-1349.616) -- 0:00:53
798500 -- (-1336.727) (-1339.134) (-1349.833) [-1333.572] * (-1342.828) (-1334.588) [-1329.728] (-1345.965) -- 0:00:53
799000 -- [-1339.300] (-1339.757) (-1345.225) (-1340.905) * (-1331.844) [-1333.286] (-1347.959) (-1340.542) -- 0:00:53
799500 -- (-1338.050) (-1331.984) [-1336.667] (-1353.157) * [-1336.571] (-1337.128) (-1357.084) (-1345.333) -- 0:00:52
800000 -- (-1344.401) [-1331.375] (-1341.815) (-1346.222) * (-1341.194) (-1343.629) (-1341.887) [-1345.872] -- 0:00:52
Average standard deviation of split frequencies: 0.010925
800500 -- (-1345.024) (-1336.847) (-1334.938) [-1333.490] * [-1334.042] (-1346.447) (-1345.749) (-1341.363) -- 0:00:52
801000 -- (-1341.463) (-1336.649) [-1343.272] (-1334.372) * (-1337.998) (-1340.155) (-1343.485) [-1340.792] -- 0:00:52
801500 -- (-1344.453) (-1330.144) (-1338.152) [-1342.312] * (-1346.704) [-1332.310] (-1342.280) (-1337.440) -- 0:00:52
802000 -- (-1336.738) (-1338.190) (-1339.705) [-1332.948] * (-1325.914) (-1343.568) [-1340.382] (-1339.925) -- 0:00:52
802500 -- (-1342.653) (-1330.773) (-1335.242) [-1331.146] * (-1337.677) (-1335.158) [-1337.934] (-1340.148) -- 0:00:52
803000 -- [-1335.119] (-1335.893) (-1338.638) (-1334.222) * [-1341.361] (-1353.406) (-1340.086) (-1348.421) -- 0:00:52
803500 -- (-1336.623) [-1345.178] (-1345.476) (-1340.467) * (-1345.112) (-1340.769) (-1342.551) [-1338.414] -- 0:00:51
804000 -- (-1330.706) (-1331.227) (-1341.527) [-1333.944] * (-1338.919) (-1345.588) [-1330.685] (-1340.991) -- 0:00:51
804500 -- [-1333.802] (-1349.701) (-1338.364) (-1339.255) * (-1344.595) (-1349.463) [-1335.698] (-1338.907) -- 0:00:51
805000 -- (-1333.062) (-1346.852) [-1334.077] (-1335.119) * [-1336.463] (-1335.702) (-1327.377) (-1354.522) -- 0:00:51
Average standard deviation of split frequencies: 0.010918
805500 -- (-1341.361) (-1335.098) (-1339.975) [-1334.708] * (-1336.615) (-1342.753) (-1337.267) [-1341.284] -- 0:00:51
806000 -- (-1331.088) (-1338.124) [-1339.565] (-1331.927) * (-1335.774) (-1353.608) [-1338.326] (-1346.972) -- 0:00:51
806500 -- (-1353.802) [-1344.063] (-1340.114) (-1335.112) * [-1335.498] (-1347.158) (-1343.171) (-1339.372) -- 0:00:51
807000 -- (-1343.601) (-1342.712) (-1347.813) [-1337.682] * (-1333.266) (-1340.233) [-1341.663] (-1342.745) -- 0:00:50
807500 -- (-1340.561) [-1342.242] (-1333.332) (-1336.077) * [-1331.387] (-1342.890) (-1346.651) (-1332.083) -- 0:00:50
808000 -- [-1337.880] (-1344.196) (-1336.150) (-1338.511) * [-1333.868] (-1342.265) (-1345.798) (-1332.125) -- 0:00:50
808500 -- (-1333.191) (-1340.354) (-1339.888) [-1339.176] * (-1339.218) (-1343.730) (-1340.692) [-1346.499] -- 0:00:50
809000 -- [-1331.811] (-1341.406) (-1344.930) (-1330.313) * [-1335.697] (-1348.981) (-1345.406) (-1349.133) -- 0:00:50
809500 -- (-1332.715) [-1332.781] (-1345.963) (-1343.852) * [-1341.563] (-1340.786) (-1337.639) (-1348.206) -- 0:00:50
810000 -- (-1333.792) [-1340.361] (-1339.265) (-1338.184) * (-1343.490) [-1342.585] (-1352.984) (-1331.522) -- 0:00:50
Average standard deviation of split frequencies: 0.011049
810500 -- [-1347.800] (-1331.418) (-1345.882) (-1338.137) * [-1341.365] (-1342.844) (-1333.863) (-1332.957) -- 0:00:50
811000 -- (-1339.474) (-1341.561) (-1351.803) [-1329.571] * [-1342.626] (-1340.230) (-1340.411) (-1331.863) -- 0:00:49
811500 -- (-1335.795) [-1328.170] (-1344.211) (-1334.390) * (-1338.000) (-1345.654) (-1349.661) [-1339.990] -- 0:00:49
812000 -- (-1339.320) (-1340.468) [-1339.188] (-1336.082) * (-1333.899) (-1340.040) [-1337.640] (-1353.854) -- 0:00:49
812500 -- (-1340.434) [-1327.575] (-1335.197) (-1333.897) * (-1340.252) (-1332.472) (-1343.363) [-1334.702] -- 0:00:49
813000 -- (-1337.230) (-1347.263) [-1337.467] (-1337.098) * [-1334.245] (-1339.259) (-1341.431) (-1337.687) -- 0:00:49
813500 -- [-1345.086] (-1339.435) (-1336.633) (-1336.223) * (-1341.239) (-1330.481) (-1340.334) [-1341.325] -- 0:00:49
814000 -- [-1336.937] (-1342.512) (-1344.127) (-1342.434) * (-1335.223) (-1333.772) [-1339.085] (-1340.806) -- 0:00:49
814500 -- (-1346.727) (-1343.240) (-1340.695) [-1328.760] * (-1338.864) [-1337.919] (-1357.010) (-1337.913) -- 0:00:48
815000 -- (-1352.146) (-1341.060) (-1334.320) [-1332.742] * [-1332.785] (-1337.065) (-1339.194) (-1339.439) -- 0:00:48
Average standard deviation of split frequencies: 0.010944
815500 -- (-1335.938) (-1348.506) [-1333.237] (-1343.015) * (-1334.999) [-1335.981] (-1338.299) (-1338.071) -- 0:00:48
816000 -- (-1339.157) (-1337.482) (-1348.806) [-1345.999] * (-1338.301) (-1339.988) (-1338.907) [-1344.723] -- 0:00:48
816500 -- [-1329.671] (-1335.734) (-1334.228) (-1341.566) * [-1331.676] (-1344.869) (-1331.003) (-1344.167) -- 0:00:48
817000 -- [-1335.129] (-1343.033) (-1339.888) (-1341.130) * [-1335.939] (-1352.444) (-1352.846) (-1338.946) -- 0:00:48
817500 -- [-1343.181] (-1334.288) (-1340.372) (-1335.286) * (-1350.241) (-1336.139) (-1346.479) [-1340.740] -- 0:00:48
818000 -- (-1339.587) (-1348.070) [-1337.669] (-1341.612) * (-1354.542) (-1334.256) (-1335.332) [-1334.488] -- 0:00:48
818500 -- (-1339.142) (-1338.670) (-1337.741) [-1337.540] * (-1339.314) (-1339.980) (-1346.246) [-1334.756] -- 0:00:47
819000 -- (-1342.070) [-1337.341] (-1345.747) (-1337.219) * [-1336.007] (-1339.677) (-1334.146) (-1337.902) -- 0:00:47
819500 -- [-1334.656] (-1334.025) (-1355.068) (-1343.808) * [-1332.884] (-1336.157) (-1334.108) (-1340.785) -- 0:00:47
820000 -- (-1333.952) (-1337.504) (-1337.881) [-1341.733] * [-1331.463] (-1335.974) (-1340.007) (-1336.031) -- 0:00:47
Average standard deviation of split frequencies: 0.010818
820500 -- (-1339.106) (-1345.089) (-1342.263) [-1336.729] * [-1327.666] (-1337.657) (-1342.210) (-1338.304) -- 0:00:47
821000 -- (-1341.215) (-1327.128) (-1339.101) [-1333.802] * (-1332.952) (-1329.847) (-1344.187) [-1335.786] -- 0:00:47
821500 -- (-1343.556) (-1347.428) (-1332.263) [-1338.101] * (-1342.216) (-1340.525) [-1342.666] (-1352.970) -- 0:00:47
822000 -- (-1334.217) (-1343.694) (-1345.766) [-1330.517] * [-1327.703] (-1334.736) (-1334.709) (-1342.264) -- 0:00:46
822500 -- (-1333.438) [-1343.046] (-1343.430) (-1340.627) * (-1338.627) [-1334.920] (-1332.270) (-1337.137) -- 0:00:46
823000 -- (-1341.208) [-1340.767] (-1351.404) (-1338.512) * [-1335.270] (-1341.564) (-1331.237) (-1343.050) -- 0:00:46
823500 -- (-1346.304) [-1334.642] (-1350.504) (-1340.523) * (-1335.545) (-1341.193) [-1331.673] (-1340.354) -- 0:00:46
824000 -- (-1346.561) [-1332.211] (-1335.758) (-1344.066) * (-1335.078) (-1347.850) [-1332.467] (-1347.471) -- 0:00:46
824500 -- (-1343.199) (-1326.912) [-1331.212] (-1338.157) * (-1338.930) (-1345.564) [-1339.497] (-1342.862) -- 0:00:46
825000 -- [-1335.199] (-1337.233) (-1339.649) (-1336.525) * (-1337.016) [-1335.504] (-1340.175) (-1337.139) -- 0:00:46
Average standard deviation of split frequencies: 0.010907
825500 -- (-1341.228) [-1331.793] (-1344.650) (-1337.439) * (-1344.409) [-1334.308] (-1337.302) (-1337.236) -- 0:00:46
826000 -- (-1342.716) [-1342.347] (-1346.895) (-1343.079) * (-1340.511) (-1334.027) [-1344.333] (-1340.599) -- 0:00:45
826500 -- (-1336.333) [-1336.319] (-1333.722) (-1337.876) * (-1334.402) (-1340.165) [-1337.231] (-1345.608) -- 0:00:45
827000 -- (-1336.557) (-1339.092) (-1330.413) [-1333.775] * (-1339.714) [-1342.024] (-1332.783) (-1344.791) -- 0:00:45
827500 -- (-1343.829) (-1349.338) [-1328.689] (-1341.329) * [-1335.738] (-1364.400) (-1344.928) (-1343.851) -- 0:00:45
828000 -- [-1337.194] (-1330.824) (-1340.631) (-1340.445) * (-1341.933) (-1337.926) [-1353.930] (-1342.310) -- 0:00:45
828500 -- [-1335.610] (-1341.477) (-1340.054) (-1334.648) * (-1336.511) [-1331.884] (-1347.449) (-1334.943) -- 0:00:45
829000 -- (-1345.035) (-1337.676) [-1331.291] (-1338.209) * (-1338.985) (-1335.894) (-1345.362) [-1338.623] -- 0:00:45
829500 -- (-1341.293) (-1336.276) [-1335.303] (-1355.557) * (-1342.174) (-1337.490) (-1340.106) [-1351.171] -- 0:00:45
830000 -- (-1342.811) (-1337.095) (-1344.400) [-1347.605] * [-1342.959] (-1345.603) (-1340.908) (-1347.961) -- 0:00:44
Average standard deviation of split frequencies: 0.010530
830500 -- (-1337.415) [-1334.106] (-1345.927) (-1354.250) * (-1342.289) (-1343.626) [-1332.439] (-1340.631) -- 0:00:44
831000 -- (-1343.795) (-1342.589) [-1348.018] (-1350.840) * (-1343.860) (-1335.675) (-1333.602) [-1331.378] -- 0:00:44
831500 -- (-1332.677) (-1340.008) [-1331.185] (-1343.241) * (-1340.041) [-1332.476] (-1336.379) (-1330.889) -- 0:00:44
832000 -- (-1340.482) [-1343.844] (-1342.945) (-1340.118) * (-1339.776) (-1340.846) (-1342.222) [-1341.272] -- 0:00:44
832500 -- (-1340.371) (-1339.025) (-1334.901) [-1333.646] * (-1343.471) [-1335.347] (-1332.947) (-1344.250) -- 0:00:44
833000 -- (-1346.421) (-1334.330) [-1345.623] (-1332.706) * (-1339.900) [-1340.740] (-1338.216) (-1338.494) -- 0:00:44
833500 -- (-1339.617) (-1334.478) [-1339.184] (-1344.139) * (-1341.073) [-1343.457] (-1347.413) (-1342.163) -- 0:00:43
834000 -- (-1348.061) (-1337.639) [-1335.439] (-1339.361) * (-1343.498) [-1338.350] (-1335.096) (-1335.124) -- 0:00:43
834500 -- (-1333.882) [-1337.448] (-1337.885) (-1348.454) * (-1336.269) (-1347.341) (-1330.356) [-1336.912] -- 0:00:43
835000 -- (-1340.926) (-1341.941) (-1350.904) [-1347.944] * (-1333.684) [-1336.167] (-1343.267) (-1338.517) -- 0:00:43
Average standard deviation of split frequencies: 0.010181
835500 -- [-1339.009] (-1343.028) (-1347.566) (-1334.666) * (-1343.830) (-1346.219) [-1336.343] (-1335.695) -- 0:00:43
836000 -- (-1337.142) [-1343.315] (-1341.515) (-1345.289) * (-1345.353) (-1336.255) (-1335.040) [-1340.294] -- 0:00:43
836500 -- (-1348.543) (-1346.281) (-1338.181) [-1339.709] * (-1347.041) (-1335.570) [-1329.106] (-1337.319) -- 0:00:43
837000 -- [-1337.960] (-1339.577) (-1341.220) (-1341.829) * (-1347.714) [-1338.336] (-1335.187) (-1332.260) -- 0:00:43
837500 -- (-1335.132) (-1335.826) [-1342.583] (-1333.552) * (-1347.939) (-1342.090) (-1339.720) [-1342.820] -- 0:00:42
838000 -- (-1341.757) (-1359.543) (-1327.073) [-1332.401] * (-1341.387) [-1338.441] (-1343.867) (-1336.599) -- 0:00:42
838500 -- [-1331.441] (-1333.730) (-1336.734) (-1335.574) * (-1339.301) (-1339.281) [-1339.560] (-1340.832) -- 0:00:42
839000 -- [-1339.542] (-1347.474) (-1351.904) (-1342.864) * [-1332.717] (-1350.174) (-1328.589) (-1341.176) -- 0:00:42
839500 -- (-1334.955) (-1344.931) [-1331.930] (-1358.655) * (-1341.590) [-1332.758] (-1329.534) (-1346.773) -- 0:00:42
840000 -- [-1343.481] (-1335.279) (-1337.938) (-1337.800) * (-1347.731) (-1348.251) [-1338.029] (-1346.301) -- 0:00:42
Average standard deviation of split frequencies: 0.010280
840500 -- (-1346.816) (-1341.661) [-1332.046] (-1335.798) * (-1344.823) (-1340.523) [-1340.845] (-1341.186) -- 0:00:42
841000 -- (-1338.681) [-1333.432] (-1341.664) (-1336.429) * [-1331.182] (-1355.506) (-1339.321) (-1344.054) -- 0:00:41
841500 -- (-1340.269) (-1336.265) [-1336.089] (-1345.936) * (-1340.487) [-1337.545] (-1345.840) (-1341.041) -- 0:00:41
842000 -- (-1339.476) (-1344.257) (-1335.750) [-1339.903] * (-1342.096) [-1342.308] (-1338.269) (-1340.876) -- 0:00:41
842500 -- (-1352.430) (-1337.608) [-1344.774] (-1339.352) * (-1337.537) [-1333.775] (-1336.875) (-1348.600) -- 0:00:41
843000 -- [-1335.489] (-1335.098) (-1351.057) (-1335.685) * (-1345.179) [-1336.851] (-1341.122) (-1339.149) -- 0:00:41
843500 -- (-1348.919) (-1348.271) (-1340.224) [-1345.868] * (-1344.244) (-1337.652) [-1339.774] (-1343.303) -- 0:00:41
844000 -- (-1339.762) [-1327.752] (-1341.428) (-1358.856) * [-1329.259] (-1340.432) (-1350.379) (-1335.464) -- 0:00:41
844500 -- [-1338.605] (-1340.742) (-1340.873) (-1350.669) * (-1342.479) [-1334.788] (-1336.994) (-1338.568) -- 0:00:41
845000 -- (-1335.949) (-1344.502) (-1346.735) [-1339.253] * (-1343.689) [-1337.636] (-1343.287) (-1337.267) -- 0:00:40
Average standard deviation of split frequencies: 0.010804
845500 -- (-1341.265) (-1344.716) (-1352.702) [-1337.158] * (-1338.498) (-1345.526) [-1335.971] (-1337.091) -- 0:00:40
846000 -- (-1342.495) (-1338.355) [-1331.658] (-1348.223) * (-1334.585) [-1341.366] (-1344.575) (-1341.927) -- 0:00:40
846500 -- (-1340.328) (-1345.352) (-1341.837) [-1339.189] * [-1333.398] (-1336.930) (-1339.461) (-1341.927) -- 0:00:40
847000 -- (-1341.935) (-1339.708) (-1341.141) [-1332.745] * [-1344.508] (-1350.695) (-1339.989) (-1342.694) -- 0:00:40
847500 -- (-1340.510) [-1337.964] (-1341.713) (-1336.097) * (-1345.977) [-1334.992] (-1339.417) (-1353.773) -- 0:00:40
848000 -- [-1336.312] (-1337.691) (-1338.766) (-1334.294) * [-1340.125] (-1343.989) (-1342.065) (-1342.790) -- 0:00:40
848500 -- (-1339.799) (-1344.674) [-1335.184] (-1331.483) * (-1341.450) (-1342.661) (-1341.859) [-1340.312] -- 0:00:39
849000 -- [-1332.779] (-1349.561) (-1348.695) (-1336.768) * (-1337.589) (-1337.158) [-1337.900] (-1335.509) -- 0:00:39
849500 -- (-1340.296) (-1340.101) (-1346.238) [-1336.114] * [-1331.941] (-1337.851) (-1336.041) (-1337.691) -- 0:00:39
850000 -- (-1342.430) (-1344.609) [-1333.422] (-1338.552) * [-1337.300] (-1350.681) (-1336.818) (-1345.249) -- 0:00:39
Average standard deviation of split frequencies: 0.010745
850500 -- (-1348.333) (-1336.320) (-1345.902) [-1332.010] * (-1341.613) (-1340.488) (-1348.662) [-1332.910] -- 0:00:39
851000 -- (-1339.860) [-1335.818] (-1341.075) (-1335.269) * (-1332.194) [-1332.348] (-1342.142) (-1336.410) -- 0:00:39
851500 -- (-1344.771) [-1330.956] (-1336.766) (-1336.080) * (-1347.138) [-1341.089] (-1341.109) (-1342.292) -- 0:00:39
852000 -- (-1340.181) [-1338.641] (-1342.172) (-1338.665) * (-1341.368) (-1348.553) (-1340.564) [-1331.449] -- 0:00:39
852500 -- (-1345.051) (-1337.969) [-1336.738] (-1341.565) * (-1335.270) (-1336.597) [-1328.572] (-1346.707) -- 0:00:38
853000 -- (-1347.302) [-1341.318] (-1335.814) (-1344.653) * (-1342.601) [-1338.309] (-1339.850) (-1333.029) -- 0:00:38
853500 -- (-1358.309) (-1337.233) (-1332.252) [-1334.403] * (-1343.611) [-1333.032] (-1330.134) (-1335.375) -- 0:00:38
854000 -- (-1345.850) (-1343.132) (-1336.889) [-1332.904] * (-1336.600) [-1332.502] (-1336.640) (-1343.988) -- 0:00:38
854500 -- (-1344.890) [-1337.624] (-1335.155) (-1341.422) * (-1331.401) (-1332.368) [-1329.893] (-1345.090) -- 0:00:38
855000 -- (-1336.824) [-1328.655] (-1344.959) (-1332.623) * (-1342.588) (-1347.392) [-1339.742] (-1340.988) -- 0:00:38
Average standard deviation of split frequencies: 0.010494
855500 -- [-1337.733] (-1335.571) (-1343.401) (-1352.044) * [-1338.444] (-1346.987) (-1340.984) (-1339.372) -- 0:00:38
856000 -- (-1333.952) [-1333.428] (-1330.204) (-1346.106) * [-1336.418] (-1332.895) (-1336.726) (-1332.145) -- 0:00:38
856500 -- [-1333.519] (-1337.860) (-1340.046) (-1342.074) * (-1340.712) (-1333.429) [-1334.411] (-1343.030) -- 0:00:37
857000 -- (-1347.287) (-1335.934) (-1336.000) [-1338.573] * (-1344.193) [-1333.827] (-1331.247) (-1344.354) -- 0:00:37
857500 -- (-1347.533) (-1335.706) [-1335.457] (-1332.024) * [-1337.799] (-1344.538) (-1342.893) (-1340.904) -- 0:00:37
858000 -- (-1341.383) [-1332.119] (-1337.410) (-1343.985) * (-1338.869) (-1331.925) [-1338.236] (-1339.225) -- 0:00:37
858500 -- (-1335.529) [-1330.895] (-1333.922) (-1339.982) * (-1343.974) [-1336.576] (-1346.891) (-1335.710) -- 0:00:37
859000 -- (-1341.076) (-1341.210) (-1338.032) [-1338.228] * [-1333.682] (-1338.028) (-1336.924) (-1344.037) -- 0:00:37
859500 -- [-1345.042] (-1341.230) (-1336.215) (-1352.637) * (-1336.745) [-1337.089] (-1341.255) (-1330.610) -- 0:00:37
860000 -- (-1335.356) (-1339.236) [-1340.819] (-1346.352) * [-1336.718] (-1343.206) (-1333.344) (-1338.251) -- 0:00:36
Average standard deviation of split frequencies: 0.010255
860500 -- (-1341.305) (-1343.738) (-1335.172) [-1342.516] * (-1339.033) [-1339.745] (-1342.815) (-1339.055) -- 0:00:36
861000 -- (-1348.492) (-1348.992) [-1344.411] (-1346.812) * (-1350.512) (-1344.020) [-1338.465] (-1353.210) -- 0:00:36
861500 -- (-1342.956) (-1339.547) [-1335.654] (-1333.815) * (-1332.655) (-1344.598) (-1333.042) [-1341.025] -- 0:00:36
862000 -- (-1339.728) (-1345.559) [-1331.869] (-1326.212) * (-1344.198) (-1350.796) [-1330.233] (-1333.536) -- 0:00:36
862500 -- [-1341.145] (-1346.375) (-1338.189) (-1351.868) * (-1343.149) (-1354.745) (-1346.682) [-1334.955] -- 0:00:36
863000 -- (-1344.874) (-1342.203) (-1344.640) [-1334.410] * (-1340.687) (-1335.757) [-1336.441] (-1337.540) -- 0:00:36
863500 -- (-1345.524) (-1340.393) [-1336.683] (-1339.496) * (-1341.700) (-1342.522) (-1340.373) [-1341.578] -- 0:00:36
864000 -- (-1341.834) [-1335.937] (-1329.412) (-1342.699) * [-1338.977] (-1352.493) (-1340.836) (-1344.146) -- 0:00:35
864500 -- [-1341.051] (-1336.287) (-1340.299) (-1349.964) * (-1335.499) (-1339.388) [-1336.315] (-1347.533) -- 0:00:35
865000 -- (-1338.534) (-1342.939) (-1342.766) [-1342.770] * (-1344.931) (-1341.438) (-1335.550) [-1339.757] -- 0:00:35
Average standard deviation of split frequencies: 0.010675
865500 -- [-1347.346] (-1344.930) (-1348.412) (-1342.615) * (-1338.481) (-1329.987) [-1332.317] (-1343.947) -- 0:00:35
866000 -- [-1340.884] (-1339.523) (-1335.934) (-1336.936) * (-1338.493) [-1339.737] (-1344.401) (-1350.442) -- 0:00:35
866500 -- (-1353.465) (-1333.001) [-1335.881] (-1344.127) * [-1338.568] (-1335.222) (-1327.848) (-1348.898) -- 0:00:35
867000 -- [-1336.553] (-1344.038) (-1341.855) (-1347.473) * (-1338.667) (-1343.666) (-1333.188) [-1341.584] -- 0:00:35
867500 -- [-1347.781] (-1331.834) (-1350.842) (-1331.759) * (-1346.292) (-1338.933) [-1333.047] (-1340.179) -- 0:00:34
868000 -- [-1338.371] (-1345.274) (-1344.749) (-1331.665) * (-1333.265) (-1340.666) [-1337.510] (-1353.048) -- 0:00:34
868500 -- (-1339.247) (-1327.660) (-1348.197) [-1336.731] * (-1348.041) (-1344.663) (-1342.098) [-1341.879] -- 0:00:34
869000 -- (-1330.265) (-1332.062) [-1335.446] (-1339.618) * (-1333.525) (-1335.047) [-1340.318] (-1340.058) -- 0:00:34
869500 -- (-1329.619) [-1331.992] (-1342.682) (-1341.144) * (-1339.195) (-1349.297) (-1343.315) [-1340.962] -- 0:00:34
870000 -- (-1340.358) (-1333.719) (-1341.396) [-1342.785] * [-1328.882] (-1344.291) (-1345.048) (-1337.125) -- 0:00:34
Average standard deviation of split frequencies: 0.010257
870500 -- (-1342.503) [-1325.568] (-1341.333) (-1336.356) * (-1337.277) (-1347.860) (-1341.291) [-1341.587] -- 0:00:34
871000 -- (-1341.992) (-1342.261) (-1333.286) [-1335.161] * (-1338.596) (-1336.902) [-1342.110] (-1335.243) -- 0:00:34
871500 -- (-1337.332) (-1339.813) (-1348.934) [-1333.336] * [-1332.180] (-1340.643) (-1338.473) (-1343.169) -- 0:00:33
872000 -- (-1346.322) [-1340.846] (-1328.688) (-1341.874) * (-1347.030) (-1340.944) [-1335.992] (-1336.967) -- 0:00:33
872500 -- [-1341.201] (-1338.694) (-1347.939) (-1344.001) * (-1347.349) [-1336.742] (-1337.882) (-1338.347) -- 0:00:33
873000 -- [-1340.776] (-1335.145) (-1339.010) (-1338.073) * (-1333.835) [-1336.723] (-1348.881) (-1345.730) -- 0:00:33
873500 -- (-1342.938) (-1334.768) (-1338.951) [-1333.890] * [-1337.826] (-1333.848) (-1340.525) (-1344.034) -- 0:00:33
874000 -- [-1333.940] (-1337.996) (-1327.952) (-1336.504) * (-1336.478) (-1335.949) (-1342.448) [-1332.507] -- 0:00:33
874500 -- (-1330.923) (-1342.254) [-1337.146] (-1354.352) * [-1336.881] (-1338.260) (-1340.799) (-1339.943) -- 0:00:33
875000 -- [-1340.853] (-1334.719) (-1344.341) (-1343.784) * (-1338.455) [-1334.032] (-1338.781) (-1341.875) -- 0:00:33
Average standard deviation of split frequencies: 0.010135
875500 -- [-1329.710] (-1346.668) (-1342.311) (-1336.144) * (-1346.176) (-1345.750) [-1342.254] (-1351.994) -- 0:00:32
876000 -- [-1332.909] (-1333.228) (-1358.890) (-1340.163) * (-1350.111) (-1339.307) (-1341.085) [-1337.230] -- 0:00:32
876500 -- (-1340.301) [-1333.102] (-1346.855) (-1342.556) * (-1342.548) [-1332.579] (-1332.468) (-1350.498) -- 0:00:32
877000 -- (-1350.725) [-1329.293] (-1346.158) (-1343.845) * (-1339.190) (-1332.319) [-1334.663] (-1343.567) -- 0:00:32
877500 -- (-1342.670) (-1341.626) [-1341.832] (-1335.088) * (-1344.196) (-1339.990) [-1337.270] (-1336.577) -- 0:00:32
878000 -- (-1360.654) (-1332.373) (-1337.693) [-1339.894] * (-1335.305) [-1338.138] (-1344.503) (-1334.619) -- 0:00:32
878500 -- (-1344.255) (-1333.620) (-1337.052) [-1335.878] * (-1337.607) (-1329.475) [-1352.496] (-1345.553) -- 0:00:32
879000 -- (-1340.233) (-1341.364) (-1337.445) [-1331.982] * (-1350.801) [-1331.180] (-1343.183) (-1341.252) -- 0:00:31
879500 -- (-1334.351) [-1326.818] (-1342.279) (-1337.527) * (-1339.928) (-1339.017) (-1351.270) [-1333.013] -- 0:00:31
880000 -- (-1340.079) (-1342.451) (-1335.539) [-1331.352] * (-1337.431) (-1346.932) [-1342.727] (-1338.143) -- 0:00:31
Average standard deviation of split frequencies: 0.010081
880500 -- (-1339.786) (-1343.019) (-1346.902) [-1329.472] * (-1343.053) [-1342.512] (-1341.710) (-1344.712) -- 0:00:31
881000 -- (-1336.579) (-1334.373) (-1355.902) [-1338.696] * [-1334.208] (-1329.912) (-1328.236) (-1344.573) -- 0:00:31
881500 -- (-1338.777) (-1344.026) (-1333.654) [-1331.951] * (-1345.386) (-1346.926) [-1331.857] (-1351.508) -- 0:00:31
882000 -- (-1337.068) (-1344.023) (-1340.269) [-1340.793] * [-1342.430] (-1349.484) (-1337.620) (-1345.343) -- 0:00:31
882500 -- (-1331.545) (-1345.392) [-1335.789] (-1338.183) * (-1335.961) (-1341.856) (-1336.571) [-1337.627] -- 0:00:31
883000 -- [-1333.638] (-1346.363) (-1352.796) (-1331.353) * (-1350.807) (-1358.206) [-1339.694] (-1339.441) -- 0:00:30
883500 -- (-1338.587) (-1345.529) (-1342.810) [-1340.940] * (-1336.696) (-1344.566) [-1344.792] (-1349.985) -- 0:00:30
884000 -- (-1344.709) (-1342.797) (-1336.904) [-1339.593] * (-1334.929) (-1336.854) [-1336.455] (-1353.893) -- 0:00:30
884500 -- [-1331.864] (-1337.651) (-1335.231) (-1337.410) * (-1339.342) (-1334.176) [-1337.553] (-1341.756) -- 0:00:30
885000 -- [-1335.074] (-1333.832) (-1351.553) (-1342.570) * [-1332.169] (-1337.606) (-1347.718) (-1348.794) -- 0:00:30
Average standard deviation of split frequencies: 0.009991
885500 -- (-1333.752) (-1339.704) [-1342.710] (-1336.130) * (-1337.829) (-1342.935) [-1338.299] (-1340.073) -- 0:00:30
886000 -- [-1333.890] (-1350.184) (-1330.380) (-1332.854) * (-1344.590) (-1335.953) [-1335.679] (-1342.912) -- 0:00:30
886500 -- [-1332.665] (-1333.391) (-1335.437) (-1342.972) * (-1338.034) (-1338.320) (-1341.505) [-1339.555] -- 0:00:29
887000 -- (-1331.385) (-1353.644) (-1336.977) [-1326.065] * (-1344.751) (-1332.786) (-1343.720) [-1347.499] -- 0:00:29
887500 -- (-1343.893) (-1336.172) (-1328.511) [-1333.727] * (-1342.544) [-1332.507] (-1332.729) (-1345.216) -- 0:00:29
888000 -- [-1333.541] (-1338.375) (-1340.548) (-1339.038) * [-1333.995] (-1333.560) (-1337.647) (-1343.184) -- 0:00:29
888500 -- [-1331.540] (-1340.197) (-1339.092) (-1337.083) * (-1337.853) [-1332.179] (-1345.765) (-1337.293) -- 0:00:29
889000 -- (-1337.223) [-1327.815] (-1344.728) (-1340.241) * (-1345.844) [-1334.241] (-1335.096) (-1340.883) -- 0:00:29
889500 -- [-1336.009] (-1348.014) (-1332.016) (-1342.889) * [-1329.791] (-1336.531) (-1343.450) (-1342.455) -- 0:00:29
890000 -- (-1334.233) (-1328.563) [-1338.736] (-1331.892) * [-1330.690] (-1329.027) (-1337.025) (-1340.062) -- 0:00:29
Average standard deviation of split frequencies: 0.010233
890500 -- (-1336.249) [-1334.713] (-1333.811) (-1331.359) * (-1334.359) (-1346.343) [-1336.179] (-1340.973) -- 0:00:28
891000 -- (-1345.019) (-1337.901) [-1341.650] (-1339.145) * (-1335.187) (-1338.775) [-1333.289] (-1346.549) -- 0:00:28
891500 -- (-1332.845) [-1345.531] (-1337.429) (-1344.977) * (-1334.800) (-1333.024) [-1339.700] (-1347.754) -- 0:00:28
892000 -- [-1335.907] (-1336.818) (-1337.916) (-1348.043) * (-1346.362) [-1334.265] (-1336.068) (-1338.999) -- 0:00:28
892500 -- (-1336.764) (-1356.545) [-1338.204] (-1338.087) * [-1338.212] (-1338.313) (-1343.434) (-1341.076) -- 0:00:28
893000 -- (-1341.612) [-1337.732] (-1336.014) (-1346.236) * (-1348.912) [-1335.228] (-1332.017) (-1337.199) -- 0:00:28
893500 -- [-1333.463] (-1341.171) (-1342.126) (-1353.979) * (-1332.687) (-1346.749) (-1333.619) [-1334.063] -- 0:00:28
894000 -- (-1338.501) (-1327.573) (-1337.491) [-1352.427] * (-1332.011) (-1341.135) [-1333.104] (-1334.164) -- 0:00:27
894500 -- (-1349.865) (-1336.073) [-1337.199] (-1343.587) * [-1331.552] (-1336.754) (-1343.454) (-1344.151) -- 0:00:27
895000 -- (-1335.160) [-1331.228] (-1333.450) (-1346.325) * (-1331.239) (-1334.748) [-1331.765] (-1335.811) -- 0:00:27
Average standard deviation of split frequencies: 0.010259
895500 -- (-1349.315) (-1333.887) [-1337.443] (-1354.805) * (-1336.372) (-1335.616) (-1333.701) [-1332.751] -- 0:00:27
896000 -- (-1343.494) [-1341.752] (-1350.373) (-1355.893) * (-1340.139) (-1347.903) (-1341.336) [-1332.690] -- 0:00:27
896500 -- (-1340.965) [-1342.111] (-1340.379) (-1343.133) * (-1357.275) (-1339.112) [-1337.335] (-1342.280) -- 0:00:27
897000 -- [-1335.479] (-1331.484) (-1337.665) (-1341.806) * [-1334.377] (-1340.363) (-1331.203) (-1339.717) -- 0:00:27
897500 -- (-1340.478) (-1333.452) (-1346.005) [-1337.613] * (-1342.182) (-1333.297) (-1331.531) [-1329.342] -- 0:00:27
898000 -- (-1344.162) [-1331.558] (-1333.707) (-1339.468) * (-1344.017) (-1339.752) (-1333.503) [-1339.858] -- 0:00:26
898500 -- (-1342.627) (-1334.670) (-1331.620) [-1343.893] * (-1337.199) (-1342.492) (-1339.071) [-1340.153] -- 0:00:26
899000 -- (-1333.450) (-1353.382) [-1332.725] (-1340.131) * (-1340.116) (-1335.334) (-1345.021) [-1332.687] -- 0:00:26
899500 -- (-1333.742) (-1344.323) (-1338.928) [-1324.928] * (-1337.778) (-1339.915) [-1342.704] (-1339.696) -- 0:00:26
900000 -- (-1329.513) (-1334.369) (-1339.946) [-1336.011] * [-1338.022] (-1342.545) (-1337.559) (-1347.239) -- 0:00:26
Average standard deviation of split frequencies: 0.010090
900500 -- [-1325.857] (-1343.026) (-1341.464) (-1335.040) * (-1341.719) [-1340.316] (-1334.232) (-1338.982) -- 0:00:26
901000 -- (-1336.553) (-1339.193) [-1338.413] (-1347.795) * (-1337.574) (-1341.312) [-1341.070] (-1333.887) -- 0:00:26
901500 -- (-1346.488) [-1342.255] (-1334.811) (-1348.237) * (-1340.591) (-1339.785) [-1330.645] (-1339.521) -- 0:00:26
902000 -- (-1339.534) (-1338.634) [-1337.439] (-1345.832) * (-1335.834) (-1339.393) (-1338.548) [-1334.707] -- 0:00:25
902500 -- (-1346.713) (-1339.272) (-1345.261) [-1335.150] * (-1346.429) [-1345.431] (-1336.693) (-1333.876) -- 0:00:25
903000 -- [-1334.703] (-1333.388) (-1341.890) (-1337.016) * (-1346.923) (-1338.493) (-1341.637) [-1335.954] -- 0:00:25
903500 -- (-1340.179) [-1331.592] (-1336.945) (-1332.931) * (-1346.879) (-1341.688) (-1333.693) [-1340.390] -- 0:00:25
904000 -- [-1344.379] (-1340.885) (-1334.919) (-1333.109) * (-1342.555) (-1340.051) (-1342.636) [-1336.860] -- 0:00:25
904500 -- (-1343.113) [-1338.247] (-1336.105) (-1343.540) * (-1342.176) (-1344.929) [-1336.079] (-1341.655) -- 0:00:25
905000 -- [-1337.726] (-1334.186) (-1335.945) (-1337.424) * (-1342.666) (-1337.861) (-1339.635) [-1343.512] -- 0:00:25
Average standard deviation of split frequencies: 0.009597
905500 -- (-1335.512) (-1344.173) [-1333.478] (-1339.513) * (-1332.766) (-1341.590) [-1335.439] (-1343.844) -- 0:00:24
906000 -- (-1331.431) (-1337.631) (-1331.819) [-1336.881] * [-1331.187] (-1335.905) (-1348.121) (-1342.432) -- 0:00:24
906500 -- (-1338.925) (-1337.394) (-1333.182) [-1337.331] * [-1337.342] (-1344.859) (-1336.001) (-1339.918) -- 0:00:24
907000 -- (-1344.844) (-1346.920) (-1333.832) [-1332.952] * (-1344.043) (-1349.157) (-1336.713) [-1335.781] -- 0:00:24
907500 -- (-1345.679) [-1338.103] (-1330.902) (-1340.195) * (-1338.025) (-1343.256) (-1347.242) [-1341.090] -- 0:00:24
908000 -- [-1342.610] (-1338.432) (-1341.068) (-1336.464) * [-1335.406] (-1337.786) (-1339.678) (-1339.056) -- 0:00:24
908500 -- (-1344.262) [-1336.008] (-1336.627) (-1339.332) * (-1338.961) [-1335.460] (-1347.246) (-1340.085) -- 0:00:24
909000 -- (-1343.814) [-1334.354] (-1345.270) (-1326.174) * (-1344.535) (-1341.106) (-1347.392) [-1337.931] -- 0:00:24
909500 -- (-1335.933) (-1331.487) (-1338.247) [-1333.101] * (-1342.584) (-1341.213) [-1327.602] (-1334.077) -- 0:00:23
910000 -- (-1338.013) (-1353.859) [-1342.852] (-1336.349) * (-1349.406) (-1338.353) [-1330.268] (-1342.915) -- 0:00:23
Average standard deviation of split frequencies: 0.009461
910500 -- (-1336.888) [-1332.130] (-1342.314) (-1338.343) * (-1332.456) (-1354.632) [-1332.113] (-1335.607) -- 0:00:23
911000 -- (-1343.397) [-1333.571] (-1345.088) (-1346.159) * (-1343.309) (-1333.562) [-1333.257] (-1336.621) -- 0:00:23
911500 -- (-1344.020) (-1345.828) [-1341.233] (-1336.482) * [-1332.992] (-1343.920) (-1344.471) (-1338.936) -- 0:00:23
912000 -- (-1338.844) (-1334.319) [-1331.467] (-1336.064) * (-1338.896) [-1328.156] (-1339.396) (-1340.869) -- 0:00:23
912500 -- (-1351.105) [-1335.994] (-1342.240) (-1339.581) * (-1341.939) (-1332.496) [-1340.269] (-1340.818) -- 0:00:23
913000 -- (-1335.973) [-1330.368] (-1336.506) (-1341.770) * (-1342.408) (-1334.445) [-1341.289] (-1344.002) -- 0:00:22
913500 -- [-1335.400] (-1338.018) (-1335.830) (-1342.420) * (-1344.598) [-1337.991] (-1348.258) (-1346.393) -- 0:00:22
914000 -- [-1331.401] (-1340.292) (-1348.280) (-1336.054) * (-1338.347) [-1338.735] (-1343.612) (-1330.145) -- 0:00:22
914500 -- (-1340.261) (-1343.190) (-1343.290) [-1339.670] * [-1336.219] (-1335.807) (-1342.251) (-1333.103) -- 0:00:22
915000 -- (-1339.616) (-1340.878) (-1351.622) [-1347.986] * [-1342.121] (-1337.310) (-1349.042) (-1342.769) -- 0:00:22
Average standard deviation of split frequencies: 0.009521
915500 -- (-1332.646) (-1341.628) [-1330.900] (-1339.816) * (-1335.926) (-1334.430) [-1336.327] (-1340.255) -- 0:00:22
916000 -- (-1340.278) (-1331.645) [-1334.367] (-1337.059) * (-1337.337) (-1342.154) (-1348.845) [-1339.782] -- 0:00:22
916500 -- [-1333.703] (-1340.692) (-1331.497) (-1341.787) * (-1334.869) (-1340.588) (-1346.507) [-1347.455] -- 0:00:22
917000 -- (-1344.589) [-1331.669] (-1333.750) (-1332.359) * (-1337.457) [-1331.934] (-1339.213) (-1347.183) -- 0:00:21
917500 -- (-1338.015) (-1344.598) [-1334.162] (-1336.772) * (-1352.259) [-1330.389] (-1345.891) (-1337.206) -- 0:00:21
918000 -- (-1342.627) [-1328.165] (-1335.665) (-1343.926) * (-1335.193) [-1332.148] (-1350.672) (-1331.695) -- 0:00:21
918500 -- (-1339.779) [-1334.224] (-1341.987) (-1342.753) * (-1339.774) (-1345.070) (-1347.348) [-1340.950] -- 0:00:21
919000 -- (-1331.418) (-1339.845) (-1338.530) [-1341.492] * [-1333.972] (-1336.767) (-1340.264) (-1355.381) -- 0:00:21
919500 -- [-1332.726] (-1330.204) (-1347.444) (-1343.418) * (-1341.700) [-1336.476] (-1337.269) (-1344.591) -- 0:00:21
920000 -- (-1342.061) (-1330.582) [-1345.516] (-1339.016) * [-1329.690] (-1339.113) (-1340.965) (-1354.796) -- 0:00:21
Average standard deviation of split frequencies: 0.009472
920500 -- (-1344.880) [-1339.117] (-1336.696) (-1343.756) * (-1341.534) [-1337.023] (-1346.613) (-1352.094) -- 0:00:20
921000 -- (-1339.850) (-1345.620) [-1334.373] (-1345.374) * (-1350.006) (-1341.164) [-1336.370] (-1347.140) -- 0:00:20
921500 -- (-1338.829) (-1348.577) [-1339.911] (-1356.597) * [-1335.264] (-1332.263) (-1341.719) (-1345.251) -- 0:00:20
922000 -- (-1347.032) [-1333.973] (-1349.480) (-1341.366) * [-1331.772] (-1330.579) (-1343.097) (-1351.519) -- 0:00:20
922500 -- (-1333.946) (-1340.147) [-1335.748] (-1342.017) * (-1340.240) (-1334.228) [-1343.010] (-1350.557) -- 0:00:20
923000 -- (-1344.627) (-1336.675) (-1339.385) [-1336.640] * (-1341.159) [-1336.763] (-1334.756) (-1341.352) -- 0:00:20
923500 -- (-1336.841) (-1340.905) [-1334.954] (-1333.418) * (-1335.615) [-1327.914] (-1341.692) (-1344.500) -- 0:00:20
924000 -- [-1332.196] (-1346.806) (-1339.140) (-1354.528) * (-1347.373) (-1338.760) (-1348.048) [-1338.568] -- 0:00:20
924500 -- [-1333.782] (-1356.515) (-1341.384) (-1339.135) * (-1354.954) [-1336.453] (-1346.309) (-1337.782) -- 0:00:19
925000 -- [-1332.860] (-1360.602) (-1340.721) (-1331.485) * (-1359.519) [-1336.476] (-1344.728) (-1339.928) -- 0:00:19
Average standard deviation of split frequencies: 0.008965
925500 -- (-1324.517) (-1343.470) [-1343.052] (-1339.800) * (-1354.159) (-1334.229) (-1348.185) [-1332.536] -- 0:00:19
926000 -- (-1337.256) (-1346.828) (-1332.463) [-1333.428] * (-1340.855) [-1335.802] (-1342.668) (-1337.508) -- 0:00:19
926500 -- (-1341.516) (-1345.794) (-1340.247) [-1339.000] * (-1348.427) (-1328.535) (-1347.282) [-1340.947] -- 0:00:19
927000 -- [-1334.405] (-1338.022) (-1339.309) (-1341.719) * (-1335.578) (-1343.500) [-1345.265] (-1363.869) -- 0:00:19
927500 -- (-1342.458) (-1338.411) (-1335.516) [-1333.168] * (-1340.585) [-1334.144] (-1333.876) (-1343.156) -- 0:00:19
928000 -- (-1344.272) (-1346.588) (-1331.676) [-1334.520] * (-1337.567) [-1331.885] (-1337.969) (-1353.899) -- 0:00:19
928500 -- [-1341.721] (-1335.737) (-1328.493) (-1337.976) * (-1346.062) (-1337.100) [-1341.363] (-1337.914) -- 0:00:18
929000 -- (-1343.250) [-1333.239] (-1333.585) (-1343.003) * (-1346.771) (-1333.088) [-1338.596] (-1340.871) -- 0:00:18
929500 -- (-1353.349) (-1333.553) (-1335.465) [-1345.001] * [-1334.030] (-1342.518) (-1337.206) (-1344.552) -- 0:00:18
930000 -- [-1338.833] (-1341.141) (-1337.579) (-1343.803) * (-1330.080) [-1334.960] (-1329.158) (-1343.938) -- 0:00:18
Average standard deviation of split frequencies: 0.009033
930500 -- (-1348.276) (-1348.610) (-1335.177) [-1333.011] * [-1328.308] (-1351.185) (-1342.766) (-1340.148) -- 0:00:18
931000 -- [-1335.349] (-1344.655) (-1345.362) (-1347.320) * (-1342.321) [-1337.308] (-1345.574) (-1330.665) -- 0:00:18
931500 -- (-1339.716) (-1334.138) [-1330.139] (-1351.471) * (-1332.563) (-1340.523) (-1346.907) [-1334.856] -- 0:00:18
932000 -- (-1345.651) [-1332.884] (-1336.138) (-1348.827) * [-1331.903] (-1331.171) (-1347.230) (-1341.731) -- 0:00:17
932500 -- (-1341.041) [-1328.067] (-1334.934) (-1336.911) * (-1338.152) (-1340.869) [-1350.385] (-1339.729) -- 0:00:17
933000 -- (-1339.474) (-1333.973) [-1344.789] (-1333.024) * [-1331.337] (-1343.211) (-1329.741) (-1337.301) -- 0:00:17
933500 -- (-1344.997) [-1341.557] (-1332.478) (-1343.876) * [-1334.695] (-1348.659) (-1335.966) (-1349.261) -- 0:00:17
934000 -- (-1342.997) [-1338.938] (-1336.061) (-1348.383) * (-1346.789) [-1338.991] (-1352.810) (-1342.947) -- 0:00:17
934500 -- (-1334.466) (-1341.326) (-1330.708) [-1335.203] * (-1338.419) (-1342.654) (-1336.455) [-1337.825] -- 0:00:17
935000 -- [-1334.272] (-1342.063) (-1338.648) (-1341.390) * (-1330.591) [-1338.530] (-1336.492) (-1343.665) -- 0:00:17
Average standard deviation of split frequencies: 0.008898
935500 -- [-1335.024] (-1339.286) (-1342.060) (-1331.303) * (-1342.473) (-1336.068) [-1336.739] (-1347.703) -- 0:00:17
936000 -- (-1343.075) [-1333.887] (-1350.177) (-1345.194) * (-1344.141) (-1332.996) (-1333.151) [-1325.375] -- 0:00:16
936500 -- [-1348.031] (-1336.433) (-1335.038) (-1352.235) * (-1333.266) (-1336.863) (-1353.681) [-1340.580] -- 0:00:16
937000 -- (-1340.211) [-1330.697] (-1330.809) (-1337.776) * (-1337.688) [-1335.284] (-1337.039) (-1343.385) -- 0:00:16
937500 -- [-1339.271] (-1352.349) (-1341.103) (-1345.917) * (-1344.469) (-1342.425) [-1335.760] (-1341.670) -- 0:00:16
938000 -- [-1330.191] (-1347.173) (-1336.874) (-1345.628) * (-1349.354) [-1341.583] (-1338.559) (-1348.280) -- 0:00:16
938500 -- (-1334.430) (-1337.171) [-1332.929] (-1333.903) * (-1356.847) [-1335.711] (-1334.973) (-1343.536) -- 0:00:16
939000 -- [-1332.485] (-1346.974) (-1334.484) (-1333.528) * (-1352.374) [-1335.050] (-1332.962) (-1340.276) -- 0:00:16
939500 -- (-1343.604) [-1335.025] (-1334.032) (-1341.199) * (-1339.932) (-1333.947) [-1337.152] (-1344.615) -- 0:00:15
940000 -- (-1344.121) [-1337.136] (-1338.081) (-1326.345) * (-1334.205) (-1337.304) (-1337.357) [-1336.770] -- 0:00:15
Average standard deviation of split frequencies: 0.009160
940500 -- [-1333.877] (-1337.039) (-1345.915) (-1336.544) * [-1337.165] (-1348.584) (-1338.761) (-1334.488) -- 0:00:15
941000 -- [-1339.190] (-1338.763) (-1345.503) (-1331.835) * (-1352.019) (-1340.783) [-1337.472] (-1336.576) -- 0:00:15
941500 -- (-1342.197) (-1337.869) [-1329.654] (-1341.879) * (-1340.786) (-1346.800) (-1332.436) [-1339.371] -- 0:00:15
942000 -- (-1351.083) (-1335.573) (-1353.375) [-1329.709] * (-1345.222) (-1332.102) [-1337.664] (-1335.887) -- 0:00:15
942500 -- (-1340.540) (-1339.280) [-1336.666] (-1344.747) * (-1345.143) (-1340.923) (-1343.723) [-1340.284] -- 0:00:15
943000 -- (-1330.633) (-1350.918) [-1340.303] (-1335.990) * (-1337.884) (-1337.931) (-1338.782) [-1331.090] -- 0:00:15
943500 -- [-1337.059] (-1336.985) (-1333.078) (-1343.331) * (-1347.336) (-1332.480) [-1336.067] (-1333.728) -- 0:00:14
944000 -- (-1339.850) (-1340.784) [-1335.104] (-1341.094) * (-1347.225) [-1334.171] (-1337.292) (-1334.717) -- 0:00:14
944500 -- (-1335.180) (-1340.963) [-1332.038] (-1353.336) * (-1341.518) (-1331.889) [-1339.400] (-1343.265) -- 0:00:14
945000 -- (-1342.271) (-1338.951) [-1335.112] (-1346.012) * (-1342.647) (-1343.513) (-1336.997) [-1336.081] -- 0:00:14
Average standard deviation of split frequencies: 0.008914
945500 -- (-1338.119) (-1343.992) (-1340.030) [-1336.798] * (-1349.949) (-1336.674) [-1344.641] (-1344.000) -- 0:00:14
946000 -- (-1336.384) (-1340.927) [-1334.204] (-1345.014) * (-1336.049) (-1337.872) [-1335.449] (-1337.109) -- 0:00:14
946500 -- [-1334.676] (-1336.466) (-1333.905) (-1341.517) * (-1340.284) (-1347.760) (-1336.061) [-1338.301] -- 0:00:14
947000 -- (-1343.679) (-1337.108) [-1339.070] (-1333.859) * (-1336.935) (-1339.125) [-1336.138] (-1337.979) -- 0:00:13
947500 -- (-1334.847) [-1336.372] (-1333.562) (-1333.932) * (-1329.434) [-1336.666] (-1341.237) (-1340.502) -- 0:00:13
948000 -- [-1341.287] (-1349.058) (-1351.122) (-1330.522) * (-1336.685) (-1338.758) [-1343.025] (-1340.153) -- 0:00:13
948500 -- (-1336.703) [-1341.573] (-1330.215) (-1338.183) * (-1344.680) (-1335.722) [-1346.529] (-1346.912) -- 0:00:13
949000 -- (-1345.025) (-1344.500) [-1335.357] (-1333.889) * (-1340.809) (-1339.200) [-1337.496] (-1335.061) -- 0:00:13
949500 -- (-1327.965) (-1342.615) (-1340.465) [-1334.963] * (-1339.168) (-1354.251) (-1332.810) [-1335.818] -- 0:00:13
950000 -- (-1333.650) (-1334.862) (-1346.824) [-1324.271] * (-1340.526) (-1344.482) (-1337.190) [-1330.011] -- 0:00:13
Average standard deviation of split frequencies: 0.009091
950500 -- (-1344.969) (-1339.939) [-1341.614] (-1339.896) * (-1347.346) [-1339.853] (-1348.969) (-1345.825) -- 0:00:13
951000 -- (-1344.378) (-1343.660) [-1343.376] (-1343.800) * [-1336.180] (-1352.158) (-1343.338) (-1342.079) -- 0:00:12
951500 -- (-1339.319) (-1336.691) (-1341.824) [-1328.944] * (-1343.870) [-1340.889] (-1341.199) (-1337.993) -- 0:00:12
952000 -- (-1331.829) (-1335.088) (-1335.873) [-1328.958] * (-1339.411) (-1338.263) [-1340.751] (-1343.783) -- 0:00:12
952500 -- (-1333.604) [-1340.181] (-1337.494) (-1332.791) * (-1337.660) (-1338.996) [-1336.087] (-1336.502) -- 0:00:12
953000 -- [-1342.732] (-1340.441) (-1356.116) (-1339.696) * [-1332.715] (-1335.563) (-1340.498) (-1332.957) -- 0:00:12
953500 -- (-1334.974) (-1346.244) (-1354.389) [-1329.207] * (-1340.394) (-1342.690) [-1336.151] (-1337.923) -- 0:00:12
954000 -- [-1337.333] (-1332.064) (-1343.856) (-1345.848) * [-1333.384] (-1336.629) (-1343.428) (-1337.035) -- 0:00:12
954500 -- (-1335.759) [-1335.649] (-1330.950) (-1345.108) * (-1341.723) [-1334.524] (-1337.258) (-1345.457) -- 0:00:12
955000 -- [-1337.790] (-1340.734) (-1338.284) (-1347.390) * [-1342.929] (-1339.727) (-1339.267) (-1343.609) -- 0:00:11
Average standard deviation of split frequencies: 0.008931
955500 -- (-1333.703) (-1342.761) [-1333.026] (-1343.338) * (-1349.962) (-1335.053) [-1328.235] (-1337.406) -- 0:00:11
956000 -- (-1341.698) (-1340.824) (-1331.581) [-1336.561] * (-1360.117) (-1330.652) [-1331.067] (-1335.668) -- 0:00:11
956500 -- (-1347.885) (-1336.220) (-1344.353) [-1338.923] * (-1345.993) [-1334.276] (-1336.554) (-1336.819) -- 0:00:11
957000 -- (-1350.128) (-1332.153) (-1332.285) [-1330.863] * (-1345.046) (-1335.954) [-1329.692] (-1337.707) -- 0:00:11
957500 -- (-1346.113) (-1338.873) (-1335.656) [-1339.412] * (-1338.562) [-1334.464] (-1327.572) (-1347.237) -- 0:00:11
958000 -- (-1336.441) (-1347.718) [-1336.456] (-1338.363) * [-1336.727] (-1337.418) (-1342.579) (-1338.505) -- 0:00:11
958500 -- (-1327.191) (-1345.707) [-1337.164] (-1347.004) * (-1338.284) [-1330.451] (-1333.701) (-1342.698) -- 0:00:10
959000 -- [-1334.874] (-1343.162) (-1348.530) (-1347.977) * (-1339.938) (-1335.340) [-1340.215] (-1341.963) -- 0:00:10
959500 -- (-1338.856) (-1342.261) [-1335.155] (-1335.366) * (-1343.118) [-1338.805] (-1356.749) (-1339.339) -- 0:00:10
960000 -- (-1336.251) (-1331.111) (-1344.490) [-1344.014] * (-1349.851) [-1339.302] (-1336.750) (-1342.562) -- 0:00:10
Average standard deviation of split frequencies: 0.008778
960500 -- (-1340.587) [-1332.461] (-1343.629) (-1335.868) * (-1341.559) [-1336.754] (-1340.220) (-1337.819) -- 0:00:10
961000 -- (-1337.118) [-1330.551] (-1334.035) (-1342.949) * (-1333.920) [-1340.061] (-1343.001) (-1336.263) -- 0:00:10
961500 -- (-1344.828) [-1342.729] (-1335.577) (-1337.227) * [-1337.446] (-1332.634) (-1340.022) (-1354.099) -- 0:00:10
962000 -- [-1337.525] (-1337.642) (-1345.359) (-1336.537) * (-1340.583) (-1337.609) (-1342.015) [-1336.161] -- 0:00:09
962500 -- [-1341.741] (-1340.987) (-1341.729) (-1342.236) * (-1344.562) (-1336.900) [-1333.814] (-1341.821) -- 0:00:09
963000 -- (-1355.708) (-1332.621) [-1330.102] (-1338.080) * (-1343.396) (-1333.074) (-1351.016) [-1332.874] -- 0:00:09
963500 -- [-1330.872] (-1340.905) (-1351.414) (-1339.405) * [-1336.525] (-1335.985) (-1344.402) (-1350.641) -- 0:00:09
964000 -- (-1342.657) [-1344.699] (-1343.014) (-1334.966) * (-1338.727) [-1336.448] (-1340.969) (-1352.302) -- 0:00:09
964500 -- [-1332.667] (-1338.946) (-1343.802) (-1339.612) * (-1339.607) [-1334.473] (-1334.683) (-1344.505) -- 0:00:09
965000 -- (-1347.176) [-1332.723] (-1333.867) (-1341.242) * [-1337.110] (-1333.190) (-1342.326) (-1345.586) -- 0:00:09
Average standard deviation of split frequencies: 0.008377
965500 -- (-1337.210) [-1330.963] (-1337.402) (-1342.685) * (-1339.222) [-1338.742] (-1338.651) (-1354.079) -- 0:00:09
966000 -- (-1347.706) (-1336.716) [-1329.969] (-1345.899) * (-1350.064) [-1336.407] (-1342.813) (-1337.533) -- 0:00:08
966500 -- (-1344.243) (-1331.503) [-1327.490] (-1339.684) * (-1333.785) [-1337.545] (-1332.738) (-1335.680) -- 0:00:08
967000 -- (-1339.010) [-1334.020] (-1345.451) (-1337.940) * (-1338.040) (-1337.148) [-1329.652] (-1352.575) -- 0:00:08
967500 -- [-1331.733] (-1350.665) (-1340.072) (-1351.272) * (-1338.276) [-1342.910] (-1342.122) (-1336.472) -- 0:00:08
968000 -- [-1342.929] (-1336.988) (-1335.417) (-1355.061) * (-1337.220) (-1336.671) [-1338.574] (-1328.236) -- 0:00:08
968500 -- [-1334.938] (-1346.636) (-1345.773) (-1334.579) * (-1337.498) (-1343.323) (-1336.497) [-1334.829] -- 0:00:08
969000 -- [-1336.540] (-1331.263) (-1347.313) (-1343.857) * (-1338.861) (-1330.544) (-1352.962) [-1335.202] -- 0:00:08
969500 -- (-1337.050) (-1340.037) [-1342.660] (-1336.217) * [-1331.843] (-1345.909) (-1339.424) (-1337.550) -- 0:00:08
970000 -- (-1333.490) (-1348.909) (-1336.051) [-1336.842] * (-1345.039) (-1340.177) [-1335.670] (-1336.581) -- 0:00:07
Average standard deviation of split frequencies: 0.008175
970500 -- (-1343.129) [-1334.357] (-1336.278) (-1339.137) * [-1339.896] (-1336.989) (-1339.186) (-1338.806) -- 0:00:07
971000 -- (-1339.582) (-1342.620) [-1328.533] (-1335.234) * (-1343.114) (-1338.141) [-1336.298] (-1346.703) -- 0:00:07
971500 -- (-1337.489) [-1331.467] (-1339.912) (-1337.008) * (-1337.900) [-1329.607] (-1335.695) (-1347.367) -- 0:00:07
972000 -- (-1339.427) [-1331.674] (-1353.216) (-1338.874) * (-1345.615) [-1336.932] (-1336.700) (-1350.845) -- 0:00:07
972500 -- (-1335.892) (-1331.644) (-1326.143) [-1337.273] * (-1335.349) (-1336.287) [-1333.783] (-1339.490) -- 0:00:07
973000 -- (-1340.737) (-1330.584) (-1329.137) [-1335.564] * [-1338.526] (-1342.545) (-1333.879) (-1336.846) -- 0:00:07
973500 -- (-1334.500) (-1335.513) [-1332.533] (-1338.973) * (-1343.442) [-1329.462] (-1336.634) (-1342.581) -- 0:00:06
974000 -- [-1343.460] (-1353.022) (-1340.501) (-1337.583) * (-1328.090) (-1336.480) (-1336.682) [-1335.281] -- 0:00:06
974500 -- (-1342.954) (-1345.400) [-1334.775] (-1340.006) * (-1332.991) (-1333.336) (-1345.011) [-1341.909] -- 0:00:06
975000 -- (-1335.663) [-1333.618] (-1346.082) (-1348.117) * [-1333.759] (-1343.036) (-1336.286) (-1343.724) -- 0:00:06
Average standard deviation of split frequencies: 0.007969
975500 -- (-1334.297) (-1332.885) [-1334.542] (-1341.231) * (-1331.928) (-1336.612) [-1329.933] (-1345.036) -- 0:00:06
976000 -- (-1343.692) (-1335.644) (-1329.656) [-1339.457] * [-1336.403] (-1333.131) (-1339.187) (-1330.364) -- 0:00:06
976500 -- [-1347.696] (-1342.630) (-1338.415) (-1337.224) * [-1336.524] (-1340.111) (-1344.338) (-1336.415) -- 0:00:06
977000 -- [-1338.609] (-1332.094) (-1343.238) (-1348.724) * [-1336.574] (-1342.514) (-1338.933) (-1342.048) -- 0:00:06
977500 -- (-1342.906) (-1339.882) [-1341.519] (-1338.890) * (-1338.099) (-1337.286) (-1344.707) [-1339.939] -- 0:00:05
978000 -- (-1342.508) [-1340.086] (-1344.373) (-1337.876) * (-1343.645) (-1339.602) [-1332.922] (-1345.234) -- 0:00:05
978500 -- (-1342.208) (-1347.674) [-1333.900] (-1341.513) * (-1333.512) [-1338.350] (-1350.786) (-1342.582) -- 0:00:05
979000 -- (-1341.335) (-1343.513) (-1336.773) [-1334.234] * (-1337.283) [-1335.862] (-1337.083) (-1351.809) -- 0:00:05
979500 -- [-1332.294] (-1346.908) (-1332.044) (-1338.713) * [-1336.907] (-1341.790) (-1352.218) (-1348.667) -- 0:00:05
980000 -- (-1340.557) (-1347.602) [-1337.626] (-1342.496) * (-1349.304) [-1330.537] (-1335.168) (-1346.398) -- 0:00:05
Average standard deviation of split frequencies: 0.007504
980500 -- (-1349.198) [-1340.368] (-1336.296) (-1336.054) * [-1339.993] (-1339.459) (-1337.347) (-1345.031) -- 0:00:05
981000 -- (-1340.645) [-1342.689] (-1337.469) (-1335.102) * [-1339.431] (-1334.319) (-1339.369) (-1336.767) -- 0:00:04
981500 -- (-1343.775) (-1352.862) (-1341.918) [-1338.837] * (-1353.486) (-1334.309) [-1333.244] (-1341.957) -- 0:00:04
982000 -- (-1339.551) (-1341.714) [-1336.920] (-1339.739) * (-1351.564) (-1337.287) (-1341.600) [-1337.525] -- 0:00:04
982500 -- (-1342.400) (-1347.535) [-1340.391] (-1343.012) * (-1342.168) (-1340.594) [-1338.007] (-1344.035) -- 0:00:04
983000 -- (-1340.122) (-1353.062) (-1336.348) [-1336.282] * (-1336.837) (-1338.184) [-1334.266] (-1346.392) -- 0:00:04
983500 -- (-1342.310) (-1343.777) [-1338.440] (-1334.301) * (-1339.640) (-1346.164) [-1344.106] (-1339.657) -- 0:00:04
984000 -- (-1340.783) [-1333.886] (-1330.907) (-1347.259) * (-1341.305) [-1330.703] (-1342.860) (-1338.233) -- 0:00:04
984500 -- [-1339.224] (-1340.170) (-1337.172) (-1341.437) * (-1353.981) [-1336.465] (-1330.335) (-1336.173) -- 0:00:04
985000 -- (-1340.312) [-1337.094] (-1347.668) (-1341.840) * (-1346.785) (-1325.834) [-1334.171] (-1340.882) -- 0:00:03
Average standard deviation of split frequencies: 0.007782
985500 -- [-1332.776] (-1349.125) (-1342.633) (-1330.587) * (-1346.476) (-1352.427) (-1337.418) [-1340.084] -- 0:00:03
986000 -- (-1340.980) (-1347.901) [-1331.203] (-1347.161) * (-1347.860) (-1338.773) [-1330.341] (-1353.348) -- 0:00:03
986500 -- (-1346.355) [-1341.903] (-1336.666) (-1349.149) * (-1348.383) [-1334.302] (-1334.426) (-1335.575) -- 0:00:03
987000 -- (-1350.342) [-1329.677] (-1336.144) (-1344.656) * (-1348.227) (-1342.818) (-1341.442) [-1346.296] -- 0:00:03
987500 -- (-1347.861) (-1339.727) (-1337.130) [-1332.379] * (-1349.627) [-1344.054] (-1338.954) (-1343.500) -- 0:00:03
988000 -- (-1340.757) [-1334.279] (-1350.483) (-1350.147) * (-1334.026) [-1336.749] (-1341.903) (-1340.308) -- 0:00:03
988500 -- (-1332.559) (-1335.881) (-1343.775) [-1343.285] * [-1328.792] (-1328.490) (-1341.650) (-1341.929) -- 0:00:03
989000 -- (-1358.781) [-1335.384] (-1337.400) (-1343.947) * [-1336.570] (-1347.410) (-1342.157) (-1336.387) -- 0:00:02
989500 -- (-1343.808) [-1329.122] (-1347.410) (-1342.955) * [-1333.440] (-1335.518) (-1337.683) (-1345.232) -- 0:00:02
990000 -- (-1334.581) [-1332.706] (-1346.821) (-1345.084) * (-1342.637) (-1343.752) (-1346.889) [-1335.938] -- 0:00:02
Average standard deviation of split frequencies: 0.007666
990500 -- (-1339.042) [-1332.800] (-1347.675) (-1328.459) * (-1343.228) (-1340.387) (-1348.221) [-1347.031] -- 0:00:02
991000 -- (-1339.651) (-1342.413) (-1338.712) [-1342.221] * (-1345.927) [-1337.893] (-1350.646) (-1335.729) -- 0:00:02
991500 -- [-1341.277] (-1343.175) (-1331.835) (-1342.045) * (-1336.793) [-1333.374] (-1337.193) (-1338.418) -- 0:00:02
992000 -- (-1343.951) (-1338.498) [-1340.726] (-1342.883) * (-1354.761) [-1336.092] (-1341.781) (-1336.909) -- 0:00:02
992500 -- (-1339.965) [-1334.068] (-1328.563) (-1340.582) * (-1338.691) [-1329.979] (-1349.077) (-1328.689) -- 0:00:01
993000 -- (-1340.783) [-1337.800] (-1333.529) (-1335.351) * (-1344.859) [-1337.546] (-1340.036) (-1328.615) -- 0:00:01
993500 -- [-1329.320] (-1350.308) (-1332.451) (-1347.893) * [-1337.898] (-1355.313) (-1339.859) (-1338.286) -- 0:00:01
994000 -- (-1340.187) (-1340.635) (-1329.297) [-1337.208] * (-1339.119) (-1350.168) [-1343.318] (-1330.858) -- 0:00:01
994500 -- [-1332.641] (-1339.776) (-1344.439) (-1336.623) * (-1341.837) (-1348.952) (-1340.781) [-1334.931] -- 0:00:01
995000 -- (-1335.852) (-1349.568) [-1329.881] (-1332.182) * (-1331.421) (-1341.497) [-1341.980] (-1340.010) -- 0:00:01
Average standard deviation of split frequencies: 0.007047
995500 -- (-1344.802) (-1337.108) [-1338.201] (-1343.573) * (-1342.783) (-1335.752) (-1341.250) [-1329.443] -- 0:00:01
996000 -- (-1353.157) [-1328.597] (-1344.198) (-1338.788) * (-1329.769) (-1345.961) (-1337.195) [-1334.734] -- 0:00:01
996500 -- (-1347.411) (-1338.729) (-1337.658) [-1339.558] * (-1331.203) (-1335.631) (-1338.543) [-1329.216] -- 0:00:00
997000 -- [-1334.467] (-1343.126) (-1335.818) (-1348.838) * [-1333.423] (-1342.221) (-1334.963) (-1338.953) -- 0:00:00
997500 -- (-1346.113) [-1340.665] (-1348.409) (-1334.205) * (-1337.397) (-1341.216) [-1334.058] (-1346.695) -- 0:00:00
998000 -- (-1349.162) [-1336.587] (-1342.947) (-1334.730) * (-1348.392) (-1341.826) [-1329.873] (-1339.511) -- 0:00:00
998500 -- (-1345.323) [-1331.964] (-1340.309) (-1333.671) * (-1337.103) (-1342.035) (-1348.033) [-1339.953] -- 0:00:00
999000 -- (-1338.622) (-1338.984) (-1339.167) [-1337.334] * (-1344.305) [-1340.547] (-1341.593) (-1336.801) -- 0:00:00
999500 -- (-1339.909) (-1341.675) [-1339.081] (-1334.014) * (-1339.309) (-1336.000) (-1331.521) [-1338.236] -- 0:00:00
1000000 -- (-1336.912) [-1336.969] (-1340.876) (-1334.110) * (-1339.024) (-1332.008) [-1335.324] (-1346.399) -- 0:00:00
Average standard deviation of split frequencies: 0.007328
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1336.912390 -- 20.036889
Chain 1 -- -1336.912403 -- 20.036889
Chain 2 -- -1336.969278 -- 18.697119
Chain 2 -- -1336.969287 -- 18.697119
Chain 3 -- -1340.876009 -- 19.350459
Chain 3 -- -1340.876014 -- 19.350459
Chain 4 -- -1334.110164 -- 21.134358
Chain 4 -- -1334.110161 -- 21.134358
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1339.023615 -- 18.797790
Chain 1 -- -1339.023606 -- 18.797790
Chain 2 -- -1332.008491 -- 20.096515
Chain 2 -- -1332.008497 -- 20.096515
Chain 3 -- -1335.323665 -- 17.062755
Chain 3 -- -1335.323676 -- 17.062755
Chain 4 -- -1346.399366 -- 21.000826
Chain 4 -- -1346.399364 -- 21.000826
Analysis completed in 4 mins 23 seconds
Analysis used 262.99 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1321.49
Likelihood of best state for "cold" chain of run 2 was -1321.03
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
55.8 % ( 50 %) Dirichlet(Revmat{all})
70.8 % ( 48 %) Slider(Revmat{all})
29.3 % ( 34 %) Dirichlet(Pi{all})
31.1 % ( 33 %) Slider(Pi{all})
33.3 % ( 24 %) Multiplier(Alpha{1,2})
44.3 % ( 23 %) Multiplier(Alpha{3})
48.2 % ( 32 %) Slider(Pinvar{all})
22.7 % ( 22 %) ExtSPR(Tau{all},V{all})
8.3 % ( 10 %) ExtTBR(Tau{all},V{all})
28.2 % ( 33 %) NNI(Tau{all},V{all})
23.8 % ( 32 %) ParsSPR(Tau{all},V{all})
26.8 % ( 33 %) Multiplier(V{all})
46.6 % ( 51 %) Nodeslider(V{all})
25.9 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
56.1 % ( 48 %) Dirichlet(Revmat{all})
71.1 % ( 52 %) Slider(Revmat{all})
29.3 % ( 27 %) Dirichlet(Pi{all})
31.2 % ( 29 %) Slider(Pi{all})
33.4 % ( 25 %) Multiplier(Alpha{1,2})
44.2 % ( 23 %) Multiplier(Alpha{3})
48.2 % ( 27 %) Slider(Pinvar{all})
22.8 % ( 27 %) ExtSPR(Tau{all},V{all})
8.2 % ( 10 %) ExtTBR(Tau{all},V{all})
28.3 % ( 20 %) NNI(Tau{all},V{all})
23.8 % ( 22 %) ParsSPR(Tau{all},V{all})
26.7 % ( 28 %) Multiplier(V{all})
46.7 % ( 50 %) Nodeslider(V{all})
25.9 % ( 21 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.73 0.52 0.35
2 | 166019 0.76 0.55
3 | 166688 166927 0.77
4 | 166782 166867 166717
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 165506 0.76 0.55
3 | 166541 167191 0.78
4 | 166631 167361 166770
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1334.42
| 12 2 12 |
| 1 1 1 1 |
| 1 2 2 1 |
| 2 2 1 2 1 1 2 |
|2 1 2 1 22 2 2 1 2 1 1 2 1|
| 1 *1 21 2 1 1 1 2 2 2 2 2 * |
| *1 2 12 1 1 2 1*2 2 1 1 1 2 22|
| 2 1 2 1 1 2 2 21 11 *2 1 1 |
| 2 2 1 2 2 1 2 1 1 2 |
|1 1 2 |
| 1 2 1 2 1 |
| 2 2 1 11 |
| 1 2 1 1 2 |
| 1 2 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1338.56
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1328.57 -1345.71
2 -1330.08 -1347.49
--------------------------------------
TOTAL -1329.06 -1346.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.812469 0.017083 0.565368 1.071394 0.803883 1099.72 1135.93 1.000
r(A<->C){all} 0.083050 0.000901 0.029370 0.143340 0.080460 854.59 862.69 1.003
r(A<->G){all} 0.270828 0.004037 0.149900 0.397122 0.265829 671.76 720.90 1.001
r(A<->T){all} 0.173790 0.004304 0.047417 0.298054 0.168000 502.53 586.54 1.003
r(C<->G){all} 0.090911 0.000634 0.042961 0.139420 0.088329 895.41 947.16 1.000
r(C<->T){all} 0.346649 0.003951 0.226859 0.468267 0.343580 669.28 674.70 1.000
r(G<->T){all} 0.034772 0.000495 0.000043 0.078070 0.030445 789.58 896.37 1.001
pi(A){all} 0.246511 0.000347 0.210823 0.283027 0.246598 840.23 974.44 1.002
pi(C){all} 0.295129 0.000386 0.259351 0.335633 0.294347 1219.06 1256.28 1.000
pi(G){all} 0.255968 0.000366 0.217506 0.293281 0.255881 992.63 1172.40 1.001
pi(T){all} 0.202392 0.000304 0.169267 0.236723 0.202540 1034.59 1085.09 1.000
alpha{1,2} 0.088100 0.000351 0.055710 0.128792 0.088032 1116.18 1138.74 1.000
alpha{3} 2.539638 0.687588 1.140779 4.174147 2.406027 1130.41 1242.44 1.000
pinvar{all} 0.540672 0.002673 0.429888 0.631966 0.542966 1029.46 1143.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ...********
13 -- .....******
14 -- .**........
15 -- ...**......
16 -- ......****.
17 -- .......**..
18 -- .....*....*
19 -- .......***.
20 -- .........**
21 -- .....**..**
22 -- ......*..*.
23 -- .....**.***
24 -- .....*****.
25 -- ......*****
26 -- .....*.*...
27 -- .......*.*.
28 -- ......***..
29 -- ......*.*..
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2999 0.999001 0.000471 0.998668 0.999334 2
13 2985 0.994337 0.000471 0.994004 0.994670 2
14 2959 0.985676 0.000471 0.985343 0.986009 2
15 2622 0.873418 0.000942 0.872751 0.874084 2
16 1416 0.471686 0.016959 0.459694 0.483678 2
17 1225 0.408061 0.008951 0.401732 0.414390 2
18 1121 0.373418 0.005182 0.369753 0.377082 2
19 767 0.255496 0.007066 0.250500 0.260493 2
20 599 0.199534 0.022141 0.183877 0.215190 2
21 545 0.181546 0.002355 0.179880 0.183211 2
22 513 0.170886 0.008951 0.164557 0.177215 2
23 485 0.161559 0.000471 0.161226 0.161892 2
24 449 0.149567 0.021199 0.134577 0.164557 2
25 440 0.146569 0.001884 0.145237 0.147901 2
26 393 0.130913 0.009893 0.123917 0.137908 2
27 342 0.113924 0.009422 0.107262 0.120586 2
28 317 0.105596 0.012719 0.096602 0.114590 2
29 309 0.102931 0.002355 0.101266 0.104597 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.024815 0.000153 0.004321 0.048949 0.022883 1.000 2
length{all}[2] 0.018598 0.000100 0.002557 0.038288 0.016916 1.000 2
length{all}[3] 0.009718 0.000055 0.000147 0.023873 0.007815 1.000 2
length{all}[4] 0.036951 0.000248 0.009476 0.067278 0.034497 1.000 2
length{all}[5] 0.040025 0.000272 0.012606 0.072573 0.037467 1.000 2
length{all}[6] 0.082508 0.000825 0.033387 0.141006 0.078914 1.000 2
length{all}[7] 0.053068 0.000442 0.015651 0.094872 0.050268 1.000 2
length{all}[8] 0.113822 0.001306 0.054226 0.187814 0.108892 1.000 2
length{all}[9] 0.106459 0.001193 0.046266 0.175287 0.101245 1.002 2
length{all}[10] 0.094560 0.001015 0.036444 0.157369 0.090441 1.001 2
length{all}[11] 0.056295 0.000494 0.018922 0.101881 0.052943 1.000 2
length{all}[12] 0.033235 0.000245 0.007893 0.063445 0.030966 1.000 2
length{all}[13] 0.050081 0.000484 0.012502 0.093715 0.046635 1.000 2
length{all}[14] 0.015860 0.000098 0.000432 0.034506 0.013906 1.000 2
length{all}[15] 0.016520 0.000128 0.000016 0.038029 0.014305 1.001 2
length{all}[16] 0.019550 0.000170 0.000307 0.044010 0.017260 0.999 2
length{all}[17] 0.021305 0.000284 0.000025 0.055551 0.017550 1.000 2
length{all}[18] 0.013306 0.000134 0.000004 0.035762 0.010060 1.001 2
length{all}[19] 0.015020 0.000143 0.000024 0.039526 0.011894 0.999 2
length{all}[20] 0.015996 0.000152 0.000116 0.039870 0.013142 0.998 2
length{all}[21] 0.020114 0.000163 0.001556 0.045575 0.017340 0.999 2
length{all}[22] 0.012119 0.000116 0.000041 0.032336 0.009083 0.998 2
length{all}[23] 0.024780 0.000352 0.000269 0.060579 0.020409 1.001 2
length{all}[24] 0.009080 0.000083 0.000020 0.025601 0.006503 0.998 2
length{all}[25] 0.008757 0.000078 0.000053 0.027129 0.006083 0.998 2
length{all}[26] 0.028890 0.000374 0.000005 0.063889 0.024861 1.000 2
length{all}[27] 0.011997 0.000155 0.000011 0.035522 0.008702 0.997 2
length{all}[28] 0.011652 0.000107 0.000008 0.032569 0.008068 1.008 2
length{all}[29] 0.012121 0.000120 0.000063 0.032558 0.009470 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007328
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.008
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /----------------------- C4 (4)
| /-----------87----------+
| | \----------------------- C5 (5)
| |
| | /----------------------- C6 (6)
|----------100---------+ |
| | |----------------------- C7 (7)
| | |
+ | |----------------------- C8 (8)
| \-----------99----------+
| |----------------------- C9 (9)
| |
| |----------------------- C10 (10)
| |
| \----------------------- C11 (11)
|
| /----------------------- C2 (2)
\----------------------99----------------------+
\----------------------- C3 (3)
Phylogram (based on average branch lengths):
/--------- C1 (1)
|
| /-------------- C4 (4)
| /----+
| | \--------------- C5 (5)
| |
| | /------------------------------ C6 (6)
|-----------+ |
| | |------------------- C7 (7)
| | |
+ | |------------------------------------------ C8 (8)
| \-----------------+
| |--------------------------------------- C9 (9)
| |
| |----------------------------------- C10 (10)
| |
| \-------------------- C11 (11)
|
| /------- C2 (2)
\----+
\--- C3 (3)
|------------------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (628 trees sampled):
50 % credible set contains 41 trees
90 % credible set contains 328 trees
95 % credible set contains 478 trees
99 % credible set contains 598 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 489
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sites with gaps or missing data are removed.
39 ambiguity characters in seq. 10
13 sites are removed. 151 152 153 154 155 156 157 158 159 160 161 162 163
Sequences read..
Counting site patterns.. 0:00
93 patterns at 150 / 150 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
90768 bytes for conP
12648 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
226920 bytes for conP, adjusted
0.030386 0.030766 0.017633 0.040885 0.043949 0.043596 0.087485 0.056398 0.121283 0.113501 0.100573 0.078535 0.012040 0.013141 0.013940 0.300000 1.300000
ntime & nrate & np: 15 2 17
Bounds (np=17):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 17
lnL0 = -1412.514379
Iterating by ming2
Initial: fx= 1412.514379
x= 0.03039 0.03077 0.01763 0.04088 0.04395 0.04360 0.08749 0.05640 0.12128 0.11350 0.10057 0.07854 0.01204 0.01314 0.01394 0.30000 1.30000
1 h-m-p 0.0000 0.0002 220.4900 ++YYYYYCCCCC 1407.092490 9 0.0002 37 | 0/17
2 h-m-p 0.0000 0.0006 925.3022 +YCCCC 1388.918039 4 0.0003 65 | 0/17
3 h-m-p 0.0001 0.0005 502.7429 +CCYCC 1370.585400 4 0.0005 94 | 0/17
4 h-m-p 0.0001 0.0006 1226.4519 +YCYCCCC 1343.696568 6 0.0005 125 | 0/17
5 h-m-p 0.0000 0.0000 4125.5344 +YCYCCC 1341.202714 5 0.0000 154 | 0/17
6 h-m-p 0.0001 0.0005 396.4654 +YYYYYYC 1327.356085 6 0.0004 181 | 0/17
7 h-m-p 0.0000 0.0002 862.6748 +CYC 1315.795343 2 0.0002 205 | 0/17
8 h-m-p 0.0000 0.0001 3519.7473 +YYCYCYCCC 1272.974954 8 0.0001 238 | 0/17
9 h-m-p 0.0000 0.0000 2329.4750 ++ 1267.742879 m 0.0000 258 | 0/17
10 h-m-p -0.0000 -0.0000 5020.8582
h-m-p: -8.41004919e-23 -4.20502460e-22 5.02085818e+03 1267.742879
.. | 0/17
11 h-m-p 0.0000 0.0002 9355.5648 YYCCCCC 1232.430749 6 0.0000 305 | 0/17
12 h-m-p 0.0000 0.0002 670.5262 +YYCYYCCC 1177.904401 7 0.0002 336 | 0/17
13 h-m-p 0.0000 0.0001 235.2975 ++ 1174.609303 m 0.0001 356 | 0/17
14 h-m-p 0.0000 0.0002 487.5522 +CYCCC 1166.546833 4 0.0002 384 | 0/17
15 h-m-p 0.0000 0.0000 1045.5672 +YYCCCCC 1161.976543 6 0.0000 415 | 0/17
16 h-m-p 0.0000 0.0001 319.7135 +CYCC 1159.442887 3 0.0001 441 | 0/17
17 h-m-p 0.0000 0.0001 1090.7093 +YYCYCCC 1154.584491 6 0.0001 471 | 0/17
18 h-m-p 0.0001 0.0004 82.3251 CCCC 1154.335229 3 0.0001 497 | 0/17
19 h-m-p 0.0003 0.0039 28.5235 YCCC 1154.142769 3 0.0005 522 | 0/17
20 h-m-p 0.0007 0.0034 15.1100 CCC 1154.122597 2 0.0002 546 | 0/17
21 h-m-p 0.0002 0.0059 14.5757 YC 1154.111317 1 0.0002 567 | 0/17
22 h-m-p 0.0003 0.0281 7.2681 +YC 1154.083818 1 0.0011 589 | 0/17
23 h-m-p 0.0017 0.0436 4.5450 CC 1154.042097 1 0.0022 611 | 0/17
24 h-m-p 0.0004 0.0152 26.9824 +CCCC 1153.783458 3 0.0021 638 | 0/17
25 h-m-p 0.0004 0.0064 132.2207 +CCCC 1152.665853 3 0.0018 665 | 0/17
26 h-m-p 0.0017 0.0087 86.5254 YYYC 1151.976066 3 0.0017 688 | 0/17
27 h-m-p 0.0304 0.1521 1.8965 YYC 1151.631138 2 0.0247 710 | 0/17
28 h-m-p 0.0011 0.0103 41.2112 +YYC 1150.411150 2 0.0041 733 | 0/17
29 h-m-p 0.7921 3.9605 0.1965 CYCC 1148.847118 3 0.8553 758 | 0/17
30 h-m-p 1.5935 7.9675 0.0628 YCCC 1148.448896 3 0.9076 800 | 0/17
31 h-m-p 1.6000 8.0000 0.0199 YCCC 1148.130427 3 0.8827 842 | 0/17
32 h-m-p 0.5023 5.6925 0.0350 +YYC 1147.734354 2 1.6943 882 | 0/17
33 h-m-p 1.6000 8.0000 0.0130 YCCC 1147.305229 3 3.1010 924 | 0/17
34 h-m-p 1.5531 8.0000 0.0259 +YC 1146.555511 1 3.8893 963 | 0/17
35 h-m-p 1.6000 8.0000 0.0422 CCCC 1145.802511 3 2.1581 1006 | 0/17
36 h-m-p 1.6000 8.0000 0.0280 YCCC 1145.105104 3 3.3109 1048 | 0/17
37 h-m-p 0.7845 3.9223 0.0181 +YCYCCC 1144.017767 5 2.2101 1094 | 0/17
38 h-m-p 0.6871 4.1362 0.0581 CCCCC 1143.760991 4 0.8580 1139 | 0/17
39 h-m-p 1.5219 8.0000 0.0328 YCC 1143.685571 2 1.0299 1179 | 0/17
40 h-m-p 1.6000 8.0000 0.0016 CCC 1143.665894 2 1.6703 1220 | 0/17
41 h-m-p 0.9302 8.0000 0.0028 CYC 1143.656768 2 0.9858 1260 | 0/17
42 h-m-p 1.6000 8.0000 0.0014 C 1143.647781 0 1.6254 1297 | 0/17
43 h-m-p 1.6000 8.0000 0.0008 CC 1143.646443 1 1.2981 1336 | 0/17
44 h-m-p 1.6000 8.0000 0.0005 Y 1143.646380 0 1.2383 1373 | 0/17
45 h-m-p 1.6000 8.0000 0.0002 Y 1143.646376 0 1.1975 1410 | 0/17
46 h-m-p 1.6000 8.0000 0.0001 Y 1143.646376 0 1.1841 1447 | 0/17
47 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 0/17
48 h-m-p 0.0142 7.1067 0.0038 ------------- | 0/17
49 h-m-p 0.0142 7.1067 0.0038 -------------
Out..
lnL = -1143.646376
1595 lfun, 1595 eigenQcodon, 23925 P(t)
Time used: 0:05
Model 1: NearlyNeutral
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
0.030386 0.030766 0.017633 0.040885 0.043949 0.043596 0.087485 0.056398 0.121283 0.113501 0.100573 0.078535 0.012040 0.013141 0.013940 1.464000 0.579915 0.172397
ntime & nrate & np: 15 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.943046
np = 18
lnL0 = -1254.638022
Iterating by ming2
Initial: fx= 1254.638022
x= 0.03039 0.03077 0.01763 0.04088 0.04395 0.04360 0.08749 0.05640 0.12128 0.11350 0.10057 0.07854 0.01204 0.01314 0.01394 1.46400 0.57992 0.17240
1 h-m-p 0.0000 0.0003 281.9593 +++ 1235.035306 m 0.0003 42 | 0/18
2 h-m-p 0.0000 0.0000 8074.8906 ++ 1172.797851 m 0.0000 81 | 1/18
3 h-m-p 0.0000 0.0002 1560.6220 CYCCCC 1161.000083 5 0.0001 129 | 0/18
4 h-m-p 0.0000 0.0000 1321841.4700 CCCC 1157.819517 3 0.0000 173 | 0/18
5 h-m-p 0.0006 0.0028 40.0868 +YCYCCC 1154.583039 5 0.0017 221 | 0/18
6 h-m-p 0.0003 0.0017 53.4217 +YYCCCC 1152.058882 5 0.0011 269 | 0/18
7 h-m-p 0.0001 0.0004 122.0732 +YYCCCC 1150.640071 5 0.0003 317 | 0/18
8 h-m-p 0.0003 0.0015 115.8134 +YYYCCC 1144.372023 5 0.0010 364 | 0/18
9 h-m-p 0.0000 0.0002 317.8867 +YYCCCC 1142.194425 5 0.0001 412 | 0/18
10 h-m-p 0.0006 0.0029 39.4603 CYCCC 1141.477347 4 0.0009 458 | 0/18
11 h-m-p 0.0002 0.0011 91.5886 YYYC 1141.198836 3 0.0002 500 | 0/18
12 h-m-p 0.0005 0.0029 40.2953 CCCCC 1140.943182 4 0.0006 547 | 0/18
13 h-m-p 0.0005 0.0025 31.1069 YCC 1140.876645 2 0.0003 589 | 0/18
14 h-m-p 0.0021 0.0809 3.8969 YC 1140.788632 1 0.0051 629 | 0/18
15 h-m-p 0.0047 0.0364 4.1909 CCCC 1140.616150 3 0.0053 674 | 0/18
16 h-m-p 0.0022 0.0332 10.0293 +YYYC 1139.509265 3 0.0082 717 | 0/18
17 h-m-p 0.0029 0.0143 22.7138 YCYCCC 1136.941985 5 0.0065 764 | 0/18
18 h-m-p 0.0036 0.0181 11.5214 CCC 1136.849989 2 0.0015 807 | 0/18
19 h-m-p 0.0520 1.2161 0.3241 +YC 1136.120161 1 0.1538 848 | 0/18
20 h-m-p 0.0022 0.0112 18.5506 YYYY 1135.556669 3 0.0022 890 | 0/18
21 h-m-p 0.0189 0.8085 2.1887 +CCCC 1135.019998 3 0.1222 936 | 0/18
22 h-m-p 0.5869 2.9344 0.1748 CCC 1134.186591 2 0.7935 979 | 0/18
23 h-m-p 1.0320 5.1600 0.0355 CYCCC 1133.542787 4 0.9141 1025 | 0/18
24 h-m-p 0.4318 5.1419 0.0751 +YCCC 1132.686740 3 1.3033 1070 | 0/18
25 h-m-p 0.5876 2.9381 0.0314 YCCCC 1132.080194 4 1.2071 1116 | 0/18
26 h-m-p 0.3767 1.8835 0.0288 YCCCC 1131.761315 4 0.7024 1162 | 0/18
27 h-m-p 0.2671 6.6616 0.0757 +YCC 1131.588885 2 0.7840 1205 | 0/18
28 h-m-p 0.7328 7.4955 0.0810 CCC 1131.485559 2 0.6567 1248 | 0/18
29 h-m-p 1.6000 8.0000 0.0104 CCC 1131.415137 2 1.6299 1291 | 0/18
30 h-m-p 1.6000 8.0000 0.0085 CC 1131.309407 1 2.0218 1332 | 0/18
31 h-m-p 1.4082 8.0000 0.0122 CYC 1131.191234 2 1.6081 1374 | 0/18
32 h-m-p 1.6000 8.0000 0.0076 CC 1131.088884 1 1.4959 1415 | 0/18
33 h-m-p 0.9094 8.0000 0.0125 YC 1131.028184 1 1.6783 1455 | 0/18
34 h-m-p 1.6000 8.0000 0.0025 YC 1131.019458 1 1.1993 1495 | 0/18
35 h-m-p 1.6000 8.0000 0.0012 YC 1131.018370 1 0.7692 1535 | 0/18
36 h-m-p 0.6662 8.0000 0.0014 C 1131.018234 0 0.8031 1574 | 0/18
37 h-m-p 1.6000 8.0000 0.0002 Y 1131.018230 0 0.9924 1613 | 0/18
38 h-m-p 1.6000 8.0000 0.0000 Y 1131.018230 0 1.1053 1652 | 0/18
39 h-m-p 1.6000 8.0000 0.0000 Y 1131.018230 0 0.8314 1691 | 0/18
40 h-m-p 1.6000 8.0000 0.0000 --C 1131.018230 0 0.0250 1732
Out..
lnL = -1131.018230
1733 lfun, 5199 eigenQcodon, 51990 P(t)
Time used: 0:16
Model 2: PositiveSelection
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
initial w for M2:NSpselection reset.
0.030386 0.030766 0.017633 0.040885 0.043949 0.043596 0.087485 0.056398 0.121283 0.113501 0.100573 0.078535 0.012040 0.013141 0.013940 1.563836 1.265673 0.374565 0.422161 2.960589
ntime & nrate & np: 15 3 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.007430
np = 20
lnL0 = -1302.690810
Iterating by ming2
Initial: fx= 1302.690810
x= 0.03039 0.03077 0.01763 0.04088 0.04395 0.04360 0.08749 0.05640 0.12128 0.11350 0.10057 0.07854 0.01204 0.01314 0.01394 1.56384 1.26567 0.37456 0.42216 2.96059
1 h-m-p 0.0000 0.0004 226.2349 +++ 1295.590700 m 0.0004 46 | 0/20
2 h-m-p 0.0000 0.0003 2612.7253 ++ 1213.639978 m 0.0003 89 | 0/20
3 h-m-p 0.0016 0.0113 586.5941 --YYYYC 1211.783863 4 0.0000 138 | 0/20
4 h-m-p 0.0002 0.0190 85.3650 +++YCCC 1190.291167 3 0.0074 189 | 0/20
5 h-m-p 0.0046 0.0232 17.7349 +YYCCC 1186.659475 4 0.0170 239 | 0/20
6 h-m-p 0.0015 0.0076 34.9130 +YYCCC 1185.118010 4 0.0051 289 | 0/20
7 h-m-p 0.0028 0.0287 64.6448 +YYCC 1180.660598 3 0.0099 337 | 0/20
8 h-m-p 0.0099 0.0972 64.3843 YCCC 1171.106236 3 0.0233 385 | 0/20
9 h-m-p 0.0093 0.0467 53.7364 YCCCC 1166.027890 4 0.0175 435 | 0/20
10 h-m-p 0.0263 0.1315 23.9071 YCCCC 1159.485338 4 0.0488 485 | 0/20
11 h-m-p 0.0300 0.1499 25.5908 CCCC 1153.702976 3 0.0447 534 | 0/20
12 h-m-p 0.0145 0.0723 24.1218 YCCCCC 1149.441573 5 0.0363 586 | 0/20
13 h-m-p 0.0077 0.0385 21.2614 CCC 1148.684207 2 0.0100 633 | 0/20
14 h-m-p 0.0121 0.0605 10.1643 CYCCC 1148.098452 4 0.0189 683 | 0/20
15 h-m-p 0.0176 0.0878 5.5178 CCCC 1147.860796 3 0.0186 732 | 0/20
16 h-m-p 0.0177 0.2226 5.7974 +YYC 1147.071782 2 0.0624 778 | 0/20
17 h-m-p 0.0273 0.1363 8.2709 YCC 1146.728751 2 0.0211 824 | 0/20
18 h-m-p 0.0967 0.5880 1.8032 CCCCC 1145.807595 4 0.1428 875 | 0/20
19 h-m-p 0.0234 0.1171 4.3091 +YYCCCC 1143.266089 5 0.0782 927 | 0/20
20 h-m-p 0.0081 0.0403 10.6279 CCCCC 1142.871285 4 0.0100 978 | 0/20
21 h-m-p 0.0217 0.1084 3.9396 CCCC 1142.645620 3 0.0255 1027 | 0/20
22 h-m-p 0.1172 1.4795 0.8575 +YYYYC 1140.990188 4 0.4605 1075 | 0/20
23 h-m-p 0.2934 1.4671 0.5158 YCCCC 1139.419892 4 0.6663 1125 | 0/20
24 h-m-p 0.3717 1.8583 0.6968 CCCCC 1138.361275 4 0.4966 1176 | 0/20
25 h-m-p 0.1661 0.8304 1.0646 YCCCC 1137.652847 4 0.3219 1226 | 0/20
26 h-m-p 0.3902 8.0000 0.8784 CCCC 1137.016765 3 0.5418 1275 | 0/20
27 h-m-p 0.1299 0.6493 1.4172 +YCYCC 1136.279890 4 0.3711 1325 | 0/20
28 h-m-p 0.2803 1.4017 1.3537 CYCCC 1135.478814 4 0.5008 1375 | 0/20
29 h-m-p 0.3821 1.9103 1.1957 YCCCCC 1134.472761 5 0.7817 1427 | 0/20
30 h-m-p 0.3036 1.5179 1.5789 CCCC 1133.898715 3 0.3817 1476 | 0/20
31 h-m-p 0.3117 1.5584 1.5718 YYYC 1133.514147 3 0.3006 1522 | 0/20
32 h-m-p 0.3478 1.7389 1.3479 YYYC 1133.204767 3 0.3172 1568 | 0/20
33 h-m-p 0.2956 1.4781 1.3891 CCCC 1132.817761 3 0.4424 1617 | 0/20
34 h-m-p 0.2217 1.2668 2.7714 CCCCC 1132.427801 4 0.2633 1668 | 0/20
35 h-m-p 0.2527 1.2633 2.6329 YYC 1132.187778 2 0.1963 1713 | 0/20
36 h-m-p 0.3969 1.9843 1.1175 YYCC 1132.072777 3 0.2758 1760 | 0/20
37 h-m-p 0.2191 2.7867 1.4069 CCC 1131.951292 2 0.2766 1807 | 0/20
38 h-m-p 0.1715 1.0445 2.2685 YYC 1131.859550 2 0.1475 1852 | 0/20
39 h-m-p 0.2610 3.9279 1.2819 CYC 1131.789215 2 0.2552 1898 | 0/20
40 h-m-p 0.3676 3.1792 0.8900 YCC 1131.757656 2 0.2496 1944 | 0/20
41 h-m-p 0.1104 4.5065 2.0120 +CCCC 1131.589483 3 0.7071 1994 | 0/20
42 h-m-p 0.7181 3.5903 1.8558 YC 1131.507429 1 0.3326 2038 | 0/20
43 h-m-p 0.3071 2.0430 2.0097 YCC 1131.463041 2 0.2162 2084 | 0/20
44 h-m-p 0.4643 4.6254 0.9357 YC 1131.425652 1 0.2910 2128 | 0/20
45 h-m-p 0.2218 4.5921 1.2276 YCC 1131.385068 2 0.4076 2174 | 0/20
46 h-m-p 0.1824 2.5944 2.7438 CCC 1131.333698 2 0.2539 2221 | 0/20
47 h-m-p 0.2088 2.0122 3.3370 CCC 1131.274161 2 0.2548 2268 | 0/20
48 h-m-p 0.9068 8.0000 0.9378 CC 1131.212838 1 0.7514 2313 | 0/20
49 h-m-p 0.5320 8.0000 1.3246 CCC 1131.179968 2 0.4572 2360 | 0/20
50 h-m-p 0.3450 7.0479 1.7556 CCC 1131.151613 2 0.4746 2407 | 0/20
51 h-m-p 0.5491 8.0000 1.5174 CCC 1131.124109 2 0.7996 2454 | 0/20
52 h-m-p 1.2987 8.0000 0.9342 CYC 1131.094027 2 1.5118 2500 | 0/20
53 h-m-p 0.3873 8.0000 3.6469 CCC 1131.073884 2 0.3999 2547 | 0/20
54 h-m-p 0.6740 8.0000 2.1637 CC 1131.055914 1 0.6460 2592 | 0/20
55 h-m-p 1.1172 8.0000 1.2511 CC 1131.047380 1 1.1222 2637 | 0/20
56 h-m-p 0.8543 8.0000 1.6435 CY 1131.037676 1 0.8803 2682 | 0/20
57 h-m-p 0.7499 8.0000 1.9293 CCC 1131.031099 2 1.0604 2729 | 0/20
58 h-m-p 1.4322 8.0000 1.4284 C 1131.025946 0 1.4322 2772 | 0/20
59 h-m-p 1.1745 8.0000 1.7418 CC 1131.023062 1 1.2936 2817 | 0/20
60 h-m-p 1.6000 8.0000 1.3843 C 1131.021062 0 1.5897 2860 | 0/20
61 h-m-p 0.9836 8.0000 2.2372 C 1131.019941 0 0.9897 2903 | 0/20
62 h-m-p 1.2192 8.0000 1.8162 YC 1131.019355 1 0.8769 2947 | 0/20
63 h-m-p 0.8410 8.0000 1.8937 YC 1131.018866 1 1.5367 2991 | 0/20
64 h-m-p 1.6000 8.0000 1.7258 C 1131.018555 0 1.6000 3034 | 0/20
65 h-m-p 1.5270 8.0000 1.8084 C 1131.018407 0 1.3664 3077 | 0/20
66 h-m-p 1.3046 8.0000 1.8940 C 1131.018325 0 1.4615 3120 | 0/20
67 h-m-p 1.6000 8.0000 1.6698 C 1131.018273 0 2.1520 3163 | 0/20
68 h-m-p 1.6000 8.0000 1.5749 C 1131.018250 0 1.9216 3206 | 0/20
69 h-m-p 1.6000 8.0000 1.7399 C 1131.018241 0 1.6000 3249 | 0/20
70 h-m-p 1.4779 8.0000 1.8837 C 1131.018235 0 1.6956 3292 | 0/20
71 h-m-p 1.6000 8.0000 1.8557 C 1131.018233 0 1.4494 3335 | 0/20
72 h-m-p 1.4601 8.0000 1.8421 C 1131.018231 0 1.4601 3378 | 0/20
73 h-m-p 1.5657 8.0000 1.7179 C 1131.018231 0 2.3849 3421 | 0/20
74 h-m-p 1.6000 8.0000 1.7402 C 1131.018230 0 1.7458 3464 | 0/20
75 h-m-p 1.4189 8.0000 2.1411 C 1131.018230 0 2.2158 3507 | 0/20
76 h-m-p 1.4728 8.0000 3.2212 C 1131.018230 0 1.4728 3550 | 0/20
77 h-m-p 0.4154 8.0000 11.4214 C 1131.018230 0 0.4154 3593 | 0/20
78 h-m-p 0.9160 8.0000 5.1793 Y 1131.018230 0 2.0010 3636 | 0/20
79 h-m-p 0.5978 8.0000 17.3355 C 1131.018230 0 0.5978 3679 | 0/20
80 h-m-p 1.6000 8.0000 1.9696 Y 1131.018230 0 1.6000 3722 | 0/20
81 h-m-p 1.1442 8.0000 2.7541 Y 1131.018230 0 1.1442 3765 | 0/20
82 h-m-p 0.1834 8.0000 17.1830 ---------------.. | 0/20
83 h-m-p 0.0160 8.0000 0.0006 -------------
Out..
lnL = -1131.018230
3876 lfun, 15504 eigenQcodon, 174420 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1167.492989 S = -1139.365480 -20.210661
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 93 patterns 0:54
did 20 / 93 patterns 0:55
did 30 / 93 patterns 0:55
did 40 / 93 patterns 0:55
did 50 / 93 patterns 0:55
did 60 / 93 patterns 0:55
did 70 / 93 patterns 0:55
did 80 / 93 patterns 0:55
did 90 / 93 patterns 0:55
did 93 / 93 patterns 0:55
Time used: 0:55
Model 3: discrete
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
0.030386 0.030766 0.017633 0.040885 0.043949 0.043596 0.087485 0.056398 0.121283 0.113501 0.100573 0.078535 0.012040 0.013141 0.013940 1.563837 0.296071 0.323761 0.007311 0.018781 0.030114
ntime & nrate & np: 15 4 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 26.009002
np = 21
lnL0 = -1144.254560
Iterating by ming2
Initial: fx= 1144.254560
x= 0.03039 0.03077 0.01763 0.04088 0.04395 0.04360 0.08749 0.05640 0.12128 0.11350 0.10057 0.07854 0.01204 0.01314 0.01394 1.56384 0.29607 0.32376 0.00731 0.01878 0.03011
1 h-m-p 0.0000 0.0000 234.6480 ++ 1141.888611 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 1724.6655 +YCYCCC 1139.493826 5 0.0000 101 | 1/21
3 h-m-p 0.0000 0.0000 685.3398 ++ 1138.806268 m 0.0000 145 | 2/21
4 h-m-p 0.0000 0.0012 108.2211 +YYCCC 1137.682889 4 0.0002 196 | 2/21
5 h-m-p 0.0006 0.0028 35.9078 YCCC 1137.506618 3 0.0003 244 | 2/21
6 h-m-p 0.0004 0.0028 31.8232 CYC 1137.400037 2 0.0003 290 | 2/21
7 h-m-p 0.0006 0.0032 12.4991 CC 1137.388017 1 0.0002 335 | 2/21
8 h-m-p 0.0003 0.0110 9.4116 YC 1137.375833 1 0.0004 379 | 2/21
9 h-m-p 0.0005 0.0052 7.7803 CC 1137.372539 1 0.0002 424 | 2/21
10 h-m-p 0.0004 0.0872 3.7514 +CC 1137.365567 1 0.0015 470 | 2/21
11 h-m-p 0.0005 0.0315 12.2464 +YC 1137.349026 1 0.0012 515 | 2/21
12 h-m-p 0.0007 0.1315 18.9387 ++CCC 1137.090132 2 0.0125 564 | 2/21
13 h-m-p 0.0008 0.0063 313.8626 CCC 1136.807539 2 0.0008 611 | 2/21
14 h-m-p 0.0009 0.0065 301.2009 CYC 1136.525528 2 0.0008 657 | 2/21
15 h-m-p 0.0046 0.0230 17.7606 CYC 1136.505438 2 0.0011 703 | 2/21
16 h-m-p 0.0025 0.0711 7.6582 +CCCC 1136.414323 3 0.0120 753 | 2/21
17 h-m-p 0.0003 0.0166 284.1964 +CYC 1136.023051 2 0.0015 800 | 2/21
18 h-m-p 0.0021 0.0165 203.2328 CCC 1135.608685 2 0.0021 847 | 2/21
19 h-m-p 0.0147 0.0737 6.4814 -CC 1135.601229 1 0.0013 893 | 2/21
20 h-m-p 0.0060 1.2915 1.3700 +++CYCCC 1134.700273 4 0.6168 946 | 1/21
21 h-m-p 0.0001 0.0004 2631.6607 YC 1134.692074 1 0.0000 990 | 1/21
22 h-m-p 0.0949 0.4744 0.2166 ++ 1133.714875 m 0.4744 1034 | 2/21
23 h-m-p 0.3537 1.7687 0.1725 CYCCC 1133.045072 4 0.7141 1085 | 2/21
24 h-m-p 0.6274 8.0000 0.1964 +YCCC 1132.393325 3 1.8673 1134 | 1/21
25 h-m-p 0.0001 0.0007 4255.8930 -CYC 1132.360450 2 0.0000 1181 | 1/21
26 h-m-p 0.1120 8.0000 0.2835 ++CCCC 1131.603677 3 2.5453 1233 | 1/21
27 h-m-p 0.4701 2.3506 0.3329 YCCC 1131.304615 3 1.1728 1282 | 0/21
28 h-m-p 0.0011 0.0055 71.6365 CCC 1131.276423 2 0.0011 1330 | 0/21
29 h-m-p 0.1478 8.0000 0.5106 ++YC 1130.932946 1 1.5437 1378 | 0/21
30 h-m-p 1.6000 8.0000 0.3361 YCCC 1130.686731 3 2.7047 1428 | 0/21
31 h-m-p 0.9089 4.5447 0.3843 +YC 1130.449130 1 2.7491 1475 | 0/21
32 h-m-p 1.6000 8.0000 0.2513 YCC 1130.430058 2 0.8561 1523 | 0/21
33 h-m-p 0.8715 8.0000 0.2469 YC 1130.424169 1 0.6200 1569 | 0/21
34 h-m-p 1.6000 8.0000 0.0198 YC 1130.423913 1 1.0840 1615 | 0/21
35 h-m-p 1.6000 8.0000 0.0035 C 1130.423903 0 1.3501 1660 | 0/21
36 h-m-p 1.6000 8.0000 0.0012 Y 1130.423898 0 3.1950 1705 | 0/21
37 h-m-p 1.6000 8.0000 0.0003 +Y 1130.423892 0 4.7836 1751 | 0/21
38 h-m-p 1.6000 8.0000 0.0005 ++ 1130.423845 m 8.0000 1796 | 0/21
39 h-m-p 0.5469 2.7345 0.0023 Y 1130.423815 0 1.2251 1841 | 0/21
40 h-m-p 1.6000 8.0000 0.0007 C 1130.423813 0 1.3130 1886 | 0/21
41 h-m-p 1.6000 8.0000 0.0001 C 1130.423813 0 1.5037 1931 | 0/21
42 h-m-p 1.6000 8.0000 0.0001 ----Y 1130.423813 0 0.0016 1980 | 0/21
43 h-m-p 0.0160 8.0000 0.0001 -------------.. | 0/21
44 h-m-p 0.0035 1.7642 0.0142 -------C 1130.423813 0 0.0000 2088 | 0/21
45 h-m-p 0.0038 1.8956 0.0038 --Y 1130.423813 0 0.0001 2135 | 0/21
46 h-m-p 0.0160 8.0000 0.0023 --Y 1130.423813 0 0.0003 2182 | 0/21
47 h-m-p 0.0160 8.0000 0.0019 --C 1130.423813 0 0.0003 2229 | 0/21
48 h-m-p 0.0160 8.0000 0.0009 -------------.. | 0/21
49 h-m-p 0.0160 8.0000 0.0155 --------C 1130.423813 0 0.0000 2338 | 0/21
50 h-m-p 0.0160 8.0000 0.0038 ----------C 1130.423813 0 0.0000 2393 | 0/21
51 h-m-p 0.0114 5.6835 0.0179 -------------.. | 0/21
52 h-m-p 0.0160 8.0000 0.0153 -------------
Out..
lnL = -1130.423813
2506 lfun, 10024 eigenQcodon, 112770 P(t)
Time used: 1:19
Model 7: beta
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
0.030386 0.030766 0.017633 0.040885 0.043949 0.043596 0.087485 0.056398 0.121283 0.113501 0.100573 0.078535 0.012040 0.013141 0.013940 1.501378 0.646685 1.067456
ntime & nrate & np: 15 1 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 8.719435
np = 18
lnL0 = -1232.257506
Iterating by ming2
Initial: fx= 1232.257506
x= 0.03039 0.03077 0.01763 0.04088 0.04395 0.04360 0.08749 0.05640 0.12128 0.11350 0.10057 0.07854 0.01204 0.01314 0.01394 1.50138 0.64668 1.06746
1 h-m-p 0.0000 0.0003 196.6911 ++YCYCCC 1227.649765 5 0.0002 52 | 0/18
2 h-m-p 0.0001 0.0023 494.5191 +CCCC 1221.670180 3 0.0005 98 | 0/18
3 h-m-p 0.0004 0.0020 293.6236 +YYYCCCC 1176.379503 6 0.0015 147 | 0/18
4 h-m-p 0.0004 0.0020 86.4237 CCCC 1175.378780 3 0.0004 192 | 0/18
5 h-m-p 0.0008 0.0038 32.9217 CYCCC 1174.703745 4 0.0013 238 | 0/18
6 h-m-p 0.0006 0.0031 48.3633 CCC 1174.236886 2 0.0009 281 | 0/18
7 h-m-p 0.0009 0.0046 51.0392 CCCC 1173.637532 3 0.0013 326 | 0/18
8 h-m-p 0.0005 0.0026 62.2008 YCCC 1173.111334 3 0.0010 370 | 0/18
9 h-m-p 0.0007 0.0051 88.2528 YCCC 1172.273065 3 0.0013 414 | 0/18
10 h-m-p 0.0012 0.0062 31.2681 CCCCC 1171.945847 4 0.0015 461 | 0/18
11 h-m-p 0.0020 0.0161 23.4746 CCCC 1171.443078 3 0.0036 506 | 0/18
12 h-m-p 0.0027 0.0135 14.6807 YYC 1171.262213 2 0.0024 547 | 0/18
13 h-m-p 0.0043 0.0250 8.2120 CCCCC 1171.019098 4 0.0051 594 | 0/18
14 h-m-p 0.0057 0.0286 6.8920 CCCC 1170.639320 3 0.0060 639 | 0/18
15 h-m-p 0.0040 0.0202 9.8147 CCCC 1169.591988 3 0.0057 684 | 0/18
16 h-m-p 0.0032 0.0210 17.3271 +CYYYC 1146.541070 4 0.0188 730 | 0/18
17 h-m-p 0.0000 0.0002 255.2153 YCYCCC 1145.182358 5 0.0001 777 | 0/18
18 h-m-p 0.0008 0.0066 30.0279 YCCCC 1144.374355 4 0.0015 823 | 0/18
19 h-m-p 0.0150 0.3126 3.0541 ++YCCCC 1137.053379 4 0.1826 871 | 0/18
20 h-m-p 0.0418 0.2091 4.3341 YCCC 1135.169933 3 0.0821 915 | 0/18
21 h-m-p 0.2483 1.2416 0.3963 CYCC 1133.969217 3 0.2714 959 | 0/18
22 h-m-p 0.3665 1.8323 0.1045 YCC 1133.510296 2 0.2909 1001 | 0/18
23 h-m-p 0.2538 2.1197 0.1197 CYC 1133.345679 2 0.2401 1043 | 0/18
24 h-m-p 0.7561 8.0000 0.0380 YCC 1133.271138 2 0.5606 1085 | 0/18
25 h-m-p 0.4423 4.9112 0.0482 CCC 1133.195883 2 0.7079 1128 | 0/18
26 h-m-p 1.6000 8.0000 0.0190 CC 1133.179559 1 0.6216 1169 | 0/18
27 h-m-p 0.3733 8.0000 0.0317 CC 1133.173354 1 0.5292 1210 | 0/18
28 h-m-p 0.4404 8.0000 0.0381 +CC 1133.145003 1 2.6259 1252 | 0/18
29 h-m-p 0.4785 8.0000 0.2091 +YYCCC 1133.013122 4 2.4823 1298 | 0/18
30 h-m-p 0.2591 1.2955 0.9941 YYCCYCCC 1132.897757 7 0.3588 1348 | 0/18
31 h-m-p 0.5985 2.9923 0.3115 YCYYCCC 1132.677131 6 1.2498 1397 | 0/18
32 h-m-p 0.4853 2.4267 0.2129 CC 1132.634731 1 0.1164 1438 | 0/18
33 h-m-p 0.1714 2.7521 0.1445 YCC 1132.570488 2 0.3398 1480 | 0/18
34 h-m-p 0.4672 4.4529 0.1051 YCC 1132.544686 2 0.7981 1522 | 0/18
35 h-m-p 1.3550 6.7750 0.0613 YCCC 1132.540903 3 0.6748 1566 | 0/18
36 h-m-p 0.8927 6.7125 0.0463 CYC 1132.538357 2 1.0517 1608 | 0/18
37 h-m-p 0.7344 4.3557 0.0663 CYC 1132.537632 2 0.3437 1650 | 0/18
38 h-m-p 1.6000 8.0000 0.0141 YC 1132.537035 1 1.2475 1690 | 0/18
39 h-m-p 1.2272 8.0000 0.0143 YY 1132.536834 1 1.2272 1730 | 0/18
40 h-m-p 1.6000 8.0000 0.0003 YC 1132.536752 1 0.6468 1770 | 0/18
41 h-m-p 0.0250 8.0000 0.0082 +++Y 1132.536649 0 1.6008 1812 | 0/18
42 h-m-p 1.6000 8.0000 0.0006 YC 1132.536608 1 0.9617 1852 | 0/18
43 h-m-p 0.3420 8.0000 0.0017 +C 1132.536591 0 1.4857 1892 | 0/18
44 h-m-p 1.6000 8.0000 0.0002 Y 1132.536584 0 1.1104 1931 | 0/18
45 h-m-p 0.5196 8.0000 0.0004 ++ 1132.536574 m 8.0000 1970 | 0/18
46 h-m-p 1.3019 8.0000 0.0022 C 1132.536573 0 0.2851 2009 | 0/18
47 h-m-p 0.3665 8.0000 0.0017 ------Y 1132.536573 0 0.0000 2054 | 0/18
48 h-m-p 0.0160 8.0000 0.0911 C 1132.536572 0 0.0038 2093 | 0/18
49 h-m-p 0.5254 8.0000 0.0007 -C 1132.536572 0 0.0301 2133 | 0/18
50 h-m-p 0.0314 8.0000 0.0006 C 1132.536572 0 0.0065 2172 | 0/18
51 h-m-p 0.0160 8.0000 0.0006 Y 1132.536572 0 0.0256 2211 | 0/18
52 h-m-p 0.0261 8.0000 0.0006 Y 1132.536572 0 0.0050 2250 | 0/18
53 h-m-p 0.0160 8.0000 0.0006 C 1132.536572 0 0.0160 2289 | 0/18
54 h-m-p 0.0161 8.0000 0.0006 Y 1132.536572 0 0.0040 2328 | 0/18
55 h-m-p 0.0160 8.0000 0.0005 -----C 1132.536572 0 0.0000 2372
Out..
lnL = -1132.536572
2373 lfun, 26103 eigenQcodon, 355950 P(t)
Time used: 2:36
Model 8: beta&w>1
TREE # 1
(1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
initial w for M8:NSbetaw>1 reset.
0.030386 0.030766 0.017633 0.040885 0.043949 0.043596 0.087485 0.056398 0.121283 0.113501 0.100573 0.078535 0.012040 0.013141 0.013940 1.475320 0.900000 0.424862 1.004508 2.363541
ntime & nrate & np: 15 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.100497
np = 20
lnL0 = -1237.623141
Iterating by ming2
Initial: fx= 1237.623141
x= 0.03039 0.03077 0.01763 0.04088 0.04395 0.04360 0.08749 0.05640 0.12128 0.11350 0.10057 0.07854 0.01204 0.01314 0.01394 1.47532 0.90000 0.42486 1.00451 2.36354
1 h-m-p 0.0000 0.0004 376.5766 +++ 1201.956755 m 0.0004 46 | 1/20
2 h-m-p 0.0004 0.0018 267.3743 +YYYYCCC 1158.133824 6 0.0013 98 | 0/20
3 h-m-p 0.0000 0.0001 1541.0624 +YYCYCCC 1152.548342 6 0.0000 150 | 0/20
4 h-m-p 0.0004 0.0021 87.6001 YCCC 1150.026476 3 0.0010 198 | 0/20
5 h-m-p 0.0002 0.0010 100.8376 CCCC 1149.295484 3 0.0003 247 | 0/20
6 h-m-p 0.0004 0.0020 68.7504 +YYCCC 1147.376937 4 0.0014 297 | 0/20
7 h-m-p 0.0003 0.0013 66.2259 +YCYCCC 1146.625150 5 0.0007 349 | 0/20
8 h-m-p 0.0002 0.0012 144.0496 YCC 1145.988154 2 0.0004 395 | 0/20
9 h-m-p 0.0003 0.0016 174.2921 CCC 1145.253824 2 0.0004 442 | 0/20
10 h-m-p 0.0003 0.0014 61.6504 YCCCC 1144.840077 4 0.0007 492 | 0/20
11 h-m-p 0.0012 0.0074 34.8003 YCC 1144.258052 2 0.0023 538 | 0/20
12 h-m-p 0.0067 0.0334 7.0922 YC 1144.164148 1 0.0034 582 | 0/20
13 h-m-p 0.0015 0.0120 15.9172 CCC 1144.086505 2 0.0013 629 | 0/20
14 h-m-p 0.0045 0.0804 4.5483 +YCCC 1143.819268 3 0.0117 678 | 0/20
15 h-m-p 0.0061 0.0440 8.6753 CYC 1143.470527 2 0.0066 724 | 0/20
16 h-m-p 0.0011 0.0104 52.7611 +YYCCC 1142.188423 4 0.0034 774 | 0/20
17 h-m-p 0.0067 0.0336 14.1160 YYC 1141.742805 2 0.0055 819 | 0/20
18 h-m-p 0.0156 0.0782 4.4236 YCCC 1141.630995 3 0.0075 867 | 0/20
19 h-m-p 0.0059 0.3148 5.6549 +YCCC 1140.847042 3 0.0488 916 | 0/20
20 h-m-p 0.0089 0.0447 19.9085 YCC 1140.596953 2 0.0049 962 | 0/20
21 h-m-p 0.0532 1.9149 1.8364 +CYC 1140.120303 2 0.1896 1009 | 0/20
22 h-m-p 0.4300 2.1500 0.1225 YCCCCC 1138.655066 5 0.9623 1061 | 0/20
23 h-m-p 0.4501 2.2505 0.1307 +YYCCC 1136.114737 4 1.6433 1111 | 0/20
24 h-m-p 0.0423 0.2116 0.3333 ++ 1134.875466 m 0.2116 1154 | 1/20
25 h-m-p 0.2432 2.8634 0.2873 CYC 1134.200212 2 0.2918 1200 | 1/20
26 h-m-p 0.0673 0.3366 0.7459 CCCCC 1133.562839 4 0.0788 1250 | 1/20
27 h-m-p 0.5486 2.7432 0.0977 CCC 1133.243424 2 0.5828 1296 | 1/20
28 h-m-p 0.3651 1.8253 0.1300 CCCC 1133.075699 3 0.3737 1344 | 1/20
29 h-m-p 1.2220 6.1098 0.0140 YC 1133.008237 1 0.7213 1387 | 1/20
30 h-m-p 0.3343 5.1953 0.0301 CC 1132.990122 1 0.5029 1431 | 1/20
31 h-m-p 0.3027 8.0000 0.0501 +CCC 1132.965633 2 1.3754 1478 | 1/20
32 h-m-p 0.5853 8.0000 0.1176 +YYC 1132.903558 2 1.9352 1523 | 1/20
33 h-m-p 0.3458 2.2243 0.6583 CYCYC 1132.772691 4 0.6369 1571 | 1/20
34 h-m-p 0.4177 2.0885 0.5134 YCYYCCC 1132.614983 6 0.8652 1622 | 1/20
35 h-m-p 0.2124 1.0622 0.2916 YCCC 1132.574008 3 0.1125 1669 | 1/20
36 h-m-p 0.2176 3.8310 0.1507 +YCC 1132.549786 2 0.5893 1715 | 1/20
37 h-m-p 0.9714 5.0793 0.0914 YCC 1132.541835 2 0.6016 1760 | 1/20
38 h-m-p 1.0076 6.7461 0.0546 YYCCC 1132.539498 4 1.2419 1808 | 1/20
39 h-m-p 1.1222 5.6110 0.0535 YC 1132.538609 1 0.5987 1851 | 1/20
40 h-m-p 1.6000 8.0000 0.0102 YC 1132.538476 1 0.2793 1894 | 1/20
41 h-m-p 0.0688 6.6184 0.0413 +CC 1132.538237 1 0.4218 1939 | 1/20
42 h-m-p 1.6000 8.0000 0.0106 Y 1132.538100 0 1.1664 1981 | 1/20
43 h-m-p 1.6000 8.0000 0.0048 YC 1132.538052 1 0.8263 2024 | 1/20
44 h-m-p 1.2008 8.0000 0.0033 C 1132.538011 0 1.3203 2066 | 1/20
45 h-m-p 1.6000 8.0000 0.0020 Y 1132.537991 0 1.2799 2108 | 1/20
46 h-m-p 1.6000 8.0000 0.0004 C 1132.537989 0 0.5868 2150 | 1/20
47 h-m-p 0.4654 8.0000 0.0005 +C 1132.537981 0 2.7631 2193 | 1/20
48 h-m-p 1.6000 8.0000 0.0007 Y 1132.537981 0 0.2843 2235 | 1/20
49 h-m-p 0.4923 8.0000 0.0004 Y 1132.537981 0 0.2005 2277 | 1/20
50 h-m-p 0.2535 8.0000 0.0003 C 1132.537981 0 0.0519 2319 | 1/20
51 h-m-p 0.0635 8.0000 0.0003 Y 1132.537981 0 0.1579 2361 | 1/20
52 h-m-p 0.1277 8.0000 0.0003 ---------------.. | 1/20
53 h-m-p 0.0009 0.4568 0.2085 -----------
Out..
lnL = -1132.537981
2468 lfun, 29616 eigenQcodon, 407220 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1177.108682 S = -1140.771537 -28.867179
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 93 patterns 4:04
did 20 / 93 patterns 4:04
did 30 / 93 patterns 4:04
did 40 / 93 patterns 4:04
did 50 / 93 patterns 4:05
did 60 / 93 patterns 4:05
did 70 / 93 patterns 4:05
did 80 / 93 patterns 4:05
did 90 / 93 patterns 4:05
did 93 / 93 patterns 4:05
Time used: 4:05
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=163
D_melanogaster_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_sechellia_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_simulans_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_yakuba_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_erecta_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_takahashii_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_biarmipes_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_eugracilis_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_ficusphila_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_rhopaloa_zetaCOP-PC MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
D_elegans_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG
********:*****************************************
D_melanogaster_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_sechellia_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_simulans_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_yakuba_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_erecta_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_takahashii_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_biarmipes_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_eugracilis_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_ficusphila_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_rhopaloa_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
D_elegans_zetaCOP-PC LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV
**************************************************
D_melanogaster_zetaCOP-PC LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_sechellia_zetaCOP-PC LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_simulans_zetaCOP-PC LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_yakuba_zetaCOP-PC LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_erecta_zetaCOP-PC LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_takahashii_zetaCOP-PC LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL
D_biarmipes_zetaCOP-PC LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_eugracilis_zetaCOP-PC LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_ficusphila_zetaCOP-PC LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
D_rhopaloa_zetaCOP-PC LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT
D_elegans_zetaCOP-PC LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL
*: ***************:********:*********************
D_melanogaster_zetaCOP-PC QSAREQLKWSILK
D_sechellia_zetaCOP-PC QSAREQLKWSILK
D_simulans_zetaCOP-PC QSAREQLKWSILK
D_yakuba_zetaCOP-PC QSAREQLKWSILK
D_erecta_zetaCOP-PC QSAREQLKWSILK
D_takahashii_zetaCOP-PC QSAREQLKWSILK
D_biarmipes_zetaCOP-PC QSAREQLKWSILK
D_eugracilis_zetaCOP-PC QSAREQLKWSILK
D_ficusphila_zetaCOP-PC QSAREQLKWSILK
D_rhopaloa_zetaCOP-PC ooooooooooooo
D_elegans_zetaCOP-PC QSAREQLKWSILK
>D_melanogaster_zetaCOP-PC ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATTATGCTGGACGGA CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTGCTGTCCGTGCTCAACTGCCTCT ACGATTCCATTAGCCTGATCCTCAAGAAGAACGTTGAGAAGCGCCTGGTG CTGGAAAACCTGGAGATCATCATGCTGGCATTTGACGAGATCTGCGACGG AGGCATTATTCTGGATGCGGATCCCTCGTCGGTGGTGAAACGCGTTGATC TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG >D_sechellia_zetaCOP-PC ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTCCTGTCCGTGCTAAACTGCCTCT ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGATAACCTGGAGATCATCATGCTGGCTTTTGACGAGATCTGCGACGG AGGCATTATTCTGGATGCGGATCCCTCGTCCGTGGTGAAACGCGTTGATC TGCGCAACGATGACATTCCCATTGCCGAACAAACCGTTGCCCAGGTTCTG CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG >D_simulans_zetaCOP-PC ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTATTACGA CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA CTCACCTGCGTGTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTCCTGTCCGTGCTAAACTGCCTCT ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGAAAACCTGGAGATCATCATGCTGGCATTTGACGAGATCTGCGACGG AGGCATTATTCTGGATGCGGATCCCTCGTCCGTGGTGAAACGCGTTGATC TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG >D_yakuba_zetaCOP-PC ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGATGGA CTTACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT ACGATTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGATAACCTGGAGATCATCATGCTGGCCTTTGACGAGATCTGCGACGG AGGCATAATTCTGGATGCCGATCCGTCGTCCGTGGTGAAACGCGTTGATC TGCGCAACGATGACATTCCAATTGCCGAACAGACCGTCGCCCAGGTTCTG CAATCGGCACGTGAACAACTCAAATGGTCCATTCTGAAG >D_erecta_zetaCOP-PC ATGTGCATCATGGACAACGATGGCAACCGCATCCTGGCCAAGTACTACGA CAAGAACATCTTGTCCACGTTGAAGGAGCAGAAGGCCTTTGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGA CTCACCTGCGTCTACAAGAGCAACGTGGACCTGTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT ACGATTCTATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGAATACCTGGAGATCATCATGCTGGCCTTTGACGAGATCTGCGATGG AGGCATAATTCTGGATGCGGATCCCTCGTCGGTGGTGAAACGCGTTGATC TGCGCAACGATGACATTCCAATTGCCGAACAGACCGTTGCCCAGGTTCTG CAATCGGCACGTGAACAACTCAAATGGTCTATTCTGAAG >D_takahashii_zetaCOP-PC ATGTGCATCATGGACAACGACGGCAACCGCATCCTGGCCAAGTACTACGA CAAAAACATTCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTGGACGGG CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTGCTCTCGGTGCTCAACTGCCTGT ACGACTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGAGAACCTGGAGATCATCATGCTGGCCTTCGATGAGATCTGCGACGG AGGCATAATCCTGGATGCCGATCCATCGTCCATTGTGAAACGTGTCGATC TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG CAGTCGGCGCGTGAACAGCTCAAATGGTCCATTCTGAAG >D_biarmipes_zetaCOP-PC ATGTGCATCATGGACAACGACGGGAACCGCATCCTGGCCAAGTACTACGA CAAGAACATACTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT ACGACTCCATCAGCCTGATTCTCAAGAAGAATGTGGAGAAGCGCCTGGTG CTGGAGAACCTGGAGATCATCATGCTGGCCTTCGACGAGATCTGCGACGG AGGCATTATCCTGGACGCGGATCCCTCGTCCGTGGTGAAACGCGTCGATC TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG CAGTCGGCGCGCGAGCAACTCAAATGGTCCATTCTGAAG >D_eugracilis_zetaCOP-PC ATGTGCATCATGGACAACGATGGAAACCGCATCCTGGCCAAATACTACGA TAAAAACATCTTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTGGACGGA CTCACCTGCGTCTACAAAAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTGATCCTGCTGTCTGTGCTCAACTGCCTGT ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGAGAACCTGGAGATCATCATGCTGGCCTTTGATGAAATCTGCGACGG AGGCATGATTCTGGATGCGGATCCCTCCTCCGTAGTGAAACGCGTCGATC TGCGCAACGATGACATTCCTATTGCCGAACAAACCGTTGCCCAGGTTCTG CAATCGGCGCGTGAGCAACTCAAATGGTCCATTCTGAAG >D_ficusphila_zetaCOP-PC ATGTGCATCATGGACAACGATGGCAACCGCATTCTGGCGAAGTACTACGA CAAGAACATCTTGTCCACGCTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATAATGCTCGACGGA CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGAGAACCTCGAGATCATAATGCTGGCATTTGACGAGATCTGCGACGG AGGCATGATCCTGGACGCGGATCCTTCGTCCGTGGTAAAACGTGTCGATC TGCGCAACGACGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTTCTG CAGTCGGCGCGTGAGCAGCTCAAATGGTCTATTCTGAAG >D_rhopaloa_zetaCOP-PC ATGTGCATCATGGACAATGATGGAGACCGCATCCTGGCCAAGTACTACGA CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAATAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG CTCACCTGCGTCTACAAGAGCAACGTGGACCTGTTCTTCTACGTGATGGG CAATGCCTACGAGAATGAGCTGATCCTGCTCTCCGTGCTCAACTGCCTCT ACGACTCCATCAGCCTAATCCTCAAGAAGAACGTGGAGAAGCGCCTGGTG CTGGACAACCTGGAGATCATCATGCTGGCCTTCGACGAGATCTGCGACGG AGGCATGATCCTGGATGCGGATCCCTCGTCCGTGGTGAAACGAGTCGATC TGCGCAACGATGACATTCCCATTGCCGAACAGACCGTTGCCCAGGTAACT --------------------------------------- >D_elegans_zetaCOP-PC ATGTGCATCATGGACAATGATGGCAACCGCATCCTGGCCAAGTACTACGA CAAGAACATCCTGTCCACGTTGAAGGAGCAGAAGGCCTTCGAAAAGAATC TGTTCAACAAGACGCACCGCTCCAACACGGAGATCATCATGCTGGACGGG CTCACCTGCGTCTACAAGAGCAACGTGGACCTCTTCTTCTACGTGATGGG CAACGCCTACGAGAACGAGCTCATCCTGCTCTCCGTGCTCAACTGCCTCT ACGACTCCATCAGCCTGATCCTCAAGAAGAACGTGGAGAAGCGACTGGTG CTGGAGAACCTGGAGATCATCATGCTCGCCTTCGACGAGATCTGTGACGG AGGAATGATCCTGGATGCGGATCCCTCATCCGTCGTGAAACGAGTCGATC TGCGCAACGATGACATTCCCATCGCCGAACAGACCGTTGCCCAGGTTCTG CAGTCGGCGCGTGAACAACTCAAATGGTCCATTCTGAAG
>D_melanogaster_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_sechellia_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_simulans_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_yakuba_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LDNLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_erecta_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LEYLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_takahashii_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGIILDADPSSIVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_biarmipes_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGIILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_eugracilis_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_ficusphila_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK >D_rhopaloa_zetaCOP-PC MCIMDNDGDRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LDNLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVT ------------- >D_elegans_zetaCOP-PC MCIMDNDGNRILAKYYDKNILSTLKEQKAFEKNLFNKTHRSNTEIIMLDG LTCVYKSNVDLFFYVMGNAYENELILLSVLNCLYDSISLILKKNVEKRLV LENLEIIMLAFDEICDGGMILDADPSSVVKRVDLRNDDIPIAEQTVAQVL QSAREQLKWSILK
#NEXUS
[ID: 7714235038]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_zetaCOP-PC
D_sechellia_zetaCOP-PC
D_simulans_zetaCOP-PC
D_yakuba_zetaCOP-PC
D_erecta_zetaCOP-PC
D_takahashii_zetaCOP-PC
D_biarmipes_zetaCOP-PC
D_eugracilis_zetaCOP-PC
D_ficusphila_zetaCOP-PC
D_rhopaloa_zetaCOP-PC
D_elegans_zetaCOP-PC
;
end;
begin trees;
translate
1 D_melanogaster_zetaCOP-PC,
2 D_sechellia_zetaCOP-PC,
3 D_simulans_zetaCOP-PC,
4 D_yakuba_zetaCOP-PC,
5 D_erecta_zetaCOP-PC,
6 D_takahashii_zetaCOP-PC,
7 D_biarmipes_zetaCOP-PC,
8 D_eugracilis_zetaCOP-PC,
9 D_ficusphila_zetaCOP-PC,
10 D_rhopaloa_zetaCOP-PC,
11 D_elegans_zetaCOP-PC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02288276,((4:0.03449741,5:0.03746737)0.873:0.01430505,(6:0.07891415,7:0.05026756,8:0.1088922,9:0.1012453,10:0.09044092,11:0.05294348)0.994:0.04663464)0.999:0.03096554,(2:0.01691612,3:0.007814743)0.986:0.01390629);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02288276,((4:0.03449741,5:0.03746737):0.01430505,(6:0.07891415,7:0.05026756,8:0.1088922,9:0.1012453,10:0.09044092,11:0.05294348):0.04663464):0.03096554,(2:0.01691612,3:0.007814743):0.01390629);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1328.57 -1345.71
2 -1330.08 -1347.49
--------------------------------------
TOTAL -1329.06 -1346.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/443/zetaCOP-PC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.812469 0.017083 0.565368 1.071394 0.803883 1099.72 1135.93 1.000
r(A<->C){all} 0.083050 0.000901 0.029370 0.143340 0.080460 854.59 862.69 1.003
r(A<->G){all} 0.270828 0.004037 0.149900 0.397122 0.265829 671.76 720.90 1.001
r(A<->T){all} 0.173790 0.004304 0.047417 0.298054 0.168000 502.53 586.54 1.003
r(C<->G){all} 0.090911 0.000634 0.042961 0.139420 0.088329 895.41 947.16 1.000
r(C<->T){all} 0.346649 0.003951 0.226859 0.468267 0.343580 669.28 674.70 1.000
r(G<->T){all} 0.034772 0.000495 0.000043 0.078070 0.030445 789.58 896.37 1.001
pi(A){all} 0.246511 0.000347 0.210823 0.283027 0.246598 840.23 974.44 1.002
pi(C){all} 0.295129 0.000386 0.259351 0.335633 0.294347 1219.06 1256.28 1.000
pi(G){all} 0.255968 0.000366 0.217506 0.293281 0.255881 992.63 1172.40 1.001
pi(T){all} 0.202392 0.000304 0.169267 0.236723 0.202540 1034.59 1085.09 1.000
alpha{1,2} 0.088100 0.000351 0.055710 0.128792 0.088032 1116.18 1138.74 1.000
alpha{3} 2.539638 0.687588 1.140779 4.174147 2.406027 1130.41 1242.44 1.000
pinvar{all} 0.540672 0.002673 0.429888 0.631966 0.542966 1029.46 1143.55 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/443/zetaCOP-PC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 150
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 2 2 0 | Ser TCT 0 0 0 0 1 0 | Tyr TAT 0 0 1 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 3 3 5 | TCC 4 5 5 5 3 4 | TAC 6 6 5 6 7 6 | TGC 4 4 4 4 4 4
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 2 1 | TCG 2 1 1 1 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 1 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 1
CTC 6 6 6 6 6 6 | CCC 2 2 2 0 1 1 | CAC 1 1 1 1 1 1 | CGC 5 5 5 5 5 4
CTA 0 1 1 0 0 0 | CCA 0 0 0 1 1 1 | Gln CAA 0 1 0 0 0 0 | CGA 0 0 0 0 0 0
CTG 14 13 13 13 13 14 | CCG 0 0 0 1 0 0 | CAG 3 2 3 3 3 3 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 6 4 4 3 3 4 | Thr ACT 0 0 0 0 0 0 | Asn AAT 2 2 2 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 9 11 11 11 11 10 | ACC 2 2 2 2 2 2 | AAC 11 11 11 12 11 12 | AGC 2 2 2 2 2 2
ATA 0 0 0 1 1 2 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 2 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 3 3 3 3 3 3 | AAG 10 10 10 10 10 9 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 4 3 3 2 3 2 | Ala GCT 0 1 0 0 0 0 | Asp GAT 6 7 6 8 7 5 | Gly GGT 0 0 0 0 0 0
GTC 0 0 0 2 1 2 | GCC 5 5 5 7 6 7 | GAC 7 7 7 6 6 8 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 1 0 1 0 0 0 | Glu GAA 3 2 3 2 3 2 | GGA 2 2 2 2 2 1
GTG 7 8 8 7 7 6 | GCG 1 1 1 0 1 0 | GAG 7 7 7 7 7 8 | GGG 0 0 0 0 0 1
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 1 1 0 0 | Ser TCT 0 1 0 0 0 | Tyr TAT 0 0 0 0 0 | Cys TGT 0 0 0 0 1
TTC 5 4 4 5 5 | TCC 5 5 5 5 5 | TAC 6 6 6 6 6 | TGC 4 4 4 4 3
Leu TTA 0 0 0 0 0 | TCA 0 0 0 0 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 2 1 1 1 | TCG 1 0 1 1 0 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 0 1 1 0 0 | His CAT 0 0 0 0 0 | Arg CGT 0 0 1 0 0
CTC 6 4 8 5 8 | CCC 2 1 1 2 2 | CAC 1 1 1 1 1 | CGC 5 5 4 4 3
CTA 0 1 1 1 0 | CCA 0 0 0 0 0 | Gln CAA 0 1 0 0 0 | CGA 0 0 0 1 2
CTG 14 14 11 13 12 | CCG 0 0 0 0 0 | CAG 3 2 3 3 3 | CGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 4 3 3 2 1 | Thr ACT 0 0 0 1 0 | Asn AAT 2 1 1 5 2 | Ser AGT 0 0 0 0 0
ATC 10 10 9 12 13 | ACC 2 2 2 2 2 | AAC 11 12 12 7 11 | AGC 2 2 2 2 2
ATA 1 1 2 0 0 | ACA 0 0 0 0 0 | Lys AAA 1 4 1 1 1 | Arg AGA 0 0 0 0 0
Met ATG 5 6 6 6 6 | ACG 3 3 3 3 3 | AAG 10 7 10 10 10 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 1 2 | Ala GCT 0 0 0 0 0 | Asp GAT 3 7 3 5 5 | Gly GGT 0 0 0 0 0
GTC 2 2 2 2 3 | GCC 6 6 4 6 6 | GAC 10 6 10 10 8 | GGC 2 2 3 2 2
GTA 0 1 1 1 0 | GCA 0 0 1 0 0 | Glu GAA 2 3 2 2 2 | GGA 1 3 2 2 2
GTG 7 6 6 7 6 | GCG 1 1 2 1 1 | GAG 8 7 8 7 8 | GGG 2 0 0 1 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.12667 C:0.47333 A:0.04667 G:0.35333
Average T:0.21778 C:0.27111 A:0.25556 G:0.25556
#2: D_sechellia_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.12000 C:0.49333 A:0.04667 G:0.34000
Average T:0.21556 C:0.27778 A:0.25556 G:0.25111
#3: D_simulans_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.11333 C:0.48667 A:0.05333 G:0.34667
Average T:0.21333 C:0.27556 A:0.25778 G:0.25333
#4: D_yakuba_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.11333 C:0.50000 A:0.04667 G:0.34000
Average T:0.21333 C:0.28000 A:0.25556 G:0.25111
#5: D_erecta_zetaCOP-PC
position 1: T:0.16000 C:0.20000 A:0.33333 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.11333 C:0.48000 A:0.05333 G:0.35333
Average T:0.21778 C:0.27111 A:0.25556 G:0.25556
#6: D_takahashii_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34667 G:0.30000
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.08667 C:0.51333 A:0.05333 G:0.34667
Average T:0.20444 C:0.28444 A:0.26000 G:0.25111
#7: D_biarmipes_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.07333 C:0.52667 A:0.03333 G:0.36667
Average T:0.20000 C:0.28889 A:0.25111 G:0.26000
#8: D_eugracilis_zetaCOP-PC
position 1: T:0.15333 C:0.20000 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.10667 C:0.48000 A:0.09333 G:0.32000
Average T:0.21333 C:0.27111 A:0.27111 G:0.24444
#9: D_ficusphila_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.08000 C:0.51333 A:0.06667 G:0.34000
Average T:0.20222 C:0.28444 A:0.26222 G:0.25111
#10: D_rhopaloa_zetaCOP-PC
position 1: T:0.14667 C:0.20000 A:0.34000 G:0.31333
position 2: T:0.37333 C:0.14000 A:0.38000 G:0.10667
position 3: T:0.09333 C:0.50000 A:0.05333 G:0.35333
Average T:0.20444 C:0.28000 A:0.25778 G:0.25778
#11: D_elegans_zetaCOP-PC
position 1: T:0.14667 C:0.20667 A:0.34000 G:0.30667
position 2: T:0.38000 C:0.13333 A:0.38000 G:0.10667
position 3: T:0.07333 C:0.53333 A:0.05333 G:0.34000
Average T:0.20000 C:0.29111 A:0.25778 G:0.25111
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 9 | Ser S TCT 2 | Tyr Y TAT 1 | Cys C TGT 1
TTC 46 | TCC 51 | TAC 66 | TGC 43
Leu L TTA 0 | TCA 1 | *** * TAA 0 | *** * TGA 0
TTG 13 | TCG 12 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 2 | His H CAT 0 | Arg R CGT 2
CTC 67 | CCC 16 | CAC 11 | CGC 50
CTA 5 | CCA 3 | Gln Q CAA 2 | CGA 3
CTG 144 | CCG 1 | CAG 31 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 37 | Thr T ACT 1 | Asn N AAT 20 | Ser S AGT 0
ATC 117 | ACC 22 | AAC 121 | AGC 22
ATA 8 | ACA 0 | Lys K AAA 15 | Arg R AGA 0
Met M ATG 59 | ACG 33 | AAG 106 | AGG 0
------------------------------------------------------------------------------
Val V GTT 26 | Ala A GCT 1 | Asp D GAT 62 | Gly G GGT 0
GTC 16 | GCC 63 | GAC 85 | GGC 29
GTA 3 | GCA 3 | Glu E GAA 26 | GGA 21
GTG 75 | GCG 10 | GAG 81 | GGG 5
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14848 C:0.20485 A:0.34000 G:0.30667
position 2: T:0.37939 C:0.13394 A:0.38000 G:0.10667
position 3: T:0.10000 C:0.50000 A:0.05455 G:0.34545
Average T:0.20929 C:0.27960 A:0.25818 G:0.25293
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_zetaCOP-PC
D_sechellia_zetaCOP-PC 0.0349 (0.0029 0.0826)
D_simulans_zetaCOP-PC -1.0000 (0.0000 0.0717) 0.0963 (0.0029 0.0299)
D_yakuba_zetaCOP-PC 0.0164 (0.0029 0.1757)-1.0000 (0.0000 0.1635) 0.0176 (0.0029 0.1635)
D_erecta_zetaCOP-PC 0.0190 (0.0029 0.1513) 0.0353 (0.0058 0.1635) 0.0176 (0.0029 0.1634) 0.0549 (0.0058 0.1051)
D_takahashii_zetaCOP-PC 0.0150 (0.0043 0.2888) 0.0263 (0.0072 0.2748) 0.0150 (0.0043 0.2890) 0.0327 (0.0072 0.2208) 0.0262 (0.0072 0.2753)
D_biarmipes_zetaCOP-PC -1.0000 (0.0000 0.2398) 0.0135 (0.0029 0.2135)-1.0000 (0.0000 0.2265) 0.0127 (0.0029 0.2271) 0.0120 (0.0029 0.2404) 0.0255 (0.0043 0.1696)
D_eugracilis_zetaCOP-PC 0.0093 (0.0029 0.3112) 0.0215 (0.0058 0.2682) 0.0092 (0.0029 0.3114) 0.0185 (0.0058 0.3122) 0.0194 (0.0058 0.2973) 0.0226 (0.0058 0.2547) 0.0097 (0.0029 0.2968)
D_ficusphila_zetaCOP-PC 0.0097 (0.0029 0.2979) 0.0193 (0.0058 0.2982) 0.0096 (0.0029 0.2980) 0.0193 (0.0058 0.2988) 0.0193 (0.0058 0.2987) 0.0260 (0.0072 0.2770) 0.0119 (0.0029 0.2418)-1.0000 (0.0000 0.3292)
D_rhopaloa_zetaCOP-PC 0.0597 (0.0150 0.2514) 0.0480 (0.0121 0.2517) 0.0630 (0.0150 0.2380) 0.0431 (0.0121 0.2801) 0.0752 (0.0179 0.2385) 0.0837 (0.0194 0.2317) 0.0929 (0.0150 0.1614) 0.0390 (0.0121 0.3096) 0.0428 (0.0121 0.2817)
D_elegans_zetaCOP-PC 0.0108 (0.0029 0.2677) 0.0240 (0.0058 0.2405) 0.0113 (0.0029 0.2540) 0.0239 (0.0058 0.2410) 0.0227 (0.0058 0.2546) 0.0286 (0.0058 0.2013) 0.0164 (0.0029 0.1759)-1.0000 (0.0000 0.3426)-1.0000 (0.0000 0.3137) 0.0693 (0.0121 0.1740)
Model 0: one-ratio
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
check convergence..
lnL(ntime: 15 np: 17): -1143.646376 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.024796 0.032393 0.015749 0.039922 0.039051 0.056721 0.112923 0.070959 0.124288 0.107105 0.117232 0.093115 0.013092 0.019189 0.005934 1.464000 0.014623
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.87247
(1: 0.024796, ((4: 0.039922, 5: 0.039051): 0.015749, (6: 0.112923, 7: 0.070959, 8: 0.124288, 9: 0.107105, 10: 0.117232, 11: 0.093115): 0.056721): 0.032393, (2: 0.019189, 3: 0.005934): 0.013092);
(D_melanogaster_zetaCOP-PC: 0.024796, ((D_yakuba_zetaCOP-PC: 0.039922, D_erecta_zetaCOP-PC: 0.039051): 0.015749, (D_takahashii_zetaCOP-PC: 0.112923, D_biarmipes_zetaCOP-PC: 0.070959, D_eugracilis_zetaCOP-PC: 0.124288, D_ficusphila_zetaCOP-PC: 0.107105, D_rhopaloa_zetaCOP-PC: 0.117232, D_elegans_zetaCOP-PC: 0.093115): 0.056721): 0.032393, (D_sechellia_zetaCOP-PC: 0.019189, D_simulans_zetaCOP-PC: 0.005934): 0.013092);
Detailed output identifying parameters
kappa (ts/tv) = 1.46400
omega (dN/dS) = 0.01462
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.025 389.1 60.9 0.0146 0.0008 0.0559 0.3 3.4
12..13 0.032 389.1 60.9 0.0146 0.0011 0.0730 0.4 4.4
13..14 0.016 389.1 60.9 0.0146 0.0005 0.0355 0.2 2.2
14..4 0.040 389.1 60.9 0.0146 0.0013 0.0900 0.5 5.5
14..5 0.039 389.1 60.9 0.0146 0.0013 0.0880 0.5 5.4
13..15 0.057 389.1 60.9 0.0146 0.0019 0.1278 0.7 7.8
15..6 0.113 389.1 60.9 0.0146 0.0037 0.2545 1.4 15.5
15..7 0.071 389.1 60.9 0.0146 0.0023 0.1599 0.9 9.7
15..8 0.124 389.1 60.9 0.0146 0.0041 0.2801 1.6 17.0
15..9 0.107 389.1 60.9 0.0146 0.0035 0.2414 1.4 14.7
15..10 0.117 389.1 60.9 0.0146 0.0039 0.2642 1.5 16.1
15..11 0.093 389.1 60.9 0.0146 0.0031 0.2098 1.2 12.8
12..16 0.013 389.1 60.9 0.0146 0.0004 0.0295 0.2 1.8
16..2 0.019 389.1 60.9 0.0146 0.0006 0.0432 0.2 2.6
16..3 0.006 389.1 60.9 0.0146 0.0002 0.0134 0.1 0.8
tree length for dN: 0.0288
tree length for dS: 1.9662
Time used: 0:05
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
lnL(ntime: 15 np: 18): -1131.018230 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.026108 0.035438 0.016112 0.041957 0.041279 0.052877 0.110495 0.071550 0.131367 0.113658 0.123455 0.097498 0.013827 0.020206 0.006253 1.563836 0.976956 0.003773
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.90208
(1: 0.026108, ((4: 0.041957, 5: 0.041279): 0.016112, (6: 0.110495, 7: 0.071550, 8: 0.131367, 9: 0.113658, 10: 0.123455, 11: 0.097498): 0.052877): 0.035438, (2: 0.020206, 3: 0.006253): 0.013827);
(D_melanogaster_zetaCOP-PC: 0.026108, ((D_yakuba_zetaCOP-PC: 0.041957, D_erecta_zetaCOP-PC: 0.041279): 0.016112, (D_takahashii_zetaCOP-PC: 0.110495, D_biarmipes_zetaCOP-PC: 0.071550, D_eugracilis_zetaCOP-PC: 0.131367, D_ficusphila_zetaCOP-PC: 0.113658, D_rhopaloa_zetaCOP-PC: 0.123455, D_elegans_zetaCOP-PC: 0.097498): 0.052877): 0.035438, (D_sechellia_zetaCOP-PC: 0.020206, D_simulans_zetaCOP-PC: 0.006253): 0.013827);
Detailed output identifying parameters
kappa (ts/tv) = 1.56384
dN/dS (w) for site classes (K=2)
p: 0.97696 0.02304
w: 0.00377 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.026 388.4 61.6 0.0267 0.0015 0.0544 0.6 3.4
12..13 0.035 388.4 61.6 0.0267 0.0020 0.0739 0.8 4.5
13..14 0.016 388.4 61.6 0.0267 0.0009 0.0336 0.3 2.1
14..4 0.042 388.4 61.6 0.0267 0.0023 0.0874 0.9 5.4
14..5 0.041 388.4 61.6 0.0267 0.0023 0.0860 0.9 5.3
13..15 0.053 388.4 61.6 0.0267 0.0029 0.1102 1.1 6.8
15..6 0.110 388.4 61.6 0.0267 0.0062 0.2303 2.4 14.2
15..7 0.072 388.4 61.6 0.0267 0.0040 0.1491 1.5 9.2
15..8 0.131 388.4 61.6 0.0267 0.0073 0.2738 2.8 16.9
15..9 0.114 388.4 61.6 0.0267 0.0063 0.2369 2.5 14.6
15..10 0.123 388.4 61.6 0.0267 0.0069 0.2573 2.7 15.8
15..11 0.097 388.4 61.6 0.0267 0.0054 0.2032 2.1 12.5
12..16 0.014 388.4 61.6 0.0267 0.0008 0.0288 0.3 1.8
16..2 0.020 388.4 61.6 0.0267 0.0011 0.0421 0.4 2.6
16..3 0.006 388.4 61.6 0.0267 0.0003 0.0130 0.1 0.8
Time used: 0:16
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
check convergence..
lnL(ntime: 15 np: 20): -1131.018230 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.026108 0.035438 0.016112 0.041957 0.041279 0.052877 0.110495 0.071550 0.131367 0.113658 0.123455 0.097498 0.013827 0.020206 0.006253 1.563837 0.976956 0.023044 0.003773 109.292222
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.90208
(1: 0.026108, ((4: 0.041957, 5: 0.041279): 0.016112, (6: 0.110495, 7: 0.071550, 8: 0.131367, 9: 0.113658, 10: 0.123455, 11: 0.097498): 0.052877): 0.035438, (2: 0.020206, 3: 0.006253): 0.013827);
(D_melanogaster_zetaCOP-PC: 0.026108, ((D_yakuba_zetaCOP-PC: 0.041957, D_erecta_zetaCOP-PC: 0.041279): 0.016112, (D_takahashii_zetaCOP-PC: 0.110495, D_biarmipes_zetaCOP-PC: 0.071550, D_eugracilis_zetaCOP-PC: 0.131367, D_ficusphila_zetaCOP-PC: 0.113658, D_rhopaloa_zetaCOP-PC: 0.123455, D_elegans_zetaCOP-PC: 0.097498): 0.052877): 0.035438, (D_sechellia_zetaCOP-PC: 0.020206, D_simulans_zetaCOP-PC: 0.006253): 0.013827);
Detailed output identifying parameters
kappa (ts/tv) = 1.56384
dN/dS (w) for site classes (K=3)
p: 0.97696 0.02304 0.00000
w: 0.00377 1.00000 109.29222
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.026 388.4 61.6 0.0267 0.0015 0.0544 0.6 3.4
12..13 0.035 388.4 61.6 0.0267 0.0020 0.0739 0.8 4.5
13..14 0.016 388.4 61.6 0.0267 0.0009 0.0336 0.3 2.1
14..4 0.042 388.4 61.6 0.0267 0.0023 0.0874 0.9 5.4
14..5 0.041 388.4 61.6 0.0267 0.0023 0.0860 0.9 5.3
13..15 0.053 388.4 61.6 0.0267 0.0029 0.1102 1.1 6.8
15..6 0.110 388.4 61.6 0.0267 0.0062 0.2303 2.4 14.2
15..7 0.072 388.4 61.6 0.0267 0.0040 0.1491 1.5 9.2
15..8 0.131 388.4 61.6 0.0267 0.0073 0.2738 2.8 16.9
15..9 0.114 388.4 61.6 0.0267 0.0063 0.2369 2.5 14.6
15..10 0.123 388.4 61.6 0.0267 0.0069 0.2573 2.7 15.8
15..11 0.097 388.4 61.6 0.0267 0.0054 0.2032 2.1 12.5
12..16 0.014 388.4 61.6 0.0267 0.0008 0.0288 0.3 1.8
16..2 0.020 388.4 61.6 0.0267 0.0011 0.0421 0.4 2.6
16..3 0.006 388.4 61.6 0.0267 0.0003 0.0130 0.1 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaCOP-PC)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.274 0.119 0.086 0.077 0.075 0.074 0.074 0.073 0.073 0.073
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 0:55
Model 3: discrete (3 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
check convergence..
lnL(ntime: 15 np: 21): -1130.423813 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.025593 0.034162 0.016336 0.041231 0.040451 0.054558 0.111624 0.071260 0.128152 0.110509 0.120423 0.095209 0.013536 0.019808 0.006123 1.501378 0.002006 0.971010 0.003177 0.003187 0.600597
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.88898
(1: 0.025593, ((4: 0.041231, 5: 0.040451): 0.016336, (6: 0.111624, 7: 0.071260, 8: 0.128152, 9: 0.110509, 10: 0.120423, 11: 0.095209): 0.054558): 0.034162, (2: 0.019808, 3: 0.006123): 0.013536);
(D_melanogaster_zetaCOP-PC: 0.025593, ((D_yakuba_zetaCOP-PC: 0.041231, D_erecta_zetaCOP-PC: 0.040451): 0.016336, (D_takahashii_zetaCOP-PC: 0.111624, D_biarmipes_zetaCOP-PC: 0.071260, D_eugracilis_zetaCOP-PC: 0.128152, D_ficusphila_zetaCOP-PC: 0.110509, D_rhopaloa_zetaCOP-PC: 0.120423, D_elegans_zetaCOP-PC: 0.095209): 0.054558): 0.034162, (D_sechellia_zetaCOP-PC: 0.019808, D_simulans_zetaCOP-PC: 0.006123): 0.013536);
Detailed output identifying parameters
kappa (ts/tv) = 1.50138
dN/dS (w) for site classes (K=3)
p: 0.00201 0.97101 0.02698
w: 0.00318 0.00319 0.60060
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.026 388.9 61.1 0.0193 0.0011 0.0559 0.4 3.4
12..13 0.034 388.9 61.1 0.0193 0.0014 0.0746 0.6 4.6
13..14 0.016 388.9 61.1 0.0193 0.0007 0.0357 0.3 2.2
14..4 0.041 388.9 61.1 0.0193 0.0017 0.0901 0.7 5.5
14..5 0.040 388.9 61.1 0.0193 0.0017 0.0884 0.7 5.4
13..15 0.055 388.9 61.1 0.0193 0.0023 0.1192 0.9 7.3
15..6 0.112 388.9 61.1 0.0193 0.0047 0.2439 1.8 14.9
15..7 0.071 388.9 61.1 0.0193 0.0030 0.1557 1.2 9.5
15..8 0.128 388.9 61.1 0.0193 0.0054 0.2800 2.1 17.1
15..9 0.111 388.9 61.1 0.0193 0.0047 0.2415 1.8 14.8
15..10 0.120 388.9 61.1 0.0193 0.0051 0.2631 2.0 16.1
15..11 0.095 388.9 61.1 0.0193 0.0040 0.2080 1.6 12.7
12..16 0.014 388.9 61.1 0.0193 0.0006 0.0296 0.2 1.8
16..2 0.020 388.9 61.1 0.0193 0.0008 0.0433 0.3 2.6
16..3 0.006 388.9 61.1 0.0193 0.0003 0.0134 0.1 0.8
Naive Empirical Bayes (NEB) analysis
Time used: 1:19
Model 7: beta (10 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
lnL(ntime: 15 np: 18): -1132.536572 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.025541 0.033568 0.016448 0.041211 0.040415 0.057348 0.114685 0.072465 0.128002 0.110145 0.120406 0.095343 0.013501 0.019778 0.006112 1.475320 0.011028 0.273894
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89497
(1: 0.025541, ((4: 0.041211, 5: 0.040415): 0.016448, (6: 0.114685, 7: 0.072465, 8: 0.128002, 9: 0.110145, 10: 0.120406, 11: 0.095343): 0.057348): 0.033568, (2: 0.019778, 3: 0.006112): 0.013501);
(D_melanogaster_zetaCOP-PC: 0.025541, ((D_yakuba_zetaCOP-PC: 0.041211, D_erecta_zetaCOP-PC: 0.040415): 0.016448, (D_takahashii_zetaCOP-PC: 0.114685, D_biarmipes_zetaCOP-PC: 0.072465, D_eugracilis_zetaCOP-PC: 0.128002, D_ficusphila_zetaCOP-PC: 0.110145, D_rhopaloa_zetaCOP-PC: 0.120406, D_elegans_zetaCOP-PC: 0.095343): 0.057348): 0.033568, (D_sechellia_zetaCOP-PC: 0.019778, D_simulans_zetaCOP-PC: 0.006112): 0.013501);
Detailed output identifying parameters
kappa (ts/tv) = 1.47532
Parameters in M7 (beta):
p = 0.01103 q = 0.27389
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.20081
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.026 389.0 61.0 0.0201 0.0011 0.0557 0.4 3.4
12..13 0.034 389.0 61.0 0.0201 0.0015 0.0732 0.6 4.5
13..14 0.016 389.0 61.0 0.0201 0.0007 0.0359 0.3 2.2
14..4 0.041 389.0 61.0 0.0201 0.0018 0.0899 0.7 5.5
14..5 0.040 389.0 61.0 0.0201 0.0018 0.0882 0.7 5.4
13..15 0.057 389.0 61.0 0.0201 0.0025 0.1251 1.0 7.6
15..6 0.115 389.0 61.0 0.0201 0.0050 0.2502 2.0 15.2
15..7 0.072 389.0 61.0 0.0201 0.0032 0.1581 1.2 9.6
15..8 0.128 389.0 61.0 0.0201 0.0056 0.2792 2.2 17.0
15..9 0.110 389.0 61.0 0.0201 0.0048 0.2403 1.9 14.6
15..10 0.120 389.0 61.0 0.0201 0.0053 0.2626 2.1 16.0
15..11 0.095 389.0 61.0 0.0201 0.0042 0.2080 1.6 12.7
12..16 0.014 389.0 61.0 0.0201 0.0006 0.0295 0.2 1.8
16..2 0.020 389.0 61.0 0.0201 0.0009 0.0431 0.3 2.6
16..3 0.006 389.0 61.0 0.0201 0.0003 0.0133 0.1 0.8
Time used: 2:36
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, ((4, 5), (6, 7, 8, 9, 10, 11)), (2, 3)); MP score: 116
check convergence..
lnL(ntime: 15 np: 20): -1132.537981 +0.000000
12..1 12..13 13..14 14..4 14..5 13..15 15..6 15..7 15..8 15..9 15..10 15..11 12..16 16..2 16..3
0.025553 0.033570 0.016450 0.041218 0.040432 0.057351 0.114700 0.072439 0.128042 0.110173 0.120404 0.095335 0.013506 0.019778 0.006115 1.475280 0.999990 0.011068 0.275093 3.357605
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.89507
(1: 0.025553, ((4: 0.041218, 5: 0.040432): 0.016450, (6: 0.114700, 7: 0.072439, 8: 0.128042, 9: 0.110173, 10: 0.120404, 11: 0.095335): 0.057351): 0.033570, (2: 0.019778, 3: 0.006115): 0.013506);
(D_melanogaster_zetaCOP-PC: 0.025553, ((D_yakuba_zetaCOP-PC: 0.041218, D_erecta_zetaCOP-PC: 0.040432): 0.016450, (D_takahashii_zetaCOP-PC: 0.114700, D_biarmipes_zetaCOP-PC: 0.072439, D_eugracilis_zetaCOP-PC: 0.128042, D_ficusphila_zetaCOP-PC: 0.110173, D_rhopaloa_zetaCOP-PC: 0.120404, D_elegans_zetaCOP-PC: 0.095335): 0.057351): 0.033570, (D_sechellia_zetaCOP-PC: 0.019778, D_simulans_zetaCOP-PC: 0.006115): 0.013506);
Detailed output identifying parameters
kappa (ts/tv) = 1.47528
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.01107 q = 0.27509
(p1 = 0.00001) w = 3.35760
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.20081 3.35760
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.026 389.0 61.0 0.0201 0.0011 0.0557 0.4 3.4
12..13 0.034 389.0 61.0 0.0201 0.0015 0.0732 0.6 4.5
13..14 0.016 389.0 61.0 0.0201 0.0007 0.0359 0.3 2.2
14..4 0.041 389.0 61.0 0.0201 0.0018 0.0899 0.7 5.5
14..5 0.040 389.0 61.0 0.0201 0.0018 0.0882 0.7 5.4
13..15 0.057 389.0 61.0 0.0201 0.0025 0.1251 1.0 7.6
15..6 0.115 389.0 61.0 0.0201 0.0050 0.2501 2.0 15.2
15..7 0.072 389.0 61.0 0.0201 0.0032 0.1580 1.2 9.6
15..8 0.128 389.0 61.0 0.0201 0.0056 0.2792 2.2 17.0
15..9 0.110 389.0 61.0 0.0201 0.0048 0.2403 1.9 14.6
15..10 0.120 389.0 61.0 0.0201 0.0053 0.2626 2.1 16.0
15..11 0.095 389.0 61.0 0.0201 0.0042 0.2079 1.6 12.7
12..16 0.014 389.0 61.0 0.0201 0.0006 0.0295 0.2 1.8
16..2 0.020 389.0 61.0 0.0201 0.0009 0.0431 0.3 2.6
16..3 0.006 389.0 61.0 0.0201 0.0003 0.0133 0.1 0.8
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_zetaCOP-PC)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.001 0.012 0.064 0.238 0.684
ws: 0.250 0.116 0.088 0.081 0.078 0.078 0.077 0.077 0.077 0.077
Time used: 4:05
Model 1: NearlyNeutral -1131.01823 Model 2: PositiveSelection -1131.01823 Model 0: one-ratio -1143.646376 Model 3: discrete -1130.423813 Model 7: beta -1132.536572 Model 8: beta&w>1 -1132.537981 Model 0 vs 1 25.25629200000003 Model 2 vs 1 0.0 Model 8 vs 7 0.002817999999933818
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
